1. Introduction
The heart’s ability to withstand changes in biomechanical stress is highly dependent on signal sensing and transduction. It is, therefore, likely that transmembrane proteins are involved in this adaptive and eventually remodeling response. Syndecan-4 is a ubiquitously expressed transmembrane proteoglycan that is able to sense extracellular stress and transmit these signals intracellularly to facilitate molecular signaling [
1]. Syndecan-4 localizes to the costameres/Z-discs in cardiomyocytes and is suggested to be a biomechanical stress sensor in the heart upon pressure overload [
2,
3]. Although the loss of syndecan-4 yields no overt phenotype in the male heart at baseline, its mRNA expression and protein levels increase upon biomechanical stress or cardiac injury such as pressure overload and myocardial infarction (MI) [
2,
4,
5]. A role for syndecan-4 has been found in angiogenesis, hypertrophy development, inflammation, and response to MI (for reviews see [
6,
7,
8]).
Much like the other members of the syndecan family, syndecan-4 is composed of an extracellular domain decorated with various glycosaminoglycan (GAG) chains, a transmembrane domain, and a short cytoplasmic tail [
9]. In addition, the extracellular domain of syndecan-4 can be shed, yielding a soluble proteoglycan, which has been found to be increased in various physiological and pathological situations [
10,
11,
12,
13]. The intracellular tail of syndecan-4 holds no intrinsic enzymatic activity and is, therefore, highly reliant on its protein interactions to exert physiological effects.
Using an affinity purification-mass spectrometry approach, we have previously found that the intracellular tail of syndecan-4 interacts with Muscle LIM Protein (MLP), encoded by the
Cysteine and Glycine-Rich Protein 3 (CSRP3) gene [
14]. MLP is a 194 amino acid-long protein belonging to the LIM-only family of proteins [
15,
16]. Compared to its other family members, cysteine-rich protein (CRP) 1 and 2, MLP is exclusively expressed in cardiac and skeletal muscle and first appears at the onset of myogenic differentiation in the embryo [
17]. Whereas skeletal MLP expression significantly declines two weeks after birth, cardiac MLP levels do not change during post-natal development [
18], indicating that the protein is likely indispensable for cardiac structure and function at these stages. Indeed, the MLP knockout (KO) mouse has a low survival rate at post-natal days 5–10 due to severe dilated cardiomyopathy [
18].
As with other Z-disc proteins, MLP has been proposed to be a stress transducer in cardiomyocytes [
18,
19,
20]. This function is likely, at least in part, maintained through MLP’s interactions with multiple protein partners. The N-terminus binds to the Z-disc protein titin-cap/telethonin (TCAP) [
21], and the MLP–TCAP binding forms part of a larger complex together with titin, calcarcins, and minK, constituting part of the stretch-sensing machinery of cardiomyocytes [
22,
23]. Bordering MLP’s N-terminus is LIM1, the first of two LIM domains, which are known for their extensive protein-binding ability [
24,
25]. Two zinc fingers within these LIM domains coordinate zinc molecules, providing stable protein folding [
26]. Next, a nuclear localization signal (NLS), a motif traditionally recognized by proteins belonging to the importin group [
27], is likely partially responsible for the nuclear translocation of MLP. Following the NLS motif, a 12 amino acid cofilin-2 (CFL2) binding domain is found, of which the binding significantly impacts F-actin depolymerization [
28]. Lastly, the second LIM domain is found (LIM2) towards the C-terminus.
Syndecan-4 and MLP interact with one another in cardiac muscle, and this interaction increases following pressure overload induced by aortic banding [
14], indicating the potential importance of the interaction in disease. However, it remains unclear whether this interaction occurs within a particular subcellular fraction and the reciprocal binding sites of the two proteins. Interestingly, MLP is able to oligomerize, and its oligomeric state has been suggested to determine its subcellular localization [
29]. Multiple human mutations in MLP have been found in patients with familial hypertrophic cardiomyopathy (HCM) and dilated cardiomyopathy (DCM) [
19,
20,
21,
30,
31,
32,
33,
34]. Although the molecular mechanisms of MLP-associated cardiomyopathy are not known, they likely, at least in part, involve alterations in protein interactions and the oligomerization state, and perhaps a change in subcellular localization.
To further characterize the syndecan-4–MLP interaction sites, MLP oligomerization, and the effect of human cardiomyopathy-associated MLP mutations, we have presently explored MLP, syndecan-4, and their interaction in adult primary rat cardiomyocytes and the H9c2 rat cardiomyoblast cell line. Our results show that syndecan-4 and MLP bind in isolated adult primary rat cardiomyocytes and that this occurs specifically within nuclear-enriched fractions. Despite a thorough investigation of the syndecan-4–MLP interaction in the H9c2 cell line, the binding was not present in this cell system. Additionally, through in vitro work, we find that MLP oligomerization is altered when MLP is mutated, resulting in an increase in monomeric recombinant MLP at the expense of higher-order oligomeric MLP. Our results suggest that the sites of MLP self-association are mainly located at the end of the LIM1 through the NLS and in the middle of the LIM2 domain, and self-association is altered in the presence of HCM- and DCM-associated MLP mutations.
