Next Article in Journal
Correlation between the Serum Pepsinogen I Level and the Symptom Degree in Proton Pump Inhibitor-Users Administered with a Probiotic
Next Article in Special Issue
The Fungal Defensin Family Enlarged
Previous Article in Journal
Conformational Analysis, Molecular Structure and Solid State Simulation of the Antiviral Drug Acyclovir (Zovirax) Using Density Functional Theory Methods
Previous Article in Special Issue
Human Antimicrobial Peptides and Proteins
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Review

Antimicrobial Peptides in Reptiles

by
Monique L. Van Hoek
National Center for Biodefense and Infectious Diseases, and School of Systems Biology, George Mason University, MS1H8, 10910 University Blvd, Manassas, VA 20110, USA
Pharmaceuticals 2014, 7(6), 723-753; https://doi.org/10.3390/ph7060723
Submission received: 6 March 2014 / Revised: 9 May 2014 / Accepted: 12 May 2014 / Published: 10 June 2014

Abstract

Reptiles are among the oldest known amniotes and are highly diverse in their morphology and ecological niches. These animals have an evolutionarily ancient innate-immune system that is of great interest to scientists trying to identify new and useful antimicrobial peptides. Significant work in the last decade in the fields of biochemistry, proteomics and genomics has begun to reveal the complexity of reptilian antimicrobial peptides. Here, the current knowledge about antimicrobial peptides in reptiles is reviewed, with specific examples in each of the four orders: Testudines (turtles and tortosises), Sphenodontia (tuataras), Squamata (snakes and lizards), and Crocodilia (crocodilans). Examples are presented of the major classes of antimicrobial peptides expressed by reptiles including defensins, cathelicidins, liver-expressed peptides (hepcidin and LEAP-2), lysozyme, crotamine, and others. Some of these peptides have been identified and tested for their antibacterial or antiviral activity; others are only predicted as possible genes from genomic sequencing. Bioinformatic analysis of the reptile genomes is presented, revealing many predicted candidate antimicrobial peptides genes across this diverse class. The study of how these ancient creatures use antimicrobial peptides within their innate immune systems may reveal new understandings of our mammalian innate immune system and may also provide new and powerful antimicrobial peptides as scaffolds for potential therapeutic development.

1. Introduction

Reptiles are among the oldest amniotes. They are cold-blooded (ectothermic) vertebrates with dry and scaly skin that usually lay soft-shelled eggs with amniotic membranes. They thrive in diverse environments, ranging as far north as Hudson’s Bay in Canada, and as far south as Cape Horn, Chile. They range from very small geckos to enormous crocodiles and have survived millennia of evolution. They are highly adapted to their environment, including their innate immune systems, allowing them to be such successful animals. Antimicrobial peptides are part of the innate immune system, and may contribute to the survival of these animals in microbe-filled, challenging environment. This paper will review the known and predicted antimicrobial peptides of reptiles. A set of known host defense antimicrobial peptides is collected in the Antimicrobial Peptide Database [1,2] and the examples from reptiles have been annotated (Table 1). Recently, many reptilian genomes have been sequenced. From these genomes, potential antimicrobial peptide genes have been predicted here by bioinformatics analysis (Table 2, Table 3, Table 4, Table 5, Table 6, Table 7 and Table 8), which should be synthesized and tested for activity in future work. Overall, the Reptile class thrives in diverse and challenging environments, partly due to their robust innate immune system, and our hypothesis is that antimicrobial peptides contribute to the evolutionary success of reptiles as they do in mammals and other species.
Table 1. Known reptile antimicrobial peptides identified in the Antimicrobial Peptide Database (APD2) [2].
Table 1. Known reptile antimicrobial peptides identified in the Antimicrobial Peptide Database (APD2) [2].
Peptide nameSequenceAPD IdentifiedSource OrganismComment ReferenceActivity (*)
Cathelicidin
OH-CATHKRFKKFFKKLKNSVKKRAKKFFKKPRVIGVSIPFAP00895O. Hannah (Snake)Derivatives: OH-CATH30; OH-CM6 [3,4]G+, G−
Derivative OH-CATH30KFFKKLKNSVKKRAKKFFKKPRVIGVSIPF [5,6]G+, G−
Derivative OH-CM6KFFKKLKKAVKKGFKKFAKV [3, 4]G+, G−
BF-CATHKRFKKFFKKLKKSVKKRAKKFFKKPRVIGVSIPFAP00896Bungarus fasciatus (Snake)[7]G+, G−, F, Cancer cells
Derivative BF-30KFFRKLKKSVKKRAKEFFKKPRVIGVSIPFAP01239B. fasciatus[8,9,10]G+, G−
Derivative BF-15KFFRKLKKSVVKRFK B. fasciatus[8]G+, G−
NA-CATHKRFKKFFKKLKNSVKKRAKKFFKKPKVIGVTFPFAP00897N. atra (Snake)[3]G+, G−
Waprin
OmwaprinKDRPKKPGLCPPRPQKPCVKECKNDDSCPGQQKCCNYGCKDECRDPIFVGAP01589Oxyuranus microlepidotus (Snake)4S = S
[11, 12]
G+
Proline Rich
Lethal peptide I/WaglerinGGKPDLRPCHPPCHYIPRPKPRAP00238Trimeresurus wagleri, Wagler’s pit viper (Snake)P24335,
[13]
Tx
β-Defensin or defensin-like
TBD-1 (Turtle β-defensin 1)YDLSKNCRLRGGICYIGKCPRRFFRSGSCSRGNVCCLRFGAP01380Turtle3S = S
[14]
G+, G−, F
PelovaterinDDTPSSRCGSGGWGPCLPIVDLLCIVHVTVGCSGGFGCCRIGAP01381Turtle2JR3
BBBh2o
[15, 16]
G−
TEWP (turtle egg-white protein)EKKCPGRCTLKCGKHERPTLPYNCGKYICCVPVKVKAP01382Turtle2B5B
XXQ
[17,18,19]
G-, V
Crotamine defensin-like toxin
CrotamineYKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSGAP01650Snake Venom1Z99,
3S = S
ZZP
[20, 21]
G+, G−, F, P, Mammalian and Cancer cells
(*) Activity abbreviations: G+, G−, inhibiting both G+ and G− bacteria; G+, Gram-positive bacteria only, G−, Gram-negative bacteria only; V, antiviral; F, antifungal; P: antiparasitic, Tx: Toxin activity to mammals.

2. Four Orders of Reptiles

The structural and sequence diversity of antimicrobial peptides is impressive (see below), but it is useful to first review the phylogenetic and physiological diversity of the Reptilia class in order to appreciate all the ecosystems and environments that they live in and the prey that they eat.
All living reptiles fall within the kingdom Animalia, the phylum Chordata, the class Reptilia, and the clade Sauropsida [22]. There are four orders within the class Reptilia: turtles and tortoises (Testudines), tuataras (Sphenodontia), snakes and lizards (Squamata), and crocodilans (Crocodilia). Each order will be briefly introduced below. Many reptile species are endangered, including the painted turtle, and the Siamese crocodile. Although considered by phylogenetic analysis to be “monophyletic” with avians (Sauropsida; See Cladogram, Figure 1), reptiles are still generally considered to be separate from birds. Some researchers use the term avian reptile and non-avian reptile to distinguish the two groups [23]. Within the non-avian reptilians, the crocodilians are considered to be the most closely related to the avian branch. Interestingly, this evolutionary connection is reflected in the antimicrobial profile in that neither avians nor reptilians encode α-defensin antimicrobial peptides, for example, which are a critical part of mammalian innate immunity. In contrast, avians do not appear to express hepcidin peptides, while reptiles do, highlighting a potential difference.
Figure 1. Cladogram showing the relationships of extant members of the Sauria (Sauropsida) which includes birds and reptiles. Branch lengths are not representative of divergence time. 1. Tuataras; 2. Lizards; 3. Snakes; 4. Crocodiles; 5. Birds. Cladogram by Benchill, licensed under the Creative Commons Attribution 3.0 Unported license [24].
Figure 1. Cladogram showing the relationships of extant members of the Sauria (Sauropsida) which includes birds and reptiles. Branch lengths are not representative of divergence time. 1. Tuataras; 2. Lizards; 3. Snakes; 4. Crocodiles; 5. Birds. Cladogram by Benchill, licensed under the Creative Commons Attribution 3.0 Unported license [24].

