Proteo-Transcriptomic Analysis of the Venom Gland of the Cone Snail Cylinder canonicus Reveals the Origin of the Predatory-Evoked Venom
Abstract
:1. Introduction
2. Results and Interpretations
2.1. Venom Profiling: LC-MS Traces of Predatory-Evoked and Dissected Venoms
2.2. Venom Profiling: MALDI-TOF-MS of Predatory-Evoked and Dissected Venoms
2.3. Transcriptomics: mRNA Transcripts Expression in the Whole Venom Gland of Cylinder canonicus
2.4. Proteomics: Characterization of the Predatory-Evoked Venoms and Dissected Venom Duct Sections
3. Discussion
3.1. Characterization of Cylinder Canonicus’ Venom Through a Venomics Approach
3.2. Effect of the Instrumentation Chosen for Venom Profiling
3.3. Compartmentalization of the Venom Gland vs. Predatory Venom
3.4. Venom Characterization Through Transcriptomics and Proteomics
3.5. Identification of the Major Constituents of the Predatory-Evoked Venom
4. Conclusions
5. Materials and Methods
5.1. Cone Snail Collection and Venom Extraction
5.2. RNA Extraction and Sequencing
5.3. Transcriptome Annotation
5.4. Mass Spectrometry (MS)
5.5. Proteomics
5.6. Identification of Conotoxin in Venom Samples
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Puillandre, N.; Bouchet, P.; Duda, T.F.; Kauferstein, S.; Kohn, A.J.; Olivera, B.M.; Watkins, M.; Meyer, C. Molecular Phylogeny and Evolution of the Cone Snails (Gastropoda, Conoidea). Mol. Phylogenetics Evol. 2014, 78, 290–303. [Google Scholar] [CrossRef] [PubMed]
- Puillandre, N.; Duda, T.F.; Meyer, C.; Olivera, B.M.; Bouchet, P. One, Four or 100 Genera? A New Classification of the Cone Snails. J. Molluscan Stud. 2015, 81, 1–23. [Google Scholar] [CrossRef] [PubMed]
- Endean, R.; Rudkin, C. Further Studies of the Venoms of Conidae. Toxicon 1965, 2, 225–249. [Google Scholar] [CrossRef]
- Dutertre, S.; Jin, A.-H.; Vetter, I.; Hamilton, B.; Sunagar, K.; Lavergne, V.; Dutertre, V.; Fry, B.G.; Antunes, A.; Venter, D.J.; et al. Evolution of Separate Predation- and Defence-Evoked Venoms in Carnivorous Cone Snails. Nat. Commun. 2014, 5, 3521. [Google Scholar] [CrossRef] [PubMed]
- Gao, B.; Peng, C.; Yang, J.; Yi, Y.; Zhang, J.; Shi, Q. Cone Snails: A Big Store of Conotoxins for Novel Drug Discovery. Toxins 2017, 9, 397. [Google Scholar] [CrossRef]
- Möller, C.; Davis, W.C.; Clark, E.; DeCaprio, A.; Marí, F. Conodipine-P1-3, the First Phospholipases A2 Characterized from Injected Cone Snail Venom. Mol. Cell. Proteom. 2019, 18, 876–891. [Google Scholar] [CrossRef]
- Lin, Z.; Torres, J.P.; Watkins, M.; Paguigan, N.; Niu, C.; Imperial, J.S.; Tun, J.; Safavi-Hemami, H.; Finol-Urdaneta, R.K.; Neves, J.L.B.; et al. Non-Peptidic Small Molecule Components from Cone Snail Venoms. Front. Pharmacol. 2021, 12, 655981. [Google Scholar] [CrossRef]
- Jakubowski, J.A.; Kelley, W.P.; Sweedler, J.V.; Gilly, W.F.; Schulz, J.R. Intraspecific Variation of Venom Injected by Fish-Hunting Conus Snails. J. Exp. Biol. 2005, 208, 2873–2883. [Google Scholar] [CrossRef]