2. Methods
2.1. Plasmids, Peptides, and Recombinant Proteins
All human MLP gene constructs (GenScript Biotech Corp, Piscataway, NJ, USA) were in a pcDNA3.1 vector, and human syndecan-4 in a pCEP4 vector. Empty vectors were used as controls. Where indicated, tagged constructs were used, where the FLAG-tag in human MLP was placed at the C-terminus, and the HA-tag in human syndecan-4 was placed between amino acids 27 and 28 at the N-terminus.
All human peptides and recombinant proteins were synthesized with >80% purity by GenScript. All MLP recombinant proteins were full length and had 6xHis tags at the N-terminus (GenScript Biotech Corp, Piscataway, NJ, USA). MLP-WT peptide sequences were synthesized as 30-mers with or without an N-terminal biotin tag. MLP mutations (in bold) were synthesized within these sequences:
MLP-W4R: MPNRGGGAKCGACEKTVYHAEEIQCNGRSF
MLP-L44P: CNGRSFHKTCFHCMACRKAPDSTTVAAHES
MLP-S46R: CNGRSFHKTCFHCMACRKALDRTTVAAHES
MLP-S54R,E55G: AAHERGIYCKVCYGRRYGPKGIGYGQGAGC
MLP-C58G: AAHESEIYGKVCYGRRYGPKGIGYGQGAGC
MLP-R64C: AAHESEIYCKVCYGCRYGPKGIGYGQGAGC
MLP-Y66C: AAHESEIYCKVCYGRRCGPKGIGYGQGAGC
MLP-K69R: AAHESEIYCKVCYGRRYGPRGIGYGQGAGC
MLP-G72R: AAHESEIYCKVCYGRRYGPKGIRYGQGAGC
MLP-Q91L: QGAGCLSTDTGEHLGLLFQQSPKPARSVTT
Biotin-ahx-SDC4cyt: RMKKKDEGSYDLGKKPIYKKAPTNEFYA
Biotin-ahx-SDC4scram: GTKYPKMDRGKLFKYKAKPEDNESAYIK
SDC4 blocking peptide: DLGKKPIYKKAPTN
2.2. Peptide Arrays
Human, rat, and mouse MLP were synthesized as overlapping 20-mers with three amino acid offsets onto cellulose membranes by an automated MultiPep peptide synthesizer (INTAVIS Bioanalytical instruments AG, Tübingen, Germany). After blocking, membranes were incubated with a biotin-ahx-SDC4cyt (SDC4cyt) peptide, a scrambled biotin-ahx-SDC4cyt (SDC4scram), a custom-made MLP antibody (#R06991, GenScript Biotech Corp, Piscataway, NJ, USA), or a commercially available MLP antibody (sc-166930, Santa Cruz, Dallas, TX, USA) overnight at 4 °C. The remaining consequent steps were identical to those performed for immunoblotting, as described further below.
2.3. Enzyme-Linked Immunosorbent Assay (ELISA)
96-well ELISA microplates were coated with 10 µg of WT or mutated human 6xHis-MLP recombinant proteins or 10 µg of MLP peptides in PBS, and rotated at 4 °C overnight. Each well was rinsed with 0.05% Tween-20 in PBS (PBS-T) and blocked with 0.5% gelatin (G-1890, Sigma Merck, Darmstadt, Germany) for one hour at room temperature before incubation with the given biotinylated peptides at a final concentration of 2–5 µM for two hours at 37 °C with gentle agitation. Each well was then thoroughly washed with PBS-T five times before incubation with 100 µL of Biotin-HRP (A0185, Sigma Merck, Darmstadt, Germany) for 30 min at room temperature with gentle agitation. Each well was then washed with PBS-T 5 times before incubation with 100 µL of Ultra TMB substrate solution (34028, Thermo Fisher Scientific, Waltham, MA, USA) for 15–30 min at room temperature with gentle agitation to develop a blue color signal. The reaction was stopped with 100 µL of 2 M hydrochloric acid (HCl) per well (yellow color development). The absorbance of each well was read at 450 nm (Hidex sense multimodal microplate reader, Åbo, Finland).
2.4. Biacore Surface Plasmon Resonance
A streptavidin (SA) chip (BR1000032, Cytiva, Marlborough, MA, USA) was conditioned with three 1 min injections of 1 × Biacore running buffer (BR100826, Cytiva, Marlborough, MA, USA), and biotinylated SDC4cyt was immobilized at 133–350 resonance units (RUs). Recombinant 6xHis-MLP-WT was dialyzed into 1 × Biacore running buffer, and increasing concentrations were injected over the chip’s surface at a flow rate of 30 µL per minute for 180 s. For the different runs, concentration ranges spanned 2.9–14.6 nM, 1.2–100 nM, and 21.2–500 nM. The dissociation time was set to 600 s. Sensorgrams were analyzed using the Biacore X100 software (Version 2.0.1) with the assumption of 1:1 binding (Langmuir binding model).