2.1. Testudines (Turtles and Tortises)

The testudine order includes the turtles and tortosises. The western painted turtle (Chrysemys picta bellii) is a small turtle of North America, commonly found in ponds and other slow-moving fresh water [25].
Figure 2. Western Painted Turtle Chrysemys picta bellii. (a) Western painted turtle. Photo by Gary M. Stolz, U.S. Fish and Wildlife Service in the Public domain [26]. (b) Underside of a Western Painted Turtle. Photo by Matt Young [27].
Figure 2. Western Painted Turtle Chrysemys picta bellii. (a) Western painted turtle. Photo by Gary M. Stolz, U.S. Fish and Wildlife Service in the Public domain [26]. (b) Underside of a Western Painted Turtle. Photo by Matt Young [27].
This intensely colorful turtle (Figure 2) has existed for approximately 15 million years, according to the fossil record [25]. The genomes of three turtles have recently been sequenced, including the green sea turtle (Chelonia mydas) and the Chinese softshell turtle Pelodiscus sinensis [28], as well as the western painted turtle, Chrysemys picta bellii [29,30]. Interestingly, these papers place the turtles as a sister group to crocodiles and birds, which is different than their prior morphological classification [31]. The precise evolutionary relationship of the testudine class with other reptiles is a matter of current debate [32,33,34,35,36]. Their genomes appear to encode cathelicidin antimicrobial peptides that are “snake-like” but encode defensin type peptides (gallinacin-like) that may be more similar to “avian” antimicrobial peptides.

2.2. Sphenodontia (Tuataras)

The family Sphenodontidae (within Lepidosauromorpha) contains the genus of Sphenodon, which has one species, S. puctatus (previously thought to have three species including S. guntheri, and S. diversum, now considered sub-species) all commonly referred to as tuatara lizards [37,38], although they are not classified as lizards. The tuatara (Figure 3) is the farthest removed from the avian lineage in terms of evolution and is considered to be the most “ancient” extant reptile, in existence in its current form for 100 million years.
Figure 3. Sphenodon punctatus, Tuatara, Nga Manu, Waikanae, New Zealand. Photo by PhillipC [39].
Figure 3. Sphenodon punctatus, Tuatara, Nga Manu, Waikanae, New Zealand. Photo by PhillipC [39].
The tuatara lives only on the costal islands of New Zealand [40]. There are currently significant efforts underway to sequence the tuatara genome [41]. However, until the genomes and transcriptomes can be analyzed for antimicrobial peptides and verified from tuatara samples, there are no known antimicrobial peptides from the tuatara.

2.3. Squamata (Snakes and Lizards)

The Squamata order of Lepidosauromorpha includes lizards and snakes. In the group of snakes which although limbless are considered tetrapod vertebrates and are descended from four legged ancestors, we will consider elapid snakes and pythons. Elapid snakes are venomous, fanged snakes commonly found in warm climates. Pythons are nonvenomous snakes that are found in Africa, Asia and Australia. The King cobra (Ophiophagus (O.) hannah) is one of the longest venomous snakes [42], with lengths up to 18 ft (Figure 4a). The genus Naja is a group of venomous elapid snakes in southern Africa and South Asia, including the species Naja (N.) atra, the Chinese King cobra (Figure 4b). The Banded Krait (Bungarus (B.) fasciatus) is commonly found in Southeast Asia and India and has distinctive banding markings (Figure 4c). The Burmese python (Python bivittatus) is typically found in tropical areas including Southeast Asia and is one of the largest snakes, typically reaching 12 ft long. This snake is also found as an invasive species in the Florida Everglades in the Southeast United States [43]. Snakes encode well-studied cathelicidin peptides that appear to be generally similar throughout the reptiles, despite the well-known sequence diversity of cathelicidin antimicrobial peptides in general.
Figure 4. Elapid snakes (a) The King cobra (O. hannah) [44] (b) A juvenile Chinese cobra (N. atra) [45] (c) Banded Krait (B. fasciatus) [46].
Figure 4. Elapid snakes (a) The King cobra (O. hannah) [44] (b) A juvenile Chinese cobra (N. atra) [45] (c) Banded Krait (B. fasciatus) [46].
The Squamata order also includes the lizards. Unlike snakes, lizards have four legs and external ears. There are more than 6,000 species of lizards, making it the largest group of reptiles. Lizards inhabit a wide range of ecological niches, from hot, dry desserts to cool, moist forests. The main groups of lizards include Gekkota, Iguania, Scincomorpha and Platynota (Varanoidea). Although the tuatara looks much like a lizard, it is excluded from the lizard group. The Gekkota suborder includes geckos, while skinks fall into the suborder Scincomorpha. Monitor lizards, Komodo dragons and Gila monsters are classified as Platynota (Varanoidea). The suborder Iguania includes chameleons, anoles and iguanas. The Carolina green anole lizard (Anolis carolinensis) is a small tree-living lizard, often green or brown, commonly found in the southeastern United States. It has intense green, blue and white coloring, especially evident on the male, and has a pink dewlap on its throat (Figure 5). The Anole lizard genome encodes for many β-defensin antimicrobial peptide genes and lysozyme genes.
Figure 5. Male Carolina Anole with partially expanded dewlap [47].
Figure 5. Male Carolina Anole with partially expanded dewlap [47].
The genomes of several members of the Squamata have recently been sequenced including the anole lizard [23], the elapid snakes O. hannah [15], B. fasciatus, and N. atra [30]. High-throughput sequencing and mass-spectrometry proteomics has been recently performed on snake venom, which should provide a deep view of proteins and peptides produced in the venom [48]. Antimicrobial peptides have been identified in the anole (defensins) [49], as well as cathelicidins in all three species of elapid snakes (see below) [3]. Very recently, the python genome has been sequenced [30]. Genome projects are also underway for other reptiles, such as the common garter snake (Thamnophis sirtalis) [23].

2.4. Crocodilia (Crocodilians)

The order of crocodilians (Crocodilia) within the group Archosauromorpha includes alligators and caimans (family Alligatoridae), crocodiles (family Crocodylidae), and gharials (gavials, family Gavialidae) (Figure 6). Most species live in fresh-water, but a few have also adapted to salt-water conditions. These animals are evolutionarily ancient, and along with birds, are considered the only surviving relatives of dinosaurs (Archosauria). Within their semi-aquatic ecosystems, these large animals are the apex predators, using their powerful jaws to capture large and small prey [50]. They are cold-blooded and egg-laying. They can be found around the world, in the Americas, in Asia, South America, and Africa [51]. The ancestors of alligators and crocodiles first emerged in the Late Cretaceous era, and the modern alligators and crocodiles are estimated to be as much as 83 million years old.
Figure 6. Crocodilians. (a) The American alligator, Alligator mississippiensis [52]. (b) The Siamese crocodile, Crocodylus siamesnsis [53].
Figure 6. Crocodilians. (a) The American alligator, Alligator mississippiensis [52]. (b) The Siamese crocodile, Crocodylus siamesnsis [53].
Today, the American alligator is commonly found all around the Gulf of Mexico and Southeastern United States, having made a comeback from near extinction due to overhunting. The meat and skins of farmed alligators are now harvested for consumption and use. This large animal is typically 8–11 ft long and 200–500 lbs depending on gender and age [54]. The alligator has a broad snout and the top teeth come down over the bottom lips, unlike the crocodile. Alligators inhabit swamps such as the Great Dismal Swamp, rivers and streams, ponds and lakes, with a preference for fresh water over brackish water, and intolerance for salt water. Alligators can be infected by Mycoplasma alligatoris [55] as well as other bacterial pathogens. In terms of temperature preference, alligators are more cold tolerant than most other crocodilian species, accounting for their location as far north as South Carolina in the United States [54].
The Siamese crocodile (Crocodylus siamensis) [56,57] is a critically endangered freshwater crocodilian found in Southeast Asia (Cambodia, Vietnam, Thailand, Indonesia and Burma for example). Like most crocodiles, it is a tropical animal with low tolerance for the cold [3]. This animal is smaller than the alligator, typically about 7 ft long and 80–150 lbs when fully grown, although larger specimens have been recorded [4]. These animals are being intensively studied as part of their conservation, and are bred in captivity, and thus are accessible to researchers for DNA or blood samples [58,59,60].
Crocodilians such as alligators can carry a high burden of fecal coliforms from their aquatic environment [61], yet despite their potentially near-constant exposure to potential pathogens, alligators and other crocodilians do not seem to be susceptible to infection by these organisms, either systemically or on their skin, via wounds or lesions. This has led to the idea that these animals may have highly potent antimicrobial components to their immune systems [57,62,63,64,65,66,67]. Several crocodilian genomes have been published [68] or are underway [69]. The peptides that have been discovered in crocodilians are outlined in the sections below and include lysozyme, defensin, hepcidin, hemocidin and other antimicrobial peptides. Several important crocodilian genomes have been sequenced, including the Chinese alligator (Alligator sinensis), the American alligator (Alligator mississippiensis), the saltwater crocodile (Crocodylus porosus) and the Indian gharial (Gavialis gangeticus) [69,70]. It will be very interesting to compare freshwater species to saltwater species in terms of their innate immune response profiles, as the environmental organisms will be significantly different between the two types of water.

