A Retrospective Analysis Reveals That the 2021 Outbreaks of African Swine Fever Virus in Ghana Were Caused by Two Distinct Genotypes
Abstract
:1. Introduction
2. Materials and Methods
2.1. Next-Generation Sequencing
2.2. Genome Assembly and SNP Detection
2.3. Annotation of Genome
2.4. Genome Alignment
2.5. Protein Alignment
3. Results
3.1. Characteristics of Collected 2021 Outbreak Samples
3.2. Genotyping of ASFV Isolates
3.3. ASFV Full-Genome Alignments
3.4. Genetic Variation among Ghana 2021 Genotype 2 Isolates
3.5. Genetic Variation among Ghana 2021 Genotype 1 Isolates
4. Discussion
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
References
- Danzetta, M.L.; Marenzoni, M.L.; Iannetti, S.; Tizzani, P.; Calistri, P.; Feliziani, F. African Swine Fever: Lessons to Learn from Past Eradication Experiences. A Systematic Review. Front. Vet. Sci. 2020, 7, 296. [Google Scholar] [CrossRef] [PubMed]
- Mighell, E.; Ward, M.P. African Swine Fever spread across Asia, 2018–2019. Transbound. Emerg. Dis. 2021, 68, 2722–2732. [Google Scholar] [CrossRef] [PubMed]
- Spinard, E.; O’Donnell, V.; Vuono, E.; Rai, A.; Davis, C.; Ramirez-Medina, E.; Espinoza, N.; Valladares, A.; Borca, M.V.; Gladue, D.P. Full genome sequence for the African swine fever virus outbreak in the Dominican Republic in 1980. Sci. Rep. 2023, 13, 1024. [Google Scholar] [CrossRef] [PubMed]
- Ramirez-Medina, E.; O’Donnell, V.; Silva, E.; Espinoza, N.; Velazquez-Salinas, L.; Moran, K.; Daite, D.A.; Barrette, R.; Faburay, B.; Holland, R.; et al. Experimental Infection of Domestic Pigs with an African Swine Fever Virus Field Strain Isolated in 2021 from the Dominican Republic. Viruses 2022, 14, 1090. [Google Scholar] [CrossRef] [PubMed]
- Chapman, D.A.; Tcherepanov, V.; Upton, C.; Dixon, L.K. Comparison of the genome sequences of non-pathogenic and pathogenic African swine fever virus isolates. J. Gen. Virol. 2008, 89, 397–408. [Google Scholar] [CrossRef] [PubMed]
- Spinard, E.; Azzinaro, P.; Rai, A.; Espinoza, N.; Ramirez-Medina, E.; Valladares, A.; Borca, M.V.; Gladue, D.P. Complete Structural Predictions of the Proteome of African Swine Fever Virus Strain Georgia 2007. Microbiol. Resour. Announc. 2022, 11, e0088122. [Google Scholar] [CrossRef] [PubMed]
- Blasco, R.; Aguero, M.; Almendral, J.M.; Vinuela, E. Variable and Constant Regions in African Swine Fever Virus-DNA. Virology 1989, 168, 330–338. [Google Scholar] [CrossRef]
- de la Vega, I.; Vinuela, E.; Blasco, R. Genetic variation and multigene families in African swine fever virus. Virology 1990, 179, 234–246. [Google Scholar] [CrossRef]
- Zhu, Z.Z.; Chen, H.T.; Liu, L.; Cao, Y.; Jiang, T.J.; Zou, Y.Q.; Peng, Y.S. Classification and characterization of multigene family proteins of African swine fever viruses. Brief. Bioinform. 2021, 22, bbaa380. [Google Scholar] [CrossRef]