2.5. Culture, Transfection, and Differentiation of H9c2 Cells
H9c2 cells (ATCC® CRL-1446TM, Manassas, VA, USA) were cultured at 37 °C and 5% CO2 in a humidified incubator in DMEM media (#41965, Gibco, Thermo Fisher Scientific, Waltham, MA, USA) supplemented with 10% FBS and 1% penicillin/streptomycin (P0781, Sigma Merck, Darmstadt, Germany). For maintenance, cells were passaged at 90% confluency.
For transfection, cells were plated in 10 cm2 culture-grade dishes or on 12 mm Ø glass coverslips (#0117520, Paul Marienfeld GmbH & Co, Lauda-Königshofen, Germany) to a confluency of 80%. After 24 h, cells were transfected with the given constructs using the PolyJet in vitro transfection reagent (SignaGen laboratories, Frederick, MD, USA) according to the manufacturer’s protocol.
For differentiation, cells were plated in 10 cm2 culture-grade dishes or on 12 mm Ø glass coverslips (#0117520, Paul Marienfeld GmbH & Co, Lauda-Königshofen, Germany) to a confluency of 70%. After 24 h, the media was changed to DMEM media (#41965, Gibco, Thermo Fisher Scientific, Waltham, MA, USA) supplemented with 1% FBS and 1% Penicillin/streptomycin. Ten nM all-trans-retinoic acid (#R2625, Sigma Merck, Darmstadt, Germany) was added to the cultures daily, with media changes conducted every other day for 5 consecutive days. Where indicated, isoprenaline (ISO) was added on the sixth day for 24 h at a concentration of 25 µM (#l5627, Sigma Merck, Darmstadt, Germany).
2.6. Culture of HL-1 Cells
HL-1 cells [
35] were cultured in flasks coated with 0.02% gelatin (G9391, Sigma Merck, Darmstadt, Germany) and 5 µg/mL fibronectin (F1141, Sigma Merck, Darmstadt, Germany) in Claycomb medium (51800C, Sigma Merck, Darmstadt, Germany) supplemented with 10% FBS, 1% penicillin/streptomycin (P0781, Sigma Merck, Darmstadt, Germany), 0.1 mM Norepinephrine (A0937, Sigma Merck, Darmstadt, Germany), and 2 mM L-Glutamine (G7513, Sigma Merck, Darmstadt, Germany) at 37 °C and 5% CO
2 in a humidified incubator. For maintenance, cells were passaged at 90%.
2.7. Animal Experiments
All animal work was performed in accordance with the approval of the National Regulation of the use of animal research and the Norwegian Animal Welfare Act (FOTS ID 30114 for rats, ID IV 1-17U for neonatal rats, and ID 29268 and 23008 for mice). For left ventricular (LV) cardiomyocyte isolations, 2–4-month-old male Wistar rats were used (Janvier Labs, Le Genest-Saint-Isle, France). For WT and cardiomyocyte-specific syndecan-4 overexpressing (TG) mouse LV lysates [
36], adult female mice with a C57BL/6J background were used (Jackson Laboratory, Bar harbor, ME, USA). Animals were housed in a temperature-controlled facility with 12:12 h light/dark cycles. All animals had access to food and water ad libitum and were sacrificed by cardiac excision during deep surgical anesthesia by isoflurane inhalation.
2.8. Adult and Neonatal Rat Left Ventricular Cardiomyocyte Isolation
The excised adult hearts were cannulated through the aorta on a constant flow Langendorff perfusion system. To clear the blood from the coronary arteries, the hearts were first flushed with approximately 5–10 mL of isolation buffer (130 mM NaCl, 5.4 mM KCl, 0.5 mM MgCl
2, 0.4 mM NaH
2PO
4, 25 mM HEPES, and 5.5 mM
d-glucose, pH 7.4) at a rate of 3 mL/minute. Isolation buffer supplemented with 2mg/mL collagenase type II (Worthington Biochemical Corporation, Lakewood, NJ, USA) was then perfused through the heart for 10–12 min at 37 °C. After digestion, the LV was dissected, minced, and separated into chunks in an isolation buffer containing 1 mg/mL of BSA. To further detach the cells from surrounding tissue, the chunks were transferred to a falcon tube containing 0.2 mg DNase (LS002006, Worthington Biochemical Corporation, Lakewood, NJ, USA), collagenase, and 250 µL of BSA. The cells were subsequently filtered through a 200 µm filter and left to sediment. The Ca
2+ concentration was gradually increased to 0.2 mM. Isolated cardiomyocytes were used within 2 h of isolation. Neonatal rat cardiomyocytes were isolated as previously described [
10].
2.9. Subcellular Fractionation
Freshly isolated rat LV cardiomyocytes and H9c2 cells were fractioned into cytoplasmic-, membrane-, nuclear-, and cytoskeletal-enriched subcellular compartments according to the manufacturer’s protocol (#2145; Merck Millipore, Burlington, MA, USA).