3. Antimicrobial Peptides of Reptiles

Reptiles are highly adapted to their environments, which often include many bacteria, allowing them to be such successful animals. Antimicrobial peptides are part of the innate immune system, and may contribute to the survival of reptiles. However, to date there has been no direct data in reptiles such as gene knock-out experiments to demonstrate their importance to overall survival, development and resistance to infection, as has been done in mice [71]. There has been some suggestion that β-defensin peptides are associated with fur color in dogs [72,73], but again no studies of this kind have yet been done on reptiles. This area of research presents many opportunities for scientists to explore the role of antimicrobial peptides in these animals. This paper will review the known (Table 1) and predicted antimicrobial peptides of reptiles. Recently, new reptilian genomes have been sequenced. From these genomes, additional antimicrobial peptide genes have been predicted here by bioinformatics analysis (Table 2, Table 3, Table 4, Table 5, Table 6, Table 7 and Table 8), which should be synthesized and tested for activity.
Antimicrobial peptides are well-characterized peptides, and exhibit significant structure-function specificity. Following the identification of magainin peptides in amphibians in 1987 [74], scientists have been exploring the diversity of peptides expressed in different animals, looking for new structures and new functions of antimicrobial peptides. The structure and function of each of the major classes of antimicrobial peptides is described below, in addition to the data pertaining to its known or predicted expression in reptiles.

3.1. Defensin Peptides in Reptiles

Defensins are one of the major classes of antimicrobial peptides in higher vertebrates. These 3–4 kDa cationic peptides are characterized by having six cysteines arranged in three disulfide bonds, with the characteristic pairing of the bonds highly characteristic for each type of defensin. Defensins have predominantly β-sheet characteristic with some α-helices. Defensins are encoded in the genome and are processed from a pro-defensin molecule by proteases [75].

3.1.1. Three Sub-Classes of Defensins

Defensins are known to be critical components of innate immunity in many animals [76]. The three main sub-classes of defensins are α, β- and θ-defensins. In humans, α-defensins are commonly found in neutrophils and other leukocytes (for example, Human Neutrophil peptide HNP-1 = α-defensin 1), and are important in the ability of white blood cells to deal with pathogens [77]. The β-defensins are defined as having a Cys1-Cys5, Cys2-Cys4, and Cys3-Cys6 bonding pattern of cysteines. In humans, β-defensins are commonly expressed in epithelial cells, and are widely expressed in the body [78]. The expression of these cationic antimicrobial peptides are often induced following bacterial or viral infection as part of the innate immune response, except for hBD1 which appears to be constitutively expressed in humans. The third class of defensins is the θ-defensins. θ-Defensins are not known outside of primates, and are not expressed in humans [21] but are very active antiviral peptides [76].
Within the reptiles, there are no known genes for α-defensins, and only the β-defensins appear to be expressed, similar to what is found in avians. Within some species of reptiles, β-defensin genes and peptides have been identified, for example in the red-eared slider turtle [79]. Lizards are known to be highly resistant to infection, and recently genes encoding up to 32 different β-defensin-like peptides were identified in the Anole carolinensis genome [49]. Indeed, using an antibody that reacts to AcBD15 (one of those β-defensin-like peptides in anole), staining was observed in some (but not all) of the granules of heterophilic and basophilic granulocytes in lizards, a snake, a turtle and the tuatara, but not alligator nor chicken granulocytes. Cells from other tissues such as epidermis were negative for staining. Alibardi et al. describe that not all the granules within a granulocyte stained with the antibody, suggesting that there may be different types of granules as is seen in mammalian neutrophils [22].
Similarly, turtle leukocytes were found to contain TBD-1, the first β-defensin identified in reptile leukocytes [14]. In the turtle system, TBD-1 was also identified in other tissues, such as the skin [18,80,81]. These fascinating and unique results suggest that further study of the antimicrobial peptidome of reptilian granulocytes should be performed.

3.1.2. Inducible Expression of β-Defensins in Wounded Lizards

The first extensive report of an in vivo role for β-defensin peptide expression was in the anole lizard (Table 2). It has long been known that lizards can lose their tails as a method of predator escape, and that these tail then regenerate from the wound site. In this process, a wound is formed, which does not typically get infected. β-Defensin peptides are found to be expressed both within the azurophilic granulocytes in the wound-bed as well as in the associated epithelium [82,83], and are observed in phagosomes containing degraded bacteria. While there is a distinct lack of inflammation in the wound, which is associated with regeneration, there is a high level of expression of AcBD15 and AcBD27 (two of the most highly expressed β-defensins in that tissue) [84,85]. Overall, there appears to be a fascinating role of AcBD15 and AcBD27 in the wound healing and regeneration in the anole lizard.
Table 2. Predicted defensin-like protein genes in multiple reptilian species.
Table 2. Predicted defensin-like protein genes in multiple reptilian species.
OrganismPeptide annotationaaLocus- Accession #
Alligator mississippiensisGallinacin-14-like58XP_006270781.1
Alligator sinensisGallinacin-14-like58XP_006033878.1
Anolis carolinensisβ-Defensin-like protein 562CBY85058.1
Anolis carolinensisβ-Defensin-like protein 865CBY85059.1
Anolis carolinensisβ-Defensin-like protein 966CBY85060.1
Anolis carolinensisβ-Defensin-like protein 1067CBY85061.1
Anolis carolinensisβ-Defensin-like protein 1563CCA62931.1
Anolis carolinensisβ-Defensin-like protein 2189CBY85062.1
Anolis carolinensisβ-Defensin-like protein 2295CBY85063.1
Anolis carolinensisβ-Defensin-like protein 2781CBY85064.1
Anolis carolinensisGallinacin-10-like68XP_003225602.1
Anolis carolinensisGallinacin-13-like60XP_003225598.1
Anolis carolinensisHypothetical protein LOC100555370 XP_003227809.1
Anolis carolinensisHypothetical protein LOC100555565 XP_003227810.1
Anolis carolinensisHypothetical protein LOC100555756 XP_003227811.1
Anolis carolinensisHypothetical protein LOC100562305 XP_003225604.1
Anolis carolinensisHypothetical protein LOC10056250265XP_003225605.1
Anolis carolinensisHypothetical protein LOC100562898 XP_003225607.1
Anolis carolinensisHypothetical protein LOC100563098 XP_003225608.1
Chrysemys picta belliiβ-Defensin 1-like80XP_005308390.1
Chrysemys picta belliiGallinacin-5-like XP_005290738.1
Chrysemys picta belliiGallinacin-5-like, partial XP_005314963.1
Chrysemys picta belliiGallinacin-14-like58XP_005308403.1
Pelodiscus sinensisGallinacin-1 α-like XP_006137072.1
Pelodiscus sinensisLingual antimicrobial peptide-like isoform X2 XP_006127561.1
Bothrops neuwiediβ-Defensin-like protein AGF25392.1
Bothrops jararacussuβ-Defensin-like protein AGF25388.1
Bothrops leucurusβ-Defensin-like protein AGF25389.1
Bothrops matogrossensisβ-Defensin-like protein AGF25391.1, AGF25390.1
Bothrops diporusβ-Defensin-like protein AGF25384.1
Bothrops pauloensisβ-Defensin-like protein AGF25393.1
Bothrops jararacaβ-Defensin-like protein AGF25386.1, AGF25387.1
Bothrops atroxβ-Defensin-like protein AGF25383.1
Bothrops erythromelasβ-defensin-like protein AGF25385.1

3.1.3. Expression of β-Defensins in Reptile Eggs

Reptile eggs are a good biological sample for the purification of peptides and proteins, since there is so much material within each egg. Recently, it was found that while the β-defensin-like peptide pelovaterin (Table 1) identified in the eggshell of the Chinese soft-shelled turtle does indeed have antimicrobial activity, these peptides may also play an additional role in the formation of the eggshell, through aggregation [15]. This is similar to the role of the gallin defensin-like peptide in avian eggs [86,87,88,89,90].

3.2. Cathelicidin Peptides in Reptiles

Cathelicidins are a second major class of antimicrobial peptides in higher eukaryotes. They are characterized as being antimicrobial peptides derived by proteolytic cleavage from a pre-propeptide that includes the cathelin domain in mammals and less-well conserved cathelin domain in other eukaryotes [91,92]. In humans, cathelicidins are stored in the azurophilic granules of neutrophils as the inactive prepropeptide, and are processed by enzymes (neutrophil elastase [93] or a serine protease [19]) to the mature active peptide [94]. In humans and higher vertebrates, the active cathelicidin peptide is always encoded on Exon 4 of the cathelicidin encoding gene [91,95,96]. Four cathelicidin-like peptides have been identified in the chicken (Gallus gallus domesticus) [97], including fowlicidin-1, -2 and -3 (also known as chCATH-1, chCATH-2/CMAP27, chCATH-3) [98], and chCATH-B1/chCATH-4 [99]. In humans, the hCAP18 cathelicidin is processed by proteinase 3 inside the granule [19] or neutrophil elastase in the extracellular space [4] to its active form. In the case of chicken cathelicidin, the pre-pro-cathelin domain peptide is cleaved by a serine protease to release the mature peptide following stimulation of heterophils with LPS [100].