- Romeo, C.; Di Francesco, L.; Oliverio, M.; Palazzo, P.; Massilia, G.R.; Ascenzi, P.; Polticelli, F.; Schininà, M.E. Conus ventricosus Venom Peptides Profiling by HPLC-MS: A New Insight in the Intraspecific Variation. J. Sep. Sci. 2008, 31, 488–498. [Google Scholar] [CrossRef]
- Davis, J.; Jones, A.; Lewis, R.J. Remarkable Inter- and Intra-Species Complexity of Conotoxins Revealed by LC/MS. Peptides 2009, 30, 1222–1227. [Google Scholar] [CrossRef]
- Dutertre, S.; Biass, D.; Stöcklin, R.; Favreau, P. Dramatic Intraspecimen Variations within the Injected Venom of Conus consors: An Unsuspected Contribution to Venom Diversity. Toxicon 2010, 55, 1453–1462. [Google Scholar] [CrossRef] [PubMed]
- Himaya, S.W.A.; Jin, A.-H.; Hamilton, B.; Rai, S.K.; Alewood, P.; Lewis, R.J. Venom Duct Origins of Prey Capture and Defensive Conotoxins in Piscivorous Conus striatus. Sci. Rep. 2021, 11, 13282. [Google Scholar] [CrossRef]
- Buccitelli, C.; Selbach, M. mRNAs, Proteins and the Emerging Principles of Gene Expression Control. Nat. Rev. Genet. 2020, 21, 630–644. [Google Scholar] [CrossRef] [PubMed]
- Jin, A.-H.; Vetter, I.; Himaya, S.W.A.; Alewood, P.F.; Lewis, R.J.; Dutertre, S. Transcriptome and Proteome of Conus planorbis Identify the Nicotinic Receptors as Primary Target for the Defensive Venom. Proteomics 2015, 15, 4030–4040. [Google Scholar] [CrossRef] [PubMed]
- Prashanth, J.R.; Dutertre, S.; Jin, A.H.; Lavergne, V.; Hamilton, B.; Cardoso, F.C.; Griffin, J.; Venter, D.J.; Alewood, P.F.; Lewis, R.J. The Role of Defensive Ecological Interactions in the Evolution of Conotoxins. Mol. Ecol. 2016, 25, 598–615. [Google Scholar] [CrossRef]
- Kiener, L.C.; Barassin; Bocourt, F.; Camatte; Dien, P.; Egasse; Gontier; Giraud, P.F.E.; Lebrun, H.; Maubert; et al. Spécies Général et Iconographie Des Coquilles Vivantes : Comprenant La Collection Du Muséum d’histoire Naturelle de Paris, La Collection Lamarck, Celle Du Prince Masséna (Appartenant Maintenant à Le Baron Benjamin Delessert) et Les Découvertes Réecentes Des Voyageurs; Chez Rousseau: Paris, France, 1846; Volume 5, pp. 1–638. [Google Scholar]
- Abalde, S.; Dutertre, S.; Zardoya, R. A Combined Transcriptomics and Proteomics Approach Reveals the Differences in the Predatory and Defensive Venoms of the Molluscivorous Cone Snail Cylinder ammiralis (Caenogastropoda: Conidae). Toxins 2021, 13, 642. [Google Scholar] [CrossRef]
- Schendel, V.; Rash, L.D.; Jenner, R.A.; Undheim, E.A.B. The Diversity of Venom: The Importance of Behavior and Venom System Morphology in Understanding Its Ecology and Evolution. Toxins 2019, 11, 666. [Google Scholar] [CrossRef]
- Clark, A.E.; Kaleta, E.J.; Arora, A.; Wolk, D.M. Matrix-Assisted Laser Desorption Ionization–Time of Flight Mass Spectrometry: A Fundamental Shift in the Routine Practice of Clinical Microbiology. Clin. Microbiol. Rev. 2013, 26, 547–603. [Google Scholar] [CrossRef]