2.10. Immunoprecipitation
For the immunoprecipitations, lysates were incubated with 2 µg of syndecan-4 (KY/8.2, #550350, BD Biosciences, Franklin Lakes, NJ, USA), MLP (#R06991, GenScript Biotech Corp, Piscataway, NJ, USA) or HA-tag (#3724, Cell Signaling technology, Danvers, MA, USA) antibodies and protein A/G agarose beads (sc-2003, Santa Cruz, Dallas, TX, USA) overnight at 4 °C. The samples were then washed three times in IP-buffer (20 mM HEPES (pH 7.5), 150 mM NaCl, 1 mM EDTA, and 1% Triton X-100) supplemented with complete EDTA-free protease inhibitors (#05056489001, Sigma Merck, Darmstadt, Germany) and phosSTOP (#04906837001, Roche Applied Science, Penzberg, Germany) before elution by boiling the samples in 2 × SDS loading buffer (0.75 M sucrose, 3.75% SDS, 31.25 mM Tris-HCl (pH 6.8), 0.1 mM EDTA (pH 7.5), 100 mM DTT, and 0.005% bromophenol blue). Non-relevant normal rat IgG (sc-2026, Santa Cruz, Dallas, TX, USA) or normal rabbit IgG (sc-2027, Santa Cruz, Dallas, TX, USA) antibodies were used as negative controls where indicated. Subsequent immunoblots were probed with anti-MLP (#R06991, GenScript, or sc-166930, Santa Cruz, as indicated) and anti-HAtag (#3724, Cell Signaling, Danvers, MA, USA) or anti-SDC4 (#429716, GenScript Biotech Corp, Piscataway, NJ, USA).
2.11. Immunoblotting
LV tissues were homogenized with TissueLyser (#85300, Qiagen Nordic, Venlo, The Netherlands) in ice-cold lysis buffer (20 mM Hepes (pH 7.5), 150 mM NaCl, 1 mM EDTA, and 0.5% Triton-X100) with an added complete EDTA-free protease inhibitor cocktail (#05056489001, Sigma Merck, Darmstadt, Germany) and PhosSTOP (#04906837001, Roche Applied Science, Penzberg, Germany). Primary rat cardiomyocytes and H9c2 cells were lysed in the same ice-cold lysis buffer or ice-cold RIPA buffer (#89900, Thermo Fisher Scientific, Waltham, MA, USA). The homogenates were centrifuged at 14000 RCF for 15 min at 4 °C, and the supernatants were stored at −20 °C or −80 °C. Protein concentrations were determined using a Micro BCA protein assay kit (#23235, Thermo Fisher Scientific, Waltham, MA, USA). An equal protein concentration was loaded per lane on 4–15 or 12% Criterion TGX precast gels (#5671084 and #5671044, Bio-Rad, Hercules, CA, USA) before being transferred onto PVDF membranes (#1704157, Bio-Rad, Hercules, CA, USA or #03010040001, Sigma Merck, Darmstadt, Germany) using the Trans-Blot Turbo system (#1704150, Bio-Rad, Hercules, CA, USA). The membranes were subsequently blocked in 1 × casein, 5% BSA, or 5% milk for one hour at room temperature before being incubated with primary antibodies overnight at 4 °C. After incubation, the membranes were washed in TBS-T (Tris-buffered saline with 1% Tween-20 (#1610781, Bio-Rad, Hercules, CA, USA)) for 20 min, followed by two 10 min washes. HRP-conjugated secondary antibodies were added for one hour at room temperature before another 20 min wash, followed by four 5 min washes in TBS-T. Using the ECL prime (#RPN2236, GE Healthcare, Arlington Heights, IL, USA), blots were developed, and the signal was thereafter detected with the Azure 600 Western blot imaging system (Azure Biosciences, Dublin, CA, USA). Membranes were stripped (#21603, Thermo Fisher Scientific, Waltham, MA, USA) for 5–10 min before reprobing. Total protein was detected using Revert 700 protein staining (#926-11021, LI-COR biosciences, Lincoln, NE, USA), and in the subcellular fractions, known compartment markers (GAPDH for cytoplasmic, Histone H3 for nuclear, NCX1 for membrane, and α-actinin for cytoskeleton) were used to verify the enrichment of the fractions.
2.12. Immunoblotting under Native Conditions
Where stated, the samples were run under native conditions. Here, the samples were diluted to the desired protein concentration (0.5 µg for recombinant proteins and 20 µg for rat cardiomyocyte subcellular fractions) in native sample buffer (#1610738, Bio-Rad, Hercules, CA, USA). The samples were not boiled prior to loading but were run with a standard SDS-containing running buffer (#1610772, Bio-Rad, Hercules, CA, USA) and transferred as described above.
2.13. Antibodies and Blocking Conditions
Anti-MLP (1:1000, 1 × Casein, sc-166930, Santa Cruz, Dallas, TX, USA), anti-MLP (1:1000, 1 × Casein, #R06991 and #R06990, GenScript Biotech Corp, Piscataway, NJ, USA), anti-syndecan-4 (1:1000, 1 × Casein, #429716, GenScript Biotech Corp, Piscataway, NJ, USA), anti-HA-tag (1:1000, 1 × BSA, #3724, Cell Signaling, Danvers, MA, USA), anti-NCX1 (1:1000, 1 × Casein, #3302, GenScript Biotech Corp, Piscataway, NJ, USA), anti-α-actinin (1:1000, 1 × Casein, ab68167, Abcam, Cambridge, UK), anti-GAPDH (1:500, 1 × Casein, sc-47724, Santa Cruz, Dallas, TX, USA), anti-Histone H3 (1:2000, 1 × Casein, #4499, Cell Signaling, Danvers, MA, USA), and anti-troponin T (1:1000, 1 × Casein, ab10214, Abcam, Cambridge, UK) were used. Secondary antibodies were anti-rabbit IgG HRP (N934V, Cytiva, Marlborough, MA, USA), anti-mouse IgG HRP (NA931V, Cytiva, Marlborough, MA, USA), and anti-goat IgG HRP (HAF109, R&D Systems, Minneapolis, MI, USA).