3.3. Cathelicidin Peptides in Snakes

Cathelicidin peptides have been identified and characterized in the snake family (Table 1) [1,2], although there may be similar genes in other reptiles by genomic analysis (see below). Highly related cathelicidins were identified in B. fasciatus, O. hannah and N. atra [3] (Table 3). We identified additional genes for antimicrobial peptides by BLAST searching the genomes of the pit vipers (Bothrops atrox, Trimeresurus wagler and Crotalus durissus) [13] and the Eastern brown snake (Pseudonaja textilis) (Table 3). The genes of these cathelicidins have the general structure of the cathelicidin genes, including a poorly conserved cathelin domain and the c-terminal active peptide. The snake cathelicidins have been well studied. The functional cathelicidin peptide of the snake family is highly divergent from the functional cathelicidin peptide of humans, for example, confirming the “general rule” of cathelicidins, which is that the active peptides are highly divergent, but the pre-pro-regions in the gene and the peptide are more highly conserved [101].

3.3.1. King Cobra (Ophiophagus (O.) Hannah)

Zhao et al. determined the hemolytic and antimicrobial activity of the predicted O. hannah cathelicidin, OH-CATH [3] (Table 1). The OH-CATH peptide proved to be an excellent inhibitor of bacterial growth and demonstrated broad-spectrum activity against bacterial isolates including multi-drug resistant strains. The OH-CATH peptide displayed greater potency than the human cathelicidin LL-37 against a variety of known human bacterial pathogens and the antimicrobial potency of OH-CATH was not significantly impacted by the concentration of salt in the media. They demonstrated that OH-CATH showed no hemolytic activity against erythrocytes, even at a concentration of 200 μg/mL, suggesting low cytotoxicity of the peptide to eukaryotic cells [3]. Additional studies with smaller fragments of OH-CATH (Table 1) have also been tested and found to be active both in vitro and in vivo, even against antibiotic resistant bacteria [4,6]. Their strong antimicrobial activity and lack of hemolytic activity make the reptile cathelicidins strong candidates for development into new therapeutics.
Table 3. Known and predicted cathelicidin open reading frames in multiple snake species. The active antimicrobial peptides NA-CATH, BF-CATH and OH-CATH are highlighted.
Table 3. Known and predicted cathelicidin open reading frames in multiple snake species. The active antimicrobial peptides NA-CATH, BF-CATH and OH-CATH are highlighted.
Protein name [Organism]AccessionSequence
Cathelicidin-NA antimicrobial peptide [Naja atra]B6S2X0.11MEGFFWKTLLVVGALTISGTSSFPHKPLTYEEAVDLAVSVYNSKSG
EDSLYRLLEAVPALKWDALSESNQELNFSVKETV 80
81CQMAEERSLEECDFQEAGAVMGCTGYYFFGESPPVLVLTCKSVGNE-
EEQKQEEGNEEEKEVEKEEKEEDQKDQPKR 156
157V 191
Cathelicidin-BF antimicrobial peptide [Bungarus fasciatus]B6D434.11MEGFFWKTLLVVGALAIAGTSSLPHKPLIYEEAVDLAVSIYNSKSGEDS
LYRLLEAVSPPKWDPLSESNQELNFTMKETV 80
81CLVAEERSLEECDFQEDGAIMGCTGYYFFGESPPVLVLTCKPVGEE-
EEQKQEEGNEEEKEVEKEEKEEDEKDQPRR 156
157V 191
Cathelicidin-OH antimicrobial peptide [Ophiophagus hannah]B6S2X2.11MEGFFWKTLLVVGALAIGGTSSLPHKPLTYEEAVDLAVSIYNSKSGEDSL
YRLLEAVPPPEWDPLSESNQELNFTIKETV 80
81CLVAEERSLEECDFQEDGVVMGCTGYYFFGESPPVVVLTCKPVGEE-
GEQKQEEGNEEEKEVEEEEQEEDEKDQPRR 156
157V 191
cathelicidin-like peptide precursor
[Bothrops atrox]
AGS36140.11 MQGFFWKTWLVVALC--GTSSSLAHRPLSYGEALELALSIYNSKAG
EESLFRLLEAVPQPEWDPLSEGSQQLNFTIKETV 78
79CQVEEERPLEECGFQEDGVVLECTGYYFFGETPPVVVLTCVPVGG
V-EEEEEDE-EEQKAEVEKDEKEDEEKDRPKR 154
155VKRFKKFFKKLKNSVKKRVKKFFRKPRVIGVTFPF 189
cathelicidin-related antimicrobial peptide isoform precursor [Pseudonaja textilis]AGS36144.11 MEGFFWKTWLVVAAFAIGGTSSLPHKPLTYEEAVDLAVSTYNGKSGEE
SLYRLLEAVPPPKWDPLSESNQELNLTIKETV 80
81CLVAEERSLEECDFQDDGAVMGCTGYFFFGESPPVLVLTCEPLGED-EE
QNQEEE-------EEEEKEEDEKDQPRR 149
150VKRFKKFFMKLKKSVKKRVMKFFKKPMVIGVTFPF 184
cathelicidin-related antimicrobial peptide precursor
[Pseudonaja textilis]
AGS36143.11 MDGFFWKTWLVVAALAIGGTSSLPHKPLTYEEAVDLAVSTYNGKSGEES
LYRLLEAVPPPKWDPLSESNQELNLTIKETV 80
81CLVAEERSLEECDFQDDGAVMGCTGYFFFGESPPVLVLTCEPLGED-
EEQNQEEE-------EEEEKEEDEKDQPRR 149
150VKRFKKFFRKLKKSVKKRVKKFFKKPRVIGVTIPF 184
cathelicidin-like peptide precursor
[Bothrops lutzi]
AGS36141.11MQGFFWKTLLVVALC—GTSSSLAHRPLSYGEALELALSVYNSKAGE
ESLFRLLEAVPQPEWDPLSEGSQQLNFTIKETV 78
79CQVEEERPLEECGFQEDGVVLECTGYYFFGETPPVVVLTCVPVGG
V-EEEEEDE-EEQKAEVEKDEKEDEEKDRPKR 154
155VKRFKKFFKKLKNNVKKRVKKFFRKPRVIGVTIPF 189
cathelicidin-like peptide precursor [Lachesis muta rhombeata]AGS36142.11MQGFFWKTWLVLAVC--GTPASLAHRPLSYGEALELAVSVYNGKAGEAS
LYRLLEAVPQPEWDPSSEGSQQLNFTLKETA 78
79CQVEEERSLEECGFQEDGVVLECTGYYFFGETPPVVVLSCVPVGGV
eEEEEEEE-EEQKAEAENDEKEDEEKDQPKR 159
160160 VKRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTFPF 194
cathelicidin-like peptide precursor [Crotalus durissus terrificus]AGS36138.11MQGFFWKTWLVLAVC—GTPASLAHRPLSYGEALELAVSVYNGKAG
EASLYRLLEAVPQPEWDPSSEGSQQLNFTLKETA 78
79CQVEEERSLEECGFQEDGVVLECTGYYFFGETPPVVVLSCVPVGGV
eEEEEEEE-EEQKAEAENDEKGDEEKDQPKR 159
160VKRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF 194

3.3.2. Chinese King Cobra (Naja (N.) Atra)

The genus Naja is a group of venomous elapid snakes in the southern Africa and South Asia, including the species N. atra, the Chinese King cobra. The cathelicidin peptide from the Chinese King cobra, N. atra (NA-CATH) (Table 1), has been well studied. The full-length NA-CATH peptide was synthesized and was found to be antimicrobial against a wide variety of bacteria [102,103,104,105]. Smaller fragments of this peptide have been identified and found to be effective [102,103,104,105].
Interestingly, while the human cathelicidin peptide (LL-37) was found to exert antibiofilm activity against bacterial pathogens such as Pseudomonas [103] and Staphylococcus [105], NA-CATH did not exhibit antibiofilm effect against Pseudomonas, despite similar overall biophysical properties (length, size, charge) to LL-37.
The smallest identified fragment of NA-CATH is an 11-amino acid peptide, called ATRA, which imperfectly repeats in the NA-CATH sequence (Figure 7a) [102]. Variants of the ATRA peptide have been found to be very informative regarding the role of charged residues and proline residues in the activity of small antimicrobial peptides [102]. The peptide ATRA-1 is almost identical to the ATRA-2 peptide, with the exception of the 3d (A/F) and 10th (L/P) residues. Variants of these peptides were made to switch out the 3rd and 10th position amino acids, such that ATRA-1A contains alanine at position 3 rather than phenylalanine (F). Another variant was ATRA-1P, which contains proline at position 10 rather than leucine (L). All the peptides were the same length, similar molecular weight, and the same net charge. It was found for multiple gram-negative bacteria that ATRA-1P was almost as ineffective as ATRA-2, while ATRA-1A was as effective as ATRA-1 [102]. These results suggested that the introduction of a proline in ATRA-1P may have affected the charge distribution on that peptide, which then may disrupt the antibacterial activity of the peptide (Figure 7b,c).
Further studies have examined the d-amino acid enantiomer of the ATRA peptides [106], and found that d-ATRA-1A is as effective as ATRA-1A, and as it is protease resistant, potentially has a longer half-life. The ATRA peptides have also been demonstrated to be highly antimicrobial both in vitro and in vivo against both gram-negative bacteria such as Escherichia coli K12 strain and Aggregatibacter actinomycetemcomitans-Y4 [102], Pseudomonas aeruginosa [103] and Francisella novicida [104]. ATRA peptides are also antimicrobial against the gram-positive bacteria Staphylococcus aureus [105].