- Dixon, L.K.; Twigg, S.R.F.; Baylis, S.A.; Vydelingum, S.; Bristow, C.; Hammond, J.M.; Smith, G.L. Nucleotide-Sequence of a 55 Kbp Region from the Right End of the Genome of a Pathogenic African Swine Fever Virus Isolate (Malawi Lil20/1). J. Gen. Virol. 1994, 75, 1655–1684. [Google Scholar] [CrossRef]
- Masembe, C.; Phan, M.V.T.; Robertson, D.L.; Cotten, M. Increased resolution of African swine fever virus genome patterns based on profile HMMs of protein domains. Virus. Evol. 2020, 6, veaa044. [Google Scholar] [CrossRef] [PubMed]
- Brown, A.A.; Penrith, M.L.; Fasina, F.O.; Beltran-Alcrudo, D. The African swine fever epidemic in West Africa, 1996–2002. Transbound. Emerg. Dis. 2018, 65, 64–76. [Google Scholar] [CrossRef] [PubMed]
- Zani, L.; Forth, J.H.; Forth, L.; Nurmoja, I.; Leidenberger, S.; Henke, J.; Carlson, J.; Breidenstein, C.; Viltrop, A.; Hoper, D.; et al. Deletion at the 5’-end of Estonian ASFV strains associated with an attenuated phenotype. Sci. Rep. 2018, 8, 6510. [Google Scholar] [CrossRef] [PubMed]
- Sun, Y.K.; Xu, Z.Y.; Gao, H.; Xu, S.J.; Liu, J.; Xing, J.B.; Kuang, Q.Y.; Chen, Y.; Wang, H.; Zhang, G.H. Detection of a Novel African Swine Fever Virus with Three Large-Fragment Deletions in Genome, China. Microbiol. Spectr. 2022, 10, e02155-22. [Google Scholar] [CrossRef] [PubMed]
- Ambagala, A.; Goonewardene, K.; Lamboo, L.; Goolia, M.; Erdelyan, C.; Fisher, M.; Handel, K.; Lung, O.; Blome, S.; King, J.; et al. Characterization of a Novel African Swine Fever Virus p72 Genotype II from Nigeria. Viruses 2023, 15, 915. [Google Scholar] [CrossRef] [PubMed]
- Bastos, A.D.; Penrith, M.L.; Cruciere, C.; Edrich, J.L.; Hutchings, G.; Roger, F.; Couacy-Hymann, E.; Thomson, G.R. Genotyping field strains of African swine fever virus by partial p72 gene characterisation. Arch. Virol. 2003, 148, 693–706. [Google Scholar] [CrossRef] [PubMed]
- Njau, E.P.; Machuka, E.M.; Cleaveland, S.; Shirima, G.M.; Kusiluka, L.J.; Okoth, E.A.; Pelle, R. African Swine Fever Virus (ASFV): Biology, Genomics and Genotypes Circulating in Sub-Saharan Africa. Viruses 2021, 13, 2285. [Google Scholar] [CrossRef] [PubMed]
- Spinard, E.; Dinhobl, M.; Tesler, N.; Birtley, H.; Signore, A.V.; Ambagala, A.; Masembe, C.; Borca, M.V.; Gladue, D.P. A Re-Evaluation of African Swine Fever Genotypes Based on p72 Sequences Reveals the Existence of Only Six Distinct p72 Groups. Viruses 2023, 15, 2246. [Google Scholar] [CrossRef] [PubMed]
- Dinhobl, M.; Spinard, E.; Birtley, H.; Tesler, N.; Borca, M.V.; Gladue, D.P. African swine fever virus P72 genotyping tool. Microbiol. Resour. Announc. 2024, 13, e0089123. [Google Scholar] [CrossRef] [PubMed]
- Qu, H.; Ge, S.; Zhang, Y.; Wu, X.; Wang, Z. A systematic review of genotypes and serogroups of African swine fever virus. Virus Genes 2022, 58, 77–87. [Google Scholar] [CrossRef]
- Dinhobl, M.; Spinard, E.; Tesler, N.; Birtley, H.; Signore, A.; Ambagala, A.; Masembe, C.; Borca, M.V.; Gladue, D.P. Reclassification of ASFV into 7 Biotypes Using Unsupervised Machine Learning. Viruses 2023, 16, 67. [Google Scholar] [CrossRef] [PubMed]