Where deemed necessary, a blocking peptide containing the epitope of the cytoplasmic syndecan-4 antibody (#429716, GenScript Biotech Corp, Piscataway, NJ, USA) was used to detect the specificity of bands. Here, the custom-made syndecan-4-blocking peptide (DLGKKPIYKKAPTN) was incubated with anti-syndecan-4 overnight at 4 °C prior to incubation of the membrane for 2 h at room temperature.
2.14. Immunofluorescence, Imaging and Processing
Baseline or differentiated H9c2 cells grown on glass coverslips or freshly isolated adult male LV cardiomyocytes were fixed in 4% paraformaldehyde for 10 min, quenched in 150 mM glycine for 10 min, and permeabilized with 0.5% Triton X-100 for 10 min at room temperature. Primary cardiomyocytes were additionally plated on glass-bottom dishes (No 1.5, Ø 14 mm, γ-irradiated, MatTek Corporation, Ashland, MA, USA) coated with laminin (#L2020, mouse, Sigma Merck, Darmstadt, Germany) and left to adhere for one hour at room temperature. Cells were then blocked in protein block (X0909, Dako, CA, USA) for 10 min at room temperature. For fluorescence labeling, cells were incubated with anti-MLP (1:50, sc-166930, Santa Cruz, Dallas, TX, USA), anti-MLP (1:50, #R06691, GenScript Biotech Corp, Piscataway, NJ, USA), anti-MLP (1:50, ab173301, Abcam, Cambridge, UK), anti-α-actinin (1:100, ab9465, Abcam, Cambridge, UK), anti-FLAG (1:50, F1804, Sigma Merck, Darmstadt, Germany), or anti-HA-tag (1:50, #3724, Cell Signaling technology, Danvers, MA, USA) overnight at 4 °C. After three 5 min washes, cells were incubated with anti-mouse Alexa Fluor 555 (1:200, #32727, Thermo Fisher Scientific, Waltham, MA, USA) and anti-rabbit Alexa Fluor 647 (1:200, #32733, Thermo Fisher Scientific, Waltham, MA, USA) for 1 h at room temperature. For the primary rat cardiomyocytes, DAPI 405 (0.1 mg/mL, #MBD0015, Sigma Merck, Darmstadt, Germany) was included in the secondary antibody step to visualize the nuclei. H9c2 cells were mounted with ProLong glass antifade mountant with NucBlue (P36983, Invitrogen, OR, USA). Both primary and secondary antibodies were diluted in a buffer containing 2% goat serum, 0.1% Triton X-100, and 0.02% NaN3 in PBS. As negative controls, freshly isolated primary rat cardiomyocytes and H9c2 cells were stained with primary or secondary antibodies only and DAPI. For imaging, cells were excited with the 555 and 647 nm laser lines of a ZEISS LSM 800 (Carl Zeiss AG, Jena, Germany) using the Airyscan mode and a plan-apo 63X 1.4 NA oil objective.
2.15. Statistics
All quantitative data are presented as the mean ± standard error of the mean. The normality of distribution was analyzed for all data using Shapiro–Wilk tests. Normally distributed data were tested with two-tailed unpaired t-tests, and non-normally distributed data with two-tailed Mann–Whitney U tests or Kruskal–Wallis with Dunn’s multiple comparisons (GraphPad Prism 9.4.1, La Jolla, CA, USA). Immunoblot quantifications were performed in FIJI 1.52p (NIH). Graph assembly and illustrations were made in Adobe Illustrator CS6 (Adobe Inc., San Jose, CA, USA).
4. Discussion
In this study, we have investigated syndecan-4 and MLP and their interaction in primary rat adult cardiomyocytes and H9c2 cells. We have previously shown that syndecan-4 and MLP co-precipitate in total rat LV lysates [
14]. Here, we show that this interaction is specific to the nuclear-enriched fraction of isolated adult cardiomyocytes. In primary adult rat cardiomyocytes, MLP co-localized to α-actinin-positive Z-discs, and the oligomeric-dependent subcellular localization was somewhat different from that which others have previously described in neonatal cardiac myocytes. Our in vitro work suggests that syndecan-4 binds to MLP at three distinct domains, covering part of the LIM1 and LIM2 domains, but also the nuclear localization signal (NLS). Additionally, syndecan-4 appeared to bind weaker to hereditary HCM-associated mutations L44P, S46R, and S54R, E55G in vitro. Despite a thorough investigation into the rat cardiomyoblast H9c2 cell line, the syndecan-4–MLP interaction was not present. However, independent of syndecan-4, transfection of mutated and WT MLP yielded an altered subcellular localization of mutated MLP compared to the WT. Furthermore, mutations in MLP also induced changes to the oligomeric state of recombinant MLP proteins, where all mutations had a higher degree of monomeric at the expense of trimeric and tetrameric MLP. Lastly, our data suggests that MLP self-association is dependent on two regions, the first spanning the end of LIM1 and the NLS and the second covering the middle of the LIM2 domain, which is weakened when MLP is mutated.