3.3.3. Banded Krait (B. fasciatus)

The cathelicidin peptide from B. fasciatus (BF-CATH, Table 1, Table 3) is also very well studied. The full-length BF-CATH peptide has been shown to have antimicrobial activity against a variety of bacteria including antibiotic resistant bacteria [7,107]. Smaller fragments of BF-CATH have also been expressed and studied [10,108] (Table 1). For example, BF-30 showed significant activity against drug-resistant E. coli and S. aureus both in vitro and in vivo [109]. BF-15 is a shorter version of BF-CATH with lower hemolytic activity, and broad-spectrum antimicrobial activity even against antibiotic-resistant bacteria [8].
Figure 7. Naja atra cathelicidin peptide analysis. (a) Sequences of the NA-CATH active peptide and derivatives [102,103,104,105]. (b) Helical wheel projection of NA-CATH. (c) Analysis of the active ATRA-1A peptide (d) Analysis of the inactive ATRA-1P peptide. From Rzlab.ucr.edu/scripts/wheel/wheel.cgi: “The hydrophilic residues are presented as circles, hydrophobic residues as diamonds, potentially negatively charged as triangles, and potentially positively charged as pentagons. Hydrophobicity is color coded as well: the most hydrophobic residue is green, and the amount of green is decreasing proportionally to the hydrophobicity, with zero hydrophobicitycoded as yellow. Hydrophilic residues are coded red with pure red being the most hydrophilic (uncharged) residue, and the amount of red decreasing proportionally to the hydrophilicity. The potentially charged residues are light blue.”
Figure 7. Naja atra cathelicidin peptide analysis. (a) Sequences of the NA-CATH active peptide and derivatives [102,103,104,105]. (b) Helical wheel projection of NA-CATH. (c) Analysis of the active ATRA-1A peptide (d) Analysis of the inactive ATRA-1P peptide. From Rzlab.ucr.edu/scripts/wheel/wheel.cgi: “The hydrophilic residues are presented as circles, hydrophobic residues as diamonds, potentially negatively charged as triangles, and potentially positively charged as pentagons. Hydrophobicity is color coded as well: the most hydrophobic residue is green, and the amount of green is decreasing proportionally to the hydrophobicity, with zero hydrophobicitycoded as yellow. Hydrophilic residues are coded red with pure red being the most hydrophilic (uncharged) residue, and the amount of red decreasing proportionally to the hydrophilicity. The potentially charged residues are light blue.”

3.3.4. Predicted Cathelicidins in Other Snake Species

By performing BLAST analysis with the elapid snake cathelicidins against other snake sequences in the database, we identified cathelicidin-like gene sequences in the venomous pit viper, Bothrops atrox, and the Eastern brown snake, Pseudonaja textilis (Table 3). These genes should be further studied to verify that cathelicidin-like peptides are produced and to determine the activity of these peptides.

3.4. Cathelicidin Peptides in Lizards

Cathelicidin-like peptides Ac-CATH-1, Ac-CATH-2a, Ac-CATH -2b, and Ac-CATH -3 have been reported in the genome of the Carolina anole lizard (Anolis carolinensis) [110] (Table 4). In addition, cathelicidin 1 and 2 antibody reactive peptides have been identified by immunocytochemistry staining within granules of heterophilic and basophilic granulocytes [111]. This study also identified cathelicidin-antibody staining material in wound epidermis and associated with bacteria within wounds [111].
Table 4. Predicted active cathelicidin peptides in the anole lizard [91,92].
Table 4. Predicted active cathelicidin peptides in the anole lizard [91,92].
OrganismPeptide annotation
Anolis carolinensisAc-CATH-1 MGRITRSRWGRFWRGAKRFVKKHGVSIALAGLRFG (+10)
Anolis carolinensisAc-CATH-2a/b DPQMTRFRGLGHFFKGFGRGFIWGLNH (+3)
Anolis carolinensisAc-CATH-3—no active peptide encoded.

3.5. Cathelicidin Peptides in Turtles

Analysis of the recently published genomes revealed that there are many cathelicin-like genes in turtles. While no active cathelicidin peptides have been demonstrated yet in the turtle (Table 1), there are at many predicted cathelicidin-like peptide genes (Table 5). Many of these are annotated as being similar to the snake cathelicidins (eg OH-CATH).
Table 5. Predicted cathelicidin pre-pro-protein genes in multiple turtle species.
Table 5. Predicted cathelicidin pre-pro-protein genes in multiple turtle species.
OrganismPeptide annotationLocus- Accession #
Chrysemys picta belliiCathelicidin-OH antimicrobial peptide-likeXM_005295113.1
Chrysemys picta belliiCathelicidin-OH antimicrobial peptide-likeXP_005295170.1
Chrysemys picta belliiCathelicidin-2-likeXP_005295171.1
Chrysemys picta belliiUncharacterized LOC101951069XR_255838.1
Chrysemys picta belliiUncharacterized LOC101951243XR_255839.1
Pelodiscus sinensisCathelicidin-2-likeXM_006114422.1
Pelodiscus sinensisCathelicidin-2-likeXM_006114419.1
Pelodiscus sinensisCathelicidin-OH antimicrobial peptide-like transcript variant X1XM_006129620.1
Pelodiscus sinensisCathelicidin-OH antimicrobial peptide-like transcript variant X2XM_006129621.1
Pelodiscus sinensisCathelicidin-OH antimicrobial peptide-likeXM_006129625.1
Pelodiscus sinensisCathelicidin-BF antimicrobial peptide-likeXP_006114480.1
Pelodiscus sinensisCathelicidin-BF antimicrobial peptide-likeXM_006114418.1
Pelodiscus sinensiCathelicidin-2-likeXP_006114484.
Pelodiscus sinensisCathelicidin-2-likeXP_006114481.1
Pelodiscus sinensisCathelicidin-OH antimicrobial peptide-like isoform X1XP_006129682.1
Pelodiscus sinensisCathelicidin-OH antimicrobial peptide-like isoform X2XP_006129683.1
Pelodiscus sinensisCathelicidin-OH antimicrobial peptide-likeXP_006129687.1
Chelonia mydasHypothetical protein UY3_13361EMP29519.1
Chelonia mydasHypothetical protein UY3_13360EMP29518.1

3.6. Cathelicidin Peptides in Crocodilians

Analysis of the databases revealed that there are many cathelicidin-like genes in alligators. While no active cathelicidin peptides have been demonstrated yet in the alligator (Table 1), there are at many predicted cathelicidin-like peptide genes (Table 6). Many of these genes are annotated as being similar to the snake cathelicidins (e.g., OH-CATH).
Table 6. Predicted cathelicidin pre-pro-protein genes in Alligator species.
Table 6. Predicted cathelicidin pre-pro-protein genes in Alligator species.
OrganismPeptide annotationLocus- Accession #
Alligator mississippiensisCathelicidin-2-likeXM_006262429.1
Alligator mississippiensisCathelicidin-2-likeXP_006262491.1
Alligator mississippiensisCathelicidin-OH antimicrobial peptide-likeXM_006262431.1
Alligator mississippiensisCathelicidin-OH antimicrobial peptide-likeXM_006262430.1
Alligator mississippiensisCathelicidin-OH antimicrobial peptide-likeXP_006262492.1
Alligator mississippiensisCathelicidin-OH antimicrobial peptide-likeXP_006262493.1
Alligator sinensisCathelicidin-2-likeXM_006026412.1
Alligator sinensisCathelicidin-2-likeXP_006026474.1
Alligator sinensisCathelicidin-2-likeXP_006026475.1
Alligator sinensisCathelicidin-3-likeXM_006026409.1
Alligator sinensisCathelicidin-3-likeXP_006026471.1
Alligator sinensisCathelicidin-OH antimicrobial peptide-likeXM_006037224.1
Alligator sinensisCathelicidin-OH antimicrobial peptide-likeXM_006026410.1
Alligator sinensisCathelicidin-OH antimicrobial peptide-likeXM_006026411.1
Alligator sinensisCathelicidin-OH antimicrobial peptide-likeXM_006037211.1
Alligator sinensisCathelicidin-OH antimicrobial peptide-likeXP_006037286.1
Alligator sinensisCathelicidin-OH antimicrobial peptide-likeXP_006026472.1
Alligator sinensisCathelicidin-OH antimicrobial peptide-likeXP_006037273.1
Alligator sinensisCathelicidin-OH antimicrobial peptide-likeXP_006026487.1