- Ramazi, S.; Zahiri, J. Post-Translational Modifications in Proteins: Resources, Tools and Prediction Methods. Database 2021, 2021, baab012. [Google Scholar] [CrossRef]
- Dutertre, S.; Jin, A.-H.; Alewood, P.F.; Lewis, R.J. Intraspecific Variations in Conus geographus Defence-Evoked Venom and Estimation of the Human Lethal Dose. Toxicon 2014, 91, 135–144. [Google Scholar] [CrossRef]
- Biass, D.; Dutertre, S.; Gerbault, A.; Menou, J.-L.; Offord, R.; Favreau, P.; Stöcklin, R. Comparative Proteomic Study of the Venom of the Piscivorous Cone Snail Conus consors. J. Proteom. 2009, 72, 210–218. [Google Scholar] [CrossRef] [PubMed]
- Rivera-Ortiz, J.A.; Cano, H.; Marí, F. Intraspecies Variability and Conopeptide Profiling of the Injected Venom of Conus ermineus. Peptides 2011, 32, 306–316. [Google Scholar] [CrossRef] [PubMed]
- Furey, A.; Moriarty, M.; Bane, V.; Kinsella, B.; Lehane, M. Ion Suppression; A Critical Review on Causes, Evaluation, Prevention and Applications. Talanta 2013, 115, 104–122. [Google Scholar] [CrossRef]
- Ferguson, R.E.; Carroll, H.P.; Harris, A.; Maher, E.R.; Selby, P.J.; Banks, R.E. Housekeeping Proteins: A Preliminary Study Illustrating Some Limitations as Useful References in Protein Expression Studies. Proteomics 2005, 5, 566–571. [Google Scholar] [CrossRef]
- Ménez, A.; Stöcklin, R.; Mebs, D. ‘Venomics’ or: The Venomous Systems Genome Project. Toxicon 2006, 47, 255–259. [Google Scholar] [CrossRef]
- Bhutani, N.; Venkatraman, P.; Goldberg, A.L. Puromycin-Sensitive Aminopeptidase Is the Major Peptidase Responsible for Digesting Polyglutamine Sequences Released by Proteasomes during Protein Degradation. EMBO J. 2007, 26, 1385–1396. [Google Scholar] [CrossRef]
- Riordan, J.F. Angiotensin-I-Converting Enzyme and Its Relatives. Genome Biol. 2003, 4, 225. [Google Scholar] [CrossRef]
- Wang, D.; Himaya, S.W.A.; Giacomotto, J.; Hasan, M.M.; Cardoso, F.C.; Ragnarsson, L.; Lewis, R.J. Characterisation of δ-Conotoxin TxVIA as a Mammalian T-Type Calcium Channel Modulator. Mar. Drugs 2020, 18, 343. [Google Scholar] [CrossRef] [PubMed]
- Dutertre, S.; Jin, A.; Kaas, Q.; Jones, A.; Alewood, P.F.; Lewis, R.J. Deep Venomics Reveals the Mechanism for Expanded Peptide Diversity in Cone Snail Venom. Mol. Cell. Proteom. 2013, 12, 312–329. [Google Scholar] [CrossRef]
- Kaas, Q.; Westermann, J.-C.; Craik, D.J. Conopeptide Characterization and Classifications: An Analysis Using ConoServer. Toxicon 2010, 55, 1491–1509. [Google Scholar] [CrossRef]
- Camacho, C.; Coulouris, G.; Avagyan, V.; Ma, N.; Papadopoulos, J.; Bealer, K.; Madden, T.L. BLAST+: Architecture and Applications. BMC Bioinform. 2009, 10, 421. [Google Scholar] [CrossRef] [PubMed]
- Ebou, A.; Koua, D.; Addablah, A.; Kakou-Ngazoa, S.; Dutertre, S. Combined Proteotranscriptomic-Based Strategy to Discover Novel Antimicrobial Peptides from Cone Snails. Biomedicines 2021, 9, 344. [Google Scholar] [CrossRef]