To better understand the underlying mechanism of MLP-associated cardiomyopathy and the potential involvement of syndecan-4, we employed adult cardiomyocytes to determine the subcellular fraction in which this interaction occurs. Interestingly, we only detected the syndecan-4–MLP interaction in the nuclear compartment. We have previously found that the syndecan-4 knockout (KO) mouse possesses less MLP in nuclear fractions [
14], suggesting that syndecan-4 is involved in the nuclear translocation of MLP. Our present data suggests that syndecan-4 and MLP, although co-localizing in the other subcellular compartments, do not bind before having entered the nuclear area, at least in isolated cardiomyocytes. However, compared to others, we observed little MLP in the cytoplasmic-enriched subcellular fraction [
31]. It should be noted that the isolation procedure may have stressed the cells, potentially having led to the nuclear translocation of MLP. We can, therefore, not disregard the possibility that syndecan-4 and MLP bind in other subcellular fractions in non-isolated cardiomyocytes in tissue. An additional possibility is that syndecan-4 requires modifications to facilitate its binding to MLP in other subcellular fractions. Dephosphorylation of serine 179 of syndecan-4 upon pressure overload has, for example, been found to increase its binding to calcineurin, activating the nuclear factor of activated T-cell (NFAT) pro-hypertrophic signaling [
2]. It is possible the increased binding between syndecan-4 and MLP we have previously observed in the pressure-overloaded heart is due to similar changes in the phosphorylation level [
14]. This is an interesting topic that will be investigated in future studies. Both MLP and syndecan-4 possess a NLS sequence, of which the NLS motif RMKKK in syndecan-4 seems to be conserved across the syndecan family [
37,
40,
46]. Syndecan-4 may be involved in stabilizing MLP in the nucleus; hence, its loss results in lower levels of MLP. Although MLP does not contain a DNA binding domain, it has been suggested to act as a transcriptional activator through its physical interaction with basic helix-loop-helix transcription factors, such as myogenin, enhancing skeletal myogenesis [
47].
The nuclear localization of different forms of syndecan-4 is also an interesting observation. Nuclear localization of syndecan-1 has also been demonstrated by others in mesothelioma cells, hepatocytes, and corneal fibroblasts, with suggested functions in the regulation of cell proliferation, synthesis of RNA, and splicing [
46,
48,
49]. Additionally, we have previously also observed the co-localization of syndecan-4 and Lamin A in bovine muscle cells [
37]. The exact role of syndecan-4 and its different forms in the nuclear region is an interesting area of further study.
As has been reported in neonatal rat cardiomyocytes, our data suggest that MLP oligomerization is also associated with a specific subcellular localization in adult rat cardiomyocytes [
29]. We found that MLP monomers were mainly present in nuclear-enriched fractions, whereas dimers were present in both the nuclear and cytoskeletal compartments and less in the cytoplasm. MLP trimers were mainly observed in the membrane, and tetramers were detected weakly in the cytoplasm and nuclear fractions. In previous work using neonatal cardiac myocytes, only monomeric MLP was found in the nucleus, while dimeric and trimeric were found in the membrane, and only tetrameric MLP was detected in the cytoskeleton [
29]. To our knowledge, oligomerization has not been investigated in adult cardiomyocytes before. The differences observed are likely due to the developmental stage of the cardiomyocytes used, where the function, and therefore subcellular localization of MLP, is different. Neonatal cardiac myocytes are subject to maturation through processes such as myofibril assembly through t-tubule development and sarcomere organization, an increase in cell size, and the development of contractile properties [
50]. During these processes, it could be hypothesized that MLP binds to different protein partners at different subcellular locations, in turn determining its oligomeric state.
The form of MLP to which syndecan-4 preferentially binds to is currently unknown. Since the two proteins bind in the nuclear region, it is likely that the interaction involves monomeric or dimeric MLP, which we detected in this compartment with immunoblotting under native conditions. Our in vitro analysis of the interaction suggests a strong binding of syndecan-4 to MLP at three sites, including part of the LIM1 domain, the NLS, part of CFL2, and part of the LIM2 domain. Whether these sites reflect the true binding domains of syndecan-4 to the tertiary MLP protein cannot be elucidated by the use of these methods. Since the use of short peptides may disrupt the folding, especially in regard to the zinc-finger containing LIM domains, these results should be interpreted with caution. However, the SPR analysis of the interaction suggests that syndecan-4 may be able to bind both the monomeric and oligomeric forms of MLP. As both MLP and syndecan-4 can oligomerize, we cannot exclude that the immobilized syndecan-4 or MLP are oligomeric forms or that syndecan-4 oligomerization is necessary for its binding to MLP. Syndecan-4 dimerization has, for example, been found to be needed for the activation of its well-described binding partner protein kinase C α (PKCα), which has been implicated in focal adhesion formation, migration, and adhesion [
51,
52].