4.1. Liver-Derived Peptides in Reptiles

4.1.1. Hepcidin (HAMP1)

Hepcidin antimicrobial peptides are liver-expressed peptides containing eight cysteines (four disulfide bonds) that are broadly antimicrobial, binds iron and is involved in ferroportin binding [112,113]. A gene encoding a hepcidin-like peptide (E8ZAD0_CROSI) was recently proposed to be encoded by the Siamese crocodile (Crocodylus siamensis). A 26 aa peptide (Cshepc), representing the predicted active peptide (FNSHFPICSYCCNCCRNKGCGLCCRT), was expressed in yeast, and the unpurified product was found to have antimicrobial activity against both Gram-positive bacteria such as S. aureus and Bacillus subtilis, as well as Gram-negative bacteria Escherichia coli and Aeromonas sobria [114]. Hepcidin-like sequences were also identified in the anole lizard, although interestingly hepcidins appear to be missing in most avians [115].

4.1.2. LEAP-2, Liver Expressed Antimicrobial Peptide-2

Another liver-expressed peptide, LEAP-2, is expressed in many different organisms, has broad-spectrum antibacterial and antifungal activity, and can be induced following bacterial challenge [116,117,118]. This 40 aa, 4-cysteine, cationic peptide differs significantly from hepcidin in sequence and predicted structure [119], but is also predominantly expressed in the liver.
The Leap-2 gene is annotated in many of the sequenced reptiles (Table 7), including Pelodiscus sinensis, Chrysemys picta bellii, Alligator sinensis, Alligator mississippiensis, as identified by a BLAST analysis we performed with the LEAP-2 from Anolis carolinensis. The antimicrobial activity or biological role of this peptide in reptiles has not been studied.
Table 7. Predicted LEAP-2 pre-propeptide amino-acid sequences identified in reptiles.
Table 7. Predicted LEAP-2 pre-propeptide amino-acid sequences identified in reptiles.
SpeciesPredicted LEAP-2 full sequenceAccession Number
Anolis carolinensisMTPLKITAVILICSALLFQTQGASLYPPNSQLVRQR
RMTPFWRGISRPIGASCRDNSECSTRLCRSKHCSLRTSQE
XP_003217432.1
Alligator sinensisMHWLKVIAVMLLFALHLFQIHCASLHQPNSQPKRQRRM
TPFWRGVSSLRPIGASCRDDIECVTMLCRKSHCSLRTSRE
XP_006023615.1
Alligator mississippiensisMHWLKVIAVMLLFALHLFQIHCASLHQPNSQPKRQRRM
TPFWRGVSSLRPIGASCKDDGECITMRCRKSHCSLRTSRE
XP_006263463.1
Pelodiscus sinensisMQCLKVIALLLFCAALLTQTHCASLHHSSSQLTRQRRMTP
FWRGISLRPIGALCRHDNECISMLCRKNRCSLRISCE
XP_006128591.1
Chrysemys picta belliMQYLKVIAVLLLCAALLSQIHSASLHRPSSHLTRQRRMTPF
WRGISLRPIGAICRDDSECVSRLCRKNHCSIRISRA
XP_005302895.1

4.2. Lysozyme in Reptiles

Lysozyme is a very important part of innate immunity in most animals. In humans, it is packaged into neutrophil granules, released in tears and other secretions, and is very effective against a broad spectrum of bacteria. Not surprisingly, reptiles have also been found to use lysozyme as part of their innate immune response. In the crocodilians, a lysozyme-like enzyme was identified with broad-spectrum antibacterial activity [67]. Lysozyme proteins very similar to chicken lysozymes (~130 aa) have been identified from some species of turtles, including the soft shelled turtle (Trionyx sinensis), the Asiatic soft shelled turtle (Amyda cartilagenea) and the green sea turtle (Chelonia mydas) [17,19,120,121,122], although the antimicrobial activity of these molecules has not yet been proven. Lysozyme peptide has also been identified from Crocodylus siamensis [67]. Lysozyme-like genes were identified by analysis of reptile genomes (Table 8).

4.3. Crotamine Peptides in Reptiles

Defensins are one example of cysteine-stabilized polypeptides with antimicrobial function. A similar family of peptides is the crotamine toxin family isolated from rattlesnakes with a similar gamma-core motif to defensins [123,124], which is considered a cell-penetrating peptide The sequence of crotamine is YKQCHKKGGHCFPKEKICLPPSSDFGKMDCRWRWKCCKKGSG (+8) [2]. This cationic peptide contains nine lysines (underlined), three disulfide bonds (6 cysteines, shown in bold) and has a defensin-like fold (Figure 8).
Table 8. Selected predicted lysozyme genes identified in reptiles.
Table 8. Selected predicted lysozyme genes identified in reptiles.
Reptile nameEnzyme NameAccession Number
Softshell turtle lysozyme C(SSTL)Lysozyme C (1,4-β-N-acetylmuramidase C)Q7LZQ1.3
Asiatic softshell turtle lysozyme C (ASTL)Lysozyme CP85345.1
Pelodiscus sinensisLysozymeADR51676.1
Pelodiscus sinensisPREDICTED: lysozyme g-like isoform X2XP_006113603.1
Pelodiscus sinensisPREDICTED: lysozyme g-like isoform X1XP_006113602.1
Pelodiscus sinensisPREDICTED: lysozyme g-likeXP_006113601.1
Chelonia mydasLysozyme CEMP38935.1
Chelonia mydasLysozyme GEMP27176.1
Chrysemys picta belliiPREDICTED: lysozyme C-likeXP_005314893.1
Chrysemys picta belliiPREDICTED: lysozyme C-likeXP_005312037.1
Chrysemys picta belliiPREDICTED: lysozyme g-like protein 2XP_005283410.1
Chrysemys picta belliiPREDICTED: lysozyme G-likeXP_005283294.1
Ophiophagus hannahLysozyme C, partialETE58503.1
XP_003225844.1,
Anolis carolinensisLysozyme C, milk isozyme-likeXP_003216710.1,
XP_003216704.1
Anolis carolinensisLysozyme C II-likeXP_003224512.1
Anolis carolinensisLysozyme g-likeXP_003227178.1
Alligator sinensisLysozyme C-likeXP_006027022.1,
XP_006027021.1
Alligator sinensisLysozyme G-likeXP_006026406.1,
XP_006026397.1,
XP_006026395.1,
XP_006026396.1
Figure 8. The crotamine chemical structure. Crotamine, a Na+ channel-affecting toxin from Crotalus durissus terrificus venom (PDB 1H5O) [125].
Figure 8. The crotamine chemical structure. Crotamine, a Na+ channel-affecting toxin from Crotalus durissus terrificus venom (PDB 1H5O) [125].
Some reptiles are known to express crotamine-like peptides, and The X-ray structure of crotamine, from the Brazilian snake Crotalus durissus terrificus, was recently solved (PDB 4GV5_A) [126]. We found that some species of reptiles have genes that are annotated as crotamine-like (Table 9).
Table 9. Crotamine-like peptide genes in reptiles.
Table 9. Crotamine-like peptide genes in reptiles.
ReptileAANameAccession numbers
Uromastyx aegyptia67crotamine-Uro-1AGI97143.1
Crotalus durissus terrificus65crotamineAAF34911.1, AAF34910.1, AAC02995.1, AAC06241.1
Crotalus durissus34crotamineACA63453.1, ACA63452.1, ACA63451.1, ACA63450.1, ACA63449.1, ACA63448.1, ACA63447.1, ACA63446.1
Crotalus oreganus helleri65crotamine 7AEU60015.1
Crotalus oreganus helleri65crotamine 6AEU60014.1
Crotalus oreganus helleri65crotamine 5AEU60013.1
Crotalus oreganus helleri70crotamine 4AEU60012.1
Crotalus oreganus helleri70crotamine 3AEU60011.1
Crotalus oreganus helleri83crotamine 2AEU60010.1
Crotalus oreganus helleri70crotamine 1AEU60009.1
Pogona barbata102CLP-POGL1AAZ75614.1
Pogona barbata67CLP-POGL2AAZ75615.1
Pogona barbata61CLP-POGU3AAZ75613.1
Pogona barbata98CLP-POGU2AAZ75612.1
Pogona barbata76CLP-POGU1AAZ75611.1
Varanus tristis83crotamine-Var-5AGI97148.1
Varanus glauerti83crotamine-Var-4AGI97147.1
Varanus glauerti83crotamine-Var-3AGI97146.1
Varanus glauerti83crotamine-Var-2AGI97145.1
Varanus glauerti83crotamine-Var-1AGI97144.1
It has been a matter of some debate whether crotamine peptides are antimicrobial or if they just contain a similar cysteine-stabilized core structure. Recently, it was demonstrated that crotamine toxin is expressed similarly on epithelial or mucosal surfaces, and displays some antimicrobial activity against Bacillus subtilis, and was able to permeabilize Staphylococcus aureus cells, for example [20]. In addition, crotamine has been shown to be antifungal [127]. Thus, it seems that crotamine should be considered as an antimicrobial peptide of reptiles.