- The UniProt Consortium UniProt: The Universal Protein Knowledgebase in 2023. Nucleic Acids Res. 2023, 51, D523–D531. [CrossRef]
- Koua, D.; Ebou, A.; Dutertre, S. Improved Prediction of Conopeptide Superfamilies with ConoDictor 2.0. Bioinform. Adv. 2021, 1, vbab011. [Google Scholar] [CrossRef]
- Koua, D.; Brauer, A.; Laht, S.; Kaplinski, L.; Favreau, P.; Remm, M.; Lisacek, F.; Stocklin, R. ConoDictor: A Tool for Prediction of Conopeptide Superfamilies. Nucleic Acids Res. 2012, 40, W238–W241. [Google Scholar] [CrossRef] [PubMed]
- Waterhouse, A.M.; Procter, J.B.; Martin, D.M.A.; Clamp, M.; Barton, G.J. Jalview Version 2—A Multiple Sequence Alignment Editor and Analysis Workbench. Bioinformatics 2009, 25, 1189–1191. [Google Scholar] [CrossRef] [PubMed]
- Larkin, M.A.; Blackshields, G.; Brown, N.P.; Chenna, R.; McGettigan, P.A.; McWilliam, H.; Valentin, F.; Wallace, I.M.; Wilm, A.; Lopez, R.; et al. Clustal W and Clustal X Version 2.0. Bioinformatics 2007, 23, 2947–2948. [Google Scholar] [CrossRef]
- Kaas, Q.; Yu, R.; Jin, A.-H.; Dutertre, S.; Craik, D.J. ConoServer: Updated Content, Knowledge, and Discovery Tools in the Conopeptide Database. Nucleic Acids Res. 2012, 40, D325–D330. [Google Scholar] [CrossRef]
Proteomics Validation | |||||
---|---|---|---|---|---|
Conotoxins | Conopeptide Precursor Sequences | Gene Superfamily | Predatory | Distal | Proximal |
>Can01 | MGMRMMFIVFLLVVLATTVVSSTSGHRAFHDRNAAAKASGLVGLTDRRPQCCSDPRCNSSHPELCGGRRX | A | |||
>Can21 | MLKMRVVLFTFLVLFPLATLQLDADQPVERYAENKQDLNPDERREIILHALGTRCCSWDVCDHPSCTCCSGX | M | |||
>Can22 | MMLKMGVVLFIFLVLFPLATLQLDADQPVERYAENKQLLNPDERRGILLPALRKFCCDSNWCNISDCECCYGX | M | |||
>Can28 | MMSKLGVLLTICLLLFSLNAVPLDGDQHADQPAERLQDDVATENHPLFDPDKRCCDDWECDYSCWPCCYGX | M | |||
>Can33 | MKLTCMMIVAVLFLTAWTFATADDPRNGLENLFSKAHHEMKNPEASKLNKRCKQSGEFCNLIDQDCCDGYCIVFLCTX | O1 | |||
>Can34 | MKLTCMMIVAVLFLTTWTFATAITSNGLENLFSKAHHEMKNPEASKLNKRCVPYEGPCNWLTQNCCDATCVVFWCLX | O1 | |||
>Can35 | MKLTCMMIVAVLFLTAWTLVMADDSNNGLANLFSKLRDEMEDPEGSKLEERDCQEKWEYCPVPFLSSGDCCIGLICGPFVCVGWX | O1 | |||
>Can45 | MEKLTILLLVAAVLTSTQALIQGREERQKAKVRFLSKRKSTWERWWDGDCRTWNAPCDPSVECCFGVCRHHRCVWWX | O2 | |||
>Can50 | MQKLIILLLVAAVLMSTHAMLQEKRPKEKIKFLSKRKTDAEKQQKRLCPDYTDPCSHAHECCSWNCHNGHCTGX | O2 | |||
>Can53 | MEKLTILLLVAAVLMSTQALAERAGGNRLKESIKSLLKGKRSEDSRLFRDCTVWLASCNAPSQCCSAICSTYCRLWX | O2 | |||
>Can55 | MHLSLAGSAVLMLFLLFALGTFVGVQPEQITRDVDNGQLTDNRRNLQSKWKPVSLFISRRGCNNSCNEHSDCESHCICTFRGCGAVNGX | P | |||
>Can61 | MSKMGAMFVLLLFTLASSQREGDIQARKTHLKRDFYRTLPRFARGCTISCEYQDNRCRGECHCPGKTNCYCTSGHHNKGCSCACX | S | |||
>Can62 | MRCLPVFVILLLLIASTPSVDARAKTRDDMSLASFHDDAKRILQILQERNACCIAKTCCRX | T | |||
>Can99 | GPNLPHTRFHKHKRARTETKNGQLKCYLTCNCGPGNRCLGDDDIDWDHRNVKIYTCPSRX | E | |||
>Can100 | QFFCPDSENDPLNCVETKGTEPACMKSKDGSYSYACGYCGKKKESCFGNKVPVADYACQIRKIPNPCGGAALX | I1 | |||