What happens to the interactions between MLP and its protein-binding partners when MLP is mutated has not been previously investigated in detail. We observed lower levels of binding of syndecan-4 to several of the HCM-associated MLP variants, namely L44P, S46R and S54R, E55G. Similarly, the direct interaction that has been found between the LIM1 and NLS domains of MLP and α-actinin has been found to be reduced when MLP is mutated at C58G and K69R, likely contributing to the cardiomyopathy phenotypes in these patients [
34,
53,
54]. Whether the L44P, S46R and S54R, E55G mutations lead to weakened binding between syndecan-4 and MLP in the nuclear region of cardiomyocytes in vivo or perhaps reduce the nuclear entry of MLP altogether remains to be investigated.
To further examine the interaction between syndecan-4 and MLP in cells, we tested whether the H9c2 rat cardiomyoblast cell line could be used as a model system [
42]. Despite some co-localization in and around the nucleus and in cell striations, the interaction between syndecan-4 and MLP was not detectable in H9c2 cells at baseline conditions. It could be postulated that at the immature cardiomyoblast stage, MLP has not yet been structurally placed at the subcellular localization where it will exert its effect at a mature stage, and therefore, the syndecan-4–MLP interaction is not yet present. This hypothesis is also supported by observations in the MLP KO mouse, which survives the embryonic period but suffers post-natal lethality, linked to a deficient terminal differentiation of cardiomyocyte cytoarchitecture [
18]. Similarly, in human embryonic stem cells lacking MLP, loss of MLP does not affect the initial differentiation into cardiomyocytes, while more differentiated cells display a typical HCM phenotype [
55]. To test whether an augmented differentiation of H9c2 cells into cardiomyocyte-resembling cells improved MLP and syndecan-4 co-localization, we treated the cells with all-trans-retinoic acid and reduced the serum concentrations [
56]. As expected, the better-differentiated cells started to express cardiac markers such as cardiac troponin T. Immunofluorescence imaging also showed an increase in sarcomeric α-actinin organization throughout the cell and indications of its co-localization with MLP. The binding between endogenous syndecan-4 and MLP was, however, still not present in these cells. Additionally, MLP was found not to co-immunoprecipitate with syndecan-4 in the HL-1 atrial cardiomyocytes. Together, these data indicate that the syndecan-4–MLP interaction is likely only present in primary cardiomyocytes since we observed this binding in rat nuclear-enriched subcellular fractions, mouse LV lysates, cardiomyocyte-specific syndecan-4 overexpressing mouse LV lysates, and neonatal rat cardiomyocytes. These findings indicate that the syndecan-4–MLP interaction may require specific types of post-translational modifications to these proteins or associated partners such as titin-TCAP [
22]. These post-translational modifications may only be present in primary cells.
To determine if any effect of syndecan-4 overexpression could be observed on the MLP subcellular localization in H9c2 cells, they were transiently transfected with MLP in the presence or absence of syndecan-4. Under these conditions, we did not see any effects of syndecan-4 on MLP subcellular localization. We have previously found that the overexpression of syndecan-4 increases the nuclear-located MLP in H9c2 cells; however, this was with the viral overexpression of syndecan-4, investigating endogenous MLP [
14], perhaps yielding a higher level of overexpression.
Independently of syndecan-4, we further investigated the subcellular localization of MLP-WT and MLP mutations in the NLS signal, such as R64C, Y66C, and K69R in H9c2 cells. None of the three mutations were affected by proteolytic degradation, at least in the H9c2 cells. Both MLP-Y66C and MLP-K69R had increased levels of MLP in the membrane- and cytoskeleton-enriched fractions. We also observed an increase in the nuclear localization of K69R by subcellular fractionation and confocal microscopy. In line with our data, an increased perinuclear localization of K69R has also been observed in C2C12 cells [
34]. In contrast, mutations such as C58G, which are located in the LIM1 domain, have been found to have a gene-dose-dependent increase in C58G transcript levels. However, there is also a decrease in MLP-C58G protein levels due to proteolytic degradation as a consequence of partial protein unfolding [
44,
53]. Protein destabilization has also been found for L44P through computational in silico studies [
57]. The MLP constructs used for overexpression for confocal imaging contained a C-terminal FLAG-tag, and it should be noted that this tag could affect MLP’s functionality and ability of nuclear translocation [
29]. However, it seems unlikely that such effects are critical since we successfully detected FLAG-tagged MLP in the nuclear region. Additionally, the FLAG-tagged MLP mouse is able to rescue the DCM phenotype of the MLP KO mouse [
58], suggesting MLP is still functional with a C-terminal tag, even if in a monomeric form. The increase in atrial natriuretic peptide (ANF) and brain natriuretic peptide (BNP) accompanying the MLP KO mice is also reduced to baseline when these animals are crossed with the FLAG-tagged MLP [
58].