4.4. Other Peptides in Reptiles

4.4.1. Leucrocin

There are a handful of peptides identified in reptiles that were not easily classified in the categories above. One interesting example is the peptide leucrocin, an antibacterial compound from white blood cells of the Siamese crocodile (Crocodylus siamensis). Unlike Crocosin [65], which does not appear to be peptide based, leucrocins are very small peptides with antibacterial activity. The amino acid sequence of Leucrocin I is NGVQPKY, and of Leucrocin II is NAGSLLSGWG [66]. No known genes encode for these peptides, so their source is unclear. Recently, a synthetic peptide based on the Leucrocin sequence was found to have broad-spectrum antibacterial activity [128].

4.4.2. Omwaprin

Another example of an unusual antimicrobial peptide in reptiles is omwaprin, which is a member of the waprin family of venom proteins (Sequence shown in Table 1) [11,12], and was isolated from the Australian inland taipan (Oxyuranus microlepidotus), considered the most venomous snake (a member of the Elapid family of snakes). This 50 aa peptide has relatively salt-tolerant antibacterial activity against gram-positive bacteria and was found to be non-toxic to mice upon injection. Its activity was found to be highly dependent upon the four disulfide-bonds, similar to the hepcidins and defensins [11]. Thus, except for its large size, this peptide appears to have many favorable properties as a potential therapeutic candidate.

4.4.3. Hemocidin

Fragments of hemoglobin have been found to have some antimicrobial activity, and have been referred to as hemocidins [129,130,131]. In the study of the Siamese crocodile, 13 fragments of crocodile hemoglobin were found to have antimicrobial activity, including peptides similar to hemoglobin β subunit [59,60]. Recently, the hemoglobin α- and β-chains of crocodilian species (Crocodylus siamensis, Alligator mississippiensis, Crocodylus niloticus and Caiman crocodilus) have been reported [132]. The in vivo relevance of these peptides in the crocodile remains to be determined, but it represents a potential other class of antimicrobial peptides from reptiles that should be investigated.

4.4.4. Other Peptides

Other peptides have been identified in reptiles that do not fall into the various classes of antimicrobial peptides described above. These include a short, synthetic tryptophan-rich cationic antimicrobial peptide, pEM-2 (KKWRWWLKALAKK) that was shown to have broad-spectrum bactericidal activities, and was identified as a fragment of myotoxin II, a snake venom Lys49 phospholipase A2 [133,134]. Synthetic variants of this peptide were shown to have improved antimicrobial activity, salt resistance and reduced hemolytic activity [135,136]. These peptides have led to other advances in rational design of synthetic peptides, including peptides with exclusively arginine and tryptophan residues [137].
Gomes et al isolated, but did not sequence, a small 1370 Da peptide from the venom of a pit viper (Borthrops jaracaca), which showed very good activity against different fungi and yeast [138].
Another group identified an antimicrobial peptide derived from N. atra venom, the vgf-1 peptide, and found that this peptide had significant antimicrobial activity against drug-resistant clinical strains of Mycobacterium tuberculosis [139].

5. Conclusions

Reptiles are evolutionarily ancient, found in diverse and microbially challenging environments and appear to have robust immune systems. Some reptiles, especially lizards, have unique properties such as tail regeneration. All of these features suggest that reptiles may express many interesting antimicrobial peptides. A few reptilian antimicrobial peptides have been isolated and studied which demonstrate broad-spectrum antimicrobial and antifungal activity. These include members of the cathelicidin and defensin and lysozyme class.
Antimicrobial peptides are known in three of the four orders of reptiles: the testudines, crocodilians, and the squamata. No peptides are known from the sphenodontia (tuataras), as this organism has just been sequenced [41]. Reptile neutrophils appear to have granules that contain both cathelicidin-like peptides as well as β-defensin peptides, although unlike mammals, there are no genes encoding α-defensins. β-defensin-like peptides and lysozyme are also found in reptile eggs. These peptides are expressed in wounds, such as when lizards lose their tails. Detailed study of the Chinese cobra Naja atra cathelicidin peptides has revealed smaller peptides that could be useful for therapeutic applications.
Overall, reptiles reflect the diversity of antimicrobial peptides within higher organisms. They appear to express cathelicidins and β-defensins, and express hepcidins unlike avians. Additional classes of antimicrobial peptides such as lysozyme, LEAP-2 and crotamine also appear to be highly expressed in reptiles. With the advent of high-throughput genomics, new reptilian genomes have been sequenced and their transcriptomes determined. Analysis of these sequences has revealed that there are additional genes that may encode AMPs in reptiles. Future studies may reveal the in vivo role of antimicrobial peptides in reptiles. In the face of the emerging challenges due to antibiotic resistant bacteria, new and useful molecules that could be developed into future antibiotics may potentially be found in the reptilian AMPs.

Acknowledgments

MVH was partially supported by HDTRA1-12-C-0039, Translational Peptides for Personnel Protection.

Conflicts of Interest

The author declares no conflict of interest.