- Zhao, D.; Sun, E.; Huang, L.; Ding, L.; Zhu, Y.; Zhang, J.; Shen, D.; Zhang, X.; Zhang, Z.; Ren, T.; et al. Highly lethal genotype I and II recombinant African swine fever viruses detected in pigs. Nat. Commun. 2023, 14, 3096. [Google Scholar] [CrossRef] [PubMed]
- Penrith, M.L.; Van Heerden, J.; Heath, L.; Abworo, E.O.; Bastos, A.D.S. Review of the Pig-Adapted African Swine Fever Viruses in and Outside Africa. Pathogens 2022, 11, 1190. [Google Scholar] [CrossRef] [PubMed]
- Spinard, E.; Rai, A.; Osei-Bonsu, J.; O’Donnell, V.; Ababio, P.T.; Tawiah-Yingar, D.; Arthur, D.; Baah, D.; Ramirez-Medina, E.; Espinoza, N.; et al. The 2022 Outbreaks of African Swine Fever Virus Demonstrate the First Report of Genotype II in Ghana. Viruses 2023, 15, 1722. [Google Scholar] [CrossRef]
- Borca, M.V.; Berggren, K.A.; Ramirez-Medina, E.; Vuono, E.A.; Gladue, D.P. CRISPR/Cas Gene Editing of a Large DNA Virus: African Swine Fever Virus. Bio-Protoc. 2018, 8, e2978. [Google Scholar] [CrossRef] [PubMed]
- Borca, M.V.; Holinka, L.G.; Berggren, K.A.; Gladue, D.P. CRISPR-Cas9, a tool to efficiently increase the development of recombinant African swine fever viruses. Sci. Rep. 2018, 8, 3154. [Google Scholar] [CrossRef] [PubMed]
- Tcherepanov, V.; Ehlers, A.; Upton, C. Genome Annotation Transfer Utility (GATU): Rapid annotation of viral genomes using a closely related reference genome. BMC Genom. 2006, 7, 150. [Google Scholar] [CrossRef] [PubMed]
- Edgar, R.C. MUSCLE: Multiple sequence alignment with high accuracy and high throughput. Nucleic Acids Res. 2004, 32, 1792–1797. [Google Scholar] [CrossRef] [PubMed]
- Reis, A.L.; Abrams, C.C.; Goatley, L.C.; Netherton, C.; Chapman, D.G.; Sanchez-Cordon, P.; Dixon, L.K. Deletion of African swine fever virus interferon inhibitors from the genome of a virulent isolate reduces virulence in domestic pigs and induces a protective response. Vaccine 2016, 34, 4698–4705. [Google Scholar] [CrossRef]
- Gil, S.; Sepulveda, N.; Albina, E.; Leitao, A.; Martins, C. The low-virulent African swine fever virus (ASFV/NH/P68) induces enhanced expression and production of relevant regulatory cytokines (IFNalpha, TNFalpha and IL12p40) on porcine macrophages in comparison to the highly virulent ASFV/L60. Arch. Virol. 2008, 153, 1845–1854. [Google Scholar] [CrossRef]
- Leitao, A.; Cartaxeiro, C.; Coelho, R.; Cruz, B.; Parkhouse, R.M.E.; Portugal, F.C.; Vigario, J.D.; Martins, C.L.V. The non-haemadsorbing African swine fever virus isolate ASFV/NH/P68 provides a model for defining the protective anti-virus immune response. J. Gen. Virol. 2001, 82, 513–523. [Google Scholar] [CrossRef]
- Camacho, C.; Coulouris, G.; Avagyan, V.; Ma, N.; Papadopoulos, J.; Bealer, K.; Madden, T.L. BLAST+: Architecture and applications. BMC Bioinform. 2009, 10, 421. [Google Scholar] [CrossRef] [PubMed]