>Can101 | HSYVCGYCGKKKESCFGDKMPVDAYDCKVRNIANPCGGTALX | I1 | |||
>Can102 | VFECLFLFVSDRLNERCLGGGEVCDIFFPKCCNYCILLFCSX | O1 | |||
>Can103 | MKLTCMMIVAVLFLTAWTFATADDPRNGLENLFSKAHHEMKNPEASKLNKRC- | O1 | |||
>Can104 | MKLTCMMIVAVLFLTAWTFATADDPRNGLENLFLKA | O1 | |||
>Can105 | FLTAWTFVTAVPHSSDALENLYLKARHEMENPEASKLNTRDDDCEPPGNFCGMIKIGPPCCSGWCFFACAX | O1 | |||
>Can106 | NQEKHQRAKMNLLSKRKPLAERWWRWGGCMAWFGLCTKNSECCSNSCDITRCELLPFPPDWX | O2 | |||
>Can107 | SDTAQLKAKDNMPLASFHGNAKQTLQMRLRNNGCCPGLECCRFGX | T | |||
>Can108 | MRCLPVFVILLLLTASALSVDARPKTKDDVFLSSFDDNAKSILRRIWNKRSCCEITFYCCGX | T |
Cysteine Framework | Cysteine Pattern | Gene Superfamilies | Pharmacological Families |
---|---|---|---|
0 | 0 C | B (1); H (1); O1 (1); Conorfamides (1); Con-insulins (1); Pro-hormones (1) | |
I | CC-C-C | A (4) | α, ρ |
III | CC-C-C-CC | M (10) | α, ι, κ, µ |
V | CC-CC | T (8) | ε, µ, τ |
VI/VII | C-C-CC-C-C | O1 (14); O2 (11); O3 (1); M (2); U (1) | δ, γ, κ, µ, ω |
VIII | C-C-C-C-C-C-C-C-C-C | S (2) | α, σ |
IX | C-C-C-C-C-C | P (5) | ND |
XI | C-C-CC-CC-C-C | I2 (2); I3 (2) | ι, κ |
XIV | C-C-C-C | E (1); M (1) | α, κ |
XV | C-C-CC-C-C-C-C | O2 (1) | ND |
XX | C-C-C-C-CC-C-C-C-C | D (1) | α, |
XXII | C-C-C-C-C-C-C-C | M (3) | ND |
XXIV | C-CC-C | Con-insulins (1) | |
Unclassified | / | F (1); I1 (3); O1 (1); O2 (3); Con-ikot-ikots (8); Conkunitzins (12); Conopressins-Conophysins (1); Elevenins (3) |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2025 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Ratibou, Z.; Ebou, A.E.T.; Bich, C.; Saintmont, F.; Valette, G.; Cazals, G.; Koua, D.K.; Inguimbert, N.; Dutertre, S. Proteo-Transcriptomic Analysis of the Venom Gland of the Cone Snail Cylinder canonicus Reveals the Origin of the Predatory-Evoked Venom. Toxins 2025, 17, 119. https://doi.org/10.3390/toxins17030119
Ratibou Z, Ebou AET, Bich C, Saintmont F, Valette G, Cazals G, Koua DK, Inguimbert N, Dutertre S. Proteo-Transcriptomic Analysis of the Venom Gland of the Cone Snail Cylinder canonicus Reveals the Origin of the Predatory-Evoked Venom. Toxins. 2025; 17(3):119. https://doi.org/10.3390/toxins17030119
Chicago/Turabian StyleRatibou, Zahrmina, Anicet E. T. Ebou, Claudia Bich, Fabrice Saintmont, Gilles Valette, Guillaume Cazals, Dominique K. Koua, Nicolas Inguimbert, and Sébastien Dutertre. 2025. "Proteo-Transcriptomic Analysis of the Venom Gland of the Cone Snail Cylinder canonicus Reveals the Origin of the Predatory-Evoked Venom" Toxins 17, no. 3: 119. https://doi.org/10.3390/toxins17030119
APA StyleRatibou, Z., Ebou, A. E. T., Bich, C., Saintmont, F., Valette, G., Cazals, G., Koua, D. K., Inguimbert, N., & Dutertre, S. (2025). Proteo-Transcriptomic Analysis of the Venom Gland of the Cone Snail Cylinder canonicus Reveals the Origin of the Predatory-Evoked Venom. Toxins, 17(3), 119. https://doi.org/10.3390/toxins17030119