References

  1. Wang, G. Antimicrobial Peptide Database. Available online: http://aps.unmc.edu/AP (accessed on 9 May 2014).
  2. Wang, G.; Li, X.; Wang, Z. APD2: The updated antimicrobial peptide database and its application in peptide design. Nucleic Acids Res. 2009, 37, D933–D937. [Google Scholar] [CrossRef]
  3. Zhao, H.; Gan, T.X.; Liu, X.D.; Jin, Y.; Lee, W.H.; Shen, J.H.; Zhang, Y. Identification and characterization of novel reptile cathelicidins from elapid snakes. Peptides 2008, 29, 1685–1691. [Google Scholar] [CrossRef]
  4. Li, S.A.; Lee, W.H.; Zhang, Y. Efficacy of OH-CATH30 and its analogs against drug-resistant bacteria in vitro and in mouse models. Antimicrob. Agents Chemother. 2012, 56, 3309–3317. [Google Scholar] [CrossRef]
  5. Zhang, B.Y.; Li, S.M.; Gao, Z.H.; Shen, J.H. Protective effects of snake venom antimicrobial peptide OH-CATH on E. coli induced rabbit urinary tract infection models. Dong Wu Xue Yan Jiu 2013, 34, 27–32. [Google Scholar]
  6. Zhang, Y.; Zhao, H.; Yu, G.Y.; Liu, X.D.; Shen, J.H.; Lee, W.H.; Zhang, Y. Structure-function relationship of king cobra cathelicidin. Peptides 2010, 31, 1488–1493. [Google Scholar] [CrossRef]
  7. Wang, Y.; Hong, J.; Liu, X.; Yang, H.; Liu, R.; Wu, J.; Wang, A.; Lin, D.; Lai, R. Snake cathelicidin from Bungarus fasciatus is a potent peptide antibiotics. PloS One 2008, 3, e3217. [Google Scholar]
  8. Chen, W.; Yang, B.; Zhou, H.; Sun, L.; Dou, J.; Qian, H.; Huang, W.; Mei, Y.; Han, J. Structure-activity relationships of a snake cathelicidin-related peptide, BF-15. Peptides 2011, 32, 2497–2503. [Google Scholar] [CrossRef]
  9. Wang, H.; Ke, M.; Tian, Y.; Wang, J.; Li, B.; Wang, Y.; Dou, J.; Zhou, C. BF-30 selectively inhibits melanoma cell proliferation via cytoplasmic membrane permeabilization and DNA-binding in vitro and in B16F10-bearing mice. Eur. J. Pharmacol. 2013, 707, 1–10. [Google Scholar]
  10. Zhou, H.; Dou, J.; Wang, J.; Chen, L.; Wang, H.; Zhou, W.; Li, Y.; Zhou, C. The antibacterial activity of BF-30 in vitro and in infected burned rats is through interference with cytoplasmic membrane integrity. Peptides 2011, 32, 1131–1138. [Google Scholar] [CrossRef]
  11. Nair, D.G.; Fry, B.G.; Alewood, P.; Kumar, P.P.; Kini, R.M. Antimicrobial activity of omwaprin, a new member of the waprin family of snake venom proteins. Biochem. J. 2007, 402, 93–104. [Google Scholar] [CrossRef]
  12. Banigan, J.R.; Mandal, K.; Sawaya, M.R.; Thammavongsa, V.; Hendrickx, A.P.; Schneewind, O.; Yeates, T.O.; Kent, S.B. Determination of the X-ray structure of the snake venom protein omwaprin by total chemical synthesis and racemic protein crystallography. Protein Sci. 2010, 19, 1840–1849. [Google Scholar] [CrossRef]
  13. Schmidt, J.J.; Weinstein, S.A.; Smith, L.A. Molecular properties and structure-function relationships of lethal peptides from venom of Wagler’s pit viper, Trimeresurus wagleri. Toxicon 1992, 30, 1027–1036. [Google Scholar] [CrossRef]
  14. Stegemann, C.; Kolobov, A., Jr.; Leonova, Y.F.; Knappe, D.; Shamova, O.; Ovchinnikova, T.V.; Kokryakov, V.N.; Hoffmann, R. Isolation, purification and de novo sequencing of TBD-1, the first beta-defensin from leukocytes of reptiles. Proteomics 2009, 9, 1364–1373. [Google Scholar] [CrossRef]
  15. Lakshminarayanan, R.; Vivekanandan, S.; Samy, R.P.; Banerjee, Y.; Chi-Jin, E.O.; Teo, K.W.; Jois, S.D.; Kini, R.M.; Valiyaveettil, S. Structure, self-assembly, and dual role of a beta-defensin-like peptide from the Chinese soft-shelled turtle eggshell matrix. J. Am. Chem. Soc. 2008, 130, 4660–4668. [Google Scholar] [CrossRef]
  16. Lakshminarayanan, R.; Chi-Jin, E.O.; Loh, X.J.; Kini, R.M.; Valiyaveettil, S. Purification and characterization of a vaterite-inducing peptide, pelovaterin, from the eggshells of Pelodiscus sinensis (Chinese soft-shelled turtle). Biomacromolecules 2005, 6, 1429–1437. [Google Scholar] [CrossRef]
  17. Thammasirirak, S.; Ponkham, P.; Preecharram, S.; Khanchanuan, R.; Phonyothee, P.; Daduang, S.; Srisomsap, C.; Araki, T.; Svasti, J. Purification, characterization and comparison of reptile lysozymes. Comp. biochem. Phys. Toxicol. Pharmacol. 2006, 143, 209–217. [Google Scholar]
  18. Chattopadhyay, S.; Sinha, N.K.; Banerjee, S.; Roy, D.; Chattopadhyay, D.; Roy, S. Small cationic protein from a marine turtle has beta-defensin-like fold and antibacterial and antiviral activity. Proteins 2006, 64, 524–531. [Google Scholar] [CrossRef]
  19. Ponkham, P.; Daduang, S.; Kitimasak, W.; Krittanai, C.; Chokchaichamnankit, D.; Srisomsap, C.; Svasti, J.; Kawamura, S.; Araki, T.; Thammasirirak, S. Complete amino acid sequence of three reptile lysozymes. Comp. Biochem. Phys. Toxicol. Pharmacol. 2010, 151, 75–83. [Google Scholar] [CrossRef]
  20. Yount, N.Y.; Kupferwasser, D.; Spisni, A.; Dutz, S.M.; Ramjan, Z.H.; Sharma, S.; Waring, A.J.; Yeaman, M.R. Selective reciprocity in antimicrobial activity versus cytotoxicity of hBD-2 and crotamine. Proc. Natl. Acad. Sci. USA 2009, 106, 14972–14977. [Google Scholar] [CrossRef]
  21. Coronado, M.A.; Georgieva, D.; Buck, F.; Gabdoulkhakov, A.H.; Ullah, A.; Spencer, P.J.; Arni, R.K.; Betzel, C. Purification, crystallization and preliminary X-ray diffraction analysis of crotamine, a myotoxic polypeptide from the Brazilian snake Crotalus durissus terrificus. Acta Crystallogr. F 2012, 68, 1052–1054. [Google Scholar] [CrossRef]
  22. Modesto, S.P.; Anderson, J.S. The phylogenetic definition of reptilia. Syst. Biol. 2004, 53, 815–821. [Google Scholar] [CrossRef]
  23. Alfoldi, J.; Di Palma, F.; Grabherr, M.; Williams, C.; Kong, L.; Mauceli, E.; Russell, P.; Lowe, C.B.; Glor, R.E.; Jaffe, J.D.; et al. The genome of the green anole lizard and a comparative analysis with birds and mammals. Nature 2011, 477, 587–591. [Google Scholar] [CrossRef]
  24. Cladogram by Benchill, licensed under the Creative Commons Attribution 3.0 Unported license. Available online: http://en.wikipedia.org/wiki/File:Tuatara_cladogram.svg (accessed on 9 May 2014).
  25. Ernst, C.H.; Lovich, J.E. Turtles of the United States and Canada, 2nd ed.; Johns Hopkins University Press: Baltimore, MD, USA, 2009; pp. 185–259. [Google Scholar]
  26. Photo from Oregon Department of Fish & Wildlife, licensed under the Creative Commons Attribution-Share Alike 2.0 Generic license. Photo by Gary M. Stolz/U. S. Fish and Wildlife Service in the Public domain. Available online: http://en.wikipedia.org/wiki/FileA4_Western_painted_turtle.jpg (accessed on 9 May 2014).
  27. Underside of a Western Painted Turtle. Photo by Matt Young, l.u.t.C.C.A.-S.A.G.l. Available online: http://en.wikipedia.org/wiki/File:B4_Western_painted_turtle_underside.jpg (accessed on 9 May 2014).
  28. Wang, Z.; Pascual-Anaya, J.; Zadissa, A.; Li, W.; Niimura, Y.; Huang, Z.; Li, C.; White, S.; Xiong, Z.; Fang, D.; et al. The draft genomes of soft-shell turtle and green sea turtle yield insights into the development and evolution of the turtle-specific body plan. Nat. Genet. 2013, 45, 701–706. [Google Scholar] [CrossRef]
  29. Jiang, J.J.; Xia, E.H.; Gao, C.W.; Gao, L.Z. The complete mitochondrial genome of western painted turtle, Chrysemys picta bellii (Chrysemys, Emydidae). Mitochondrial DNA 2014. [Google Scholar] [CrossRef]
  30. Shaffer, H.B.; Minx, P.; Warren, D.E.; Shedlock, A.M.; Thomson, R.C.; Valenzuela, N.; Abramyan, J.; Amemiya, C.T.; Badenhorst, D.; Biggar, K.K.; et al. The western painted turtle genome, a model for the evolution of extreme physiological adaptations in a slowly evolving lineage. Genome Biol. 2013, 14, R28. [Google Scholar] [CrossRef]
  31. Gilbert, S.F.; Corfe, I. Turtle origins: Picking up speed. Dev. Cell 2013, 25, 326–328. [Google Scholar] [CrossRef]
  32. Zardoya, R.; Meyer, A. Complete mitochondrial genome suggests diapsid affinities of turtles. Proc. Natl. Acad. Sci. USA 1998, 95, 14226–14231. [Google Scholar] [CrossRef]
  33. Iwabe, N.; Hara, Y.; Kumazawa, Y.; Shibamoto, K.; Saito, Y.; Miyata, T.; Katoh, K. Sister group relationship of turtles to the bird-crocodilian clade revealed by nuclear DNA-coded proteins. Mol. Biol. Evol. 2005, 22, 810–813. [Google Scholar] [CrossRef]
  34. Roos, J.; Aggarwal, R.K.; Janke, A. Extended mitogenomic phylogenetic analyses yield new insight into crocodylian evolution and their survival of the Cretaceous-Tertiary boundary. Mol. Phylogenet. Evol. 2007, 45, 663–673. [Google Scholar] [CrossRef]
  35. Katsu, Y.; Matsubara, K.; Kohno, S.; Matsuda, Y.; Toriba, M.; Oka, K.; Guillette, L.J., Jr.; Ohta, Y.; Iguchi, T. Molecular cloning, characterization, and chromosome mapping of reptilian estrogen receptors. Endocrinology 2010, 151, 5710–5720. [Google Scholar]
  36. Lyson, T.R.; Sperling, E.A.; Heimberg, A.M.; Gauthier, J.A.; King, B.L.; Peterson, K.J. MicroRNAs support a turtle + lizard clade. Biol. Lett. 