- Zhang, Z.; Schwartz, S.; Wagner, L.; Miller, W. A greedy algorithm for aligning DNA sequences. J. Comput. Biol. 2000, 7, 203–214. [Google Scholar] [CrossRef] [PubMed]
- Altschul, S.F.; Madden, T.L.; Schaffer, A.A.; Zhang, J.; Zhang, Z.; Miller, W.; Lipman, D.J. Gapped BLAST and PSI-BLAST: A new generation of protein database search programs. Nucleic Acids Res. 1997, 25, 3389–3402. [Google Scholar] [CrossRef] [PubMed]
- Altschul, S.F.; Gish, W.; Miller, W.; Myers, E.W.; Lipman, D.J. Basic local alignment search tool. J. Mol. Biol. 1990, 215, 403–410. [Google Scholar] [CrossRef] [PubMed]
- Njau, E.P.; Entfellner, J.B.D.; Machuka, E.M.; Bochere, E.N.; Cleaveland, S.; Shirima, G.M.; Kusiluka, L.J.; Upton, C.; Bishop, R.P.; Pelle, R.; et al. The first genotype II African swine fever virus isolated in Africa provides insight into the current Eurasian pandemic. Sci. Rep. 2021, 11, 13081. [Google Scholar] [CrossRef] [PubMed]
- Gladue, D.P.; Borca, M.V. Recombinant ASF Live Attenuated Virus Strains as Experimental Vaccine Candidates. Viruses 2022, 14, 878. [Google Scholar] [CrossRef]
Isolate | GenBank Accession | Region | Date of Outbreak | Genotype (p72) |
---|---|---|---|---|
Ghana2021-01 | OR371517 | Savannah | 5-1-2021 | 1 |
Ghana2021-13 | OR371519 | Greater Accra | 17-3-2021 | 2 |
Ghana2021-27 | OR371520 | Bono East | 3-3-2021 | 2 |
Ghana2021-37 | OR371521 | Bono East | 20-9-2021 | 2 |
Ghana2021-41 | OR371522 | Eastern | 9-10-2021 | 2 |
Ghana2021-49 | OR371523 | Greater Accra | 17-11-2021 | 2 |
Ghana2021-57 | OR371524 | Eastern | 17-11-2021 | 2 |
Ghana2021-75 | OR371525 | Greater Accra | 17-7-2021 | 1 |
Ghana2021-81 | OR371526 | Ashanti | 23-4-2021 | 2 |
Ghana2021-87 | OR371527 | Central | 3-9-2021 | 2 |
Ghana2021-91 | OR371528 | Upper East | 8-6-2021 | 2 |
Ghana2021-95 | OR371529 | Volta | 10-11-2021 | 1 |
Ghana2021-105 | OR371518 | Oti | 11-8-2021 | 2 |
Genotype | Isolate | Reference | Total SNPs Compared with Reference | Total Nonsynonymous SNPs Compared with Reference |
---|---|---|---|---|
2 | Ghana2021-13 | Ghana2022-35 | 13 | 5 |
Ghana2021-27 | Ghana2022-35 | 15 | 7 | |
Ghana2021-37 | Ghana2022-35 | 20 | 5 | |
Ghana2021-41 | Ghana2022-35 | 22 | 7 | |
Ghana2021-49 | Ghana2022-35 | 23 | 8 | |
Ghana2021-57 | Ghana2022-35 | 20 | 8 | |
Ghana2021-81 | Ghana2022-35 | 5 | 3 | |
Ghana2021-87 | Ghana2022-35 | 5 | 3 | |
Ghana2021-91 | Ghana2022-35 | 10 | 6 | |
Ghana2021-105 | Ghana2022-35 | 15 | 9 | |
1 | Ghana2021-95 | Benin 97/1 | 63 | 25 |
Ghana2021-01 | Ghana2021-95 | 44 | 18 | |
Ghana2021-75 | Ghana2021-95 | 43 | 15 |
Ghana2021-13 | Ghana2021-27 | Ghana2021-37 | Ghana2021-41 | Ghana2021-49 | Ghana2021-57 | Ghana2021-81 | Ghana2021-87 | Ghana2021-91 | Ghana2021-105 | |
---|---|---|---|---|---|---|---|---|---|---|
A137R | S107N | |||||||||
C315R | Q30H | Q30H | ||||||||
C475L | Q148H | Q148H | ||||||||