In H9c2 cells, most of the MLP existed in the monomeric form, which increased upon differentiation. MLP has previously been found to translocate to the nucleus in response to stretch, activating ribosomal protein S6 (RPS6) in neonatal rat cardiomyocytes, associated with an increase in protein synthesis and an increase in cell size and hypertrophy development [
29]. It is, therefore, likely that the high levels of monomeric MLP present upon differentiation are located in the nucleus, where the protein participates in promoting cell growth and, consequently, the differentiation process.
We also investigated the oligomerization of recombinant MLP-WT and mutated proteins. MLP-WT had a ~25% distribution of each oligomer and monomer. In mutated MLP, however, we observed an increase in monomeric MLP at the expense of trimeric and tetrameric MLP. It is possible that the alterations in oligomerization we observed contribute to the disease pathogenesis by increasing the ratio between monomeric to oligomeric MLP. As has been shown before, MLP oligomerization is altered in rat heart disease models, such as aortic banding and myocardial infarction, where an increase in the monomeric MLP is accompanied by a reduction in oligomeric MLP, especially the tetrameric oligomer [
29,
59]. The same has been shown in human failing hearts, where mainly monomeric MLP is detected, compared to non-failing hearts, where oligomeric MLP is present [
29]. Part of the molecular mechanism of MLP-associated cardiomyopathies likely involves a loss of balance in the ratio of monomeric to oligomeric MLP where extranuclear oligomeric MLP is lost, and monomeric MLP in the nucleus is increased. MLP has been suggested to serve a dual role in the heart, in the nucleus for the maintenance/induction of hypertrophy, and in the cytoplasm as a structural component of the various stretch and stress sensor machineries [
15,
19,
40,
60].
The exact domain of MLP self-association has been an area for debate. In vitro, we found that MLP-WT self-association was highest at amino acid residues 50–79, covering the end of the LIM1 domain and the NLS, and 125–154, covering the middle of the LIM2 domain. Others have found the C-terminus to be important for MLP oligomerization [
29]. In contrast, the N-terminal LIM domain has been a proposed site of self-association via bimolecular fluorescence complementation assays [
45]. Our data support the possibility that both the N- and C-terminal ends of MLP are sites of self-association, as well as the nuclear localization signal. We found that all MLP mutations, with the exception of L44P and C58G, had weaker self-associations at aa 50–79 and 125–154, indicating that mutated MLP is more prone to monomerization, supporting our immunoblotting data of the recombinant mutated MLP proteins.
The oligomeric state may largely influence the syndecan-4–MLP interaction. The syndecan-4 binding domains within MLP largely overlapped with the sites of MLP self-association, suggesting that syndecan-4 binding sites may not be accessible for binding unless MLP is in a monomeric form. We found that monomeric and dimeric MLP were located in nuclear-enriched fractions, where the binding was also present. Our data suggests that most MLP mutations had reduced self-association; however, we also found that syndecan-4 had reduced binding to some MLP mutations. Except for the L44P mutation, it is, therefore, likely that the reduced syndecan-4 binding affinity was caused by the MLP mutation itself and not by alterations in the binding domain availability. However, syndecan-4–MLP binding when MLP is mutated should be tested in vivo to confirm this hypothesis.
Interestingly, syndecan-4 and MLP share multiple binding partners, including α-actinin and the calmodulin-regulated phosphatase, calcineurin [
2,
61,
62], and multiple groups have postulated that MLP aids in anchoring calcineurin to the Z-discs [
62,
63,
64]. Both syndecan-4 and MLP affect the function of PKCα where syndecan-4 binds PKCα [
2], and this binding is reduced when syndecan-4 is phosphorylated at serine 179 [
2]. In contrast, MLP is involved in the autophosphorylation level of PKCα [
65]. The double KO of PKCα and MLP rescue the DCM phenotype observed in MLP KO mice [
66], potentially due to MLP being an inhibitor of PKCα. Additionally, MLP is a potential downstream target of PKCα where HCM-associated mutations in MLP exhibit reduced phosphorylation and DCM-association mutations have increased phosphorylation by PKCα [
65]. The potential involvement of syndecan-4 in the relationship between PKCα and MLP is an interesting area for further study. Therefore, although we find binding between syndecan-4 and MLP, specifically in nuclear-enriched fractions, we cannot discard the possibility that the two proteins are part of larger protein complexes together elsewhere in the cardiomyocyte.
To conclude, syndecan-4 and MLP interact in nuclear-enriched fractions of adult rat cardiomyocytes. Furthermore, although H9c2 cells express both endogenous syndecan-4 and MLP, these do not interact in baseline conditions, after ISO stimulation, or upon differentiation. Independent of syndecan-4, recombinant MLP-WT had an approximate 25% dispersion between the monomeric and three oligomeric forms, and this ratio was altered when MLP was mutated, yielding a higher level in monomeric MLP at the expense of trimeric and tetrameric MLP. Lastly, the domains of self-association aiding in the oligomerization of MLP likely involve the LIM1, NLS, and LIM2 domains, largely overlapping with the syndecan-4–MLP binding domains. Whether syndecan-4 aids in stabilizing MLP in the nuclear region or, alternatively, preventing MLP from binding to its target transcription factors are compelling possibilities that warrant further studies.