C717R | K613N | K613N | K609T, EK612-613QN | |||||||
E146L | G39E | |||||||||
E199L | E125V | |||||||||
G1340L | R91H | |||||||||
K145R | Y116H | Y116H | Y116H | Y116H | ||||||
MGF 360-10L | E238D | |||||||||
MGF 360-13L | ATSTK262-266QHQPS, Ins283-283YAFST | ATSTK262-266QHQPS, Ins283-283YAFST | ATSTK262-266QHQPS, Ins283-283YAFST | ATSTK262-266QHQPS, Ins283-283YAFST | ATSTK262-266QHQPS, Ins283-283YAFST | ATSTK262-266QHQPS, Ins283-283YAFST | ||||
MGF 360-1L | fusion | fusion | ||||||||
MGF 360-2L | truncation | fusion | fusion | |||||||
MGF 505-1R | R450I | |||||||||
NP419L | P17S | |||||||||
P1192R | E39G |
Ghana2021-75 | Ghana2021-95 | Ghana2021-01 | |
---|---|---|---|
A859L | Truncation | ||
B169L | A152T | ||
B407L | Ins121-121GSIRN | Ins121-121GSIRN | Ins121-121GSIRN |
B602L | MAEFNIDELLKNVLEDPSTEISEETLKQLYQRTNPYKQFKNDSRVAFCSFTNLREQYIRRLIMTSFIGYVFKALQEW1-77Del | MAEFNIDELLKNVLEDPSTEISEETLKQLYQRTNPYKQFKNDSRVAFCSFTNLREQYIRRLIMTSFIGYVFKALQEW1-77Del | MAEFNIDELLKNVLEDPSTEISEETLKQLYQRTNPYKQFKNDSRVAFCSFTNLREQYIRRLIMTSFIGYVFKALQEW1-77Del |
C475L | P329L | ||
C84L | S12L | S12L | S12L |
E111R | A35T | A35T | A35T |
E183L | RPATN106-110Del | RPATN106-110Del | RPATN106-110Del |
E199L | T20I | T20I | |
E301R | M231T | M231T | M231T |
EP364R | A343V | ||
F1055L | V120I | V120I | V120I |
MGF_360-14L | AADFDRAQLIAHKAYMYNLSNIFLVKQLFSRDVTLVLDVTEPQEIYDMLKTYTSKNMKRAEEYLTAHPEI284-353GPPILIG-------------------------------------------------------HNSLRTKL, V355C, D357T | ||
MGF_360-16R | ECYST----------Y--304-309VLQHIILERKNIPLGLFL | ECYST---------Y--304-309VLQHILERKFNILGLIP | ECYST---------Y--304-309VLQHILERKFNILGLIP |
MGF_360-19R | ANINQAM269-275G------ | Na | ANINQAM269-275G------ |
MGF_360-1L | H58R | ||
MGF_360-6L | G94S | ||
MGF_505-9R | E283K | ||
NP1450L | P220L | P220L | P220L |
NP868R | L466F |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Rai, A.; Spinard, E.; Osei-Bonsu, J.; Meyers, A.; Dinhobl, M.; O’Donnell, V.; Ababio, P.T.; Tawiah-Yingar, D.; Arthur, D.; Baah, D.; et al. A Retrospective Analysis Reveals That the 2021 Outbreaks of African Swine Fever Virus in Ghana Were Caused by Two Distinct Genotypes. Viruses 2024, 16, 1265. https://doi.org/10.3390/v16081265
Rai A, Spinard E, Osei-Bonsu J, Meyers A, Dinhobl M, O’Donnell V, Ababio PT, Tawiah-Yingar D, Arthur D, Baah D, et al. A Retrospective Analysis Reveals That the 2021 Outbreaks of African Swine Fever Virus in Ghana Were Caused by Two Distinct Genotypes. Viruses. 2024; 16(8):1265. https://doi.org/10.3390/v16081265
Chicago/Turabian StyleRai, Ayushi, Edward Spinard, Jehadi Osei-Bonsu, Amanda Meyers, Mark Dinhobl, Vivian O’Donnell, Patrick T. Ababio, Daniel Tawiah-Yingar, Daniel Arthur, Daniel Baah, and et al. 2024. "A Retrospective Analysis Reveals That the 2021 Outbreaks of African Swine Fever Virus in Ghana Were Caused by Two Distinct Genotypes" Viruses 16, no. 8: 1265. https://doi.org/10.3390/v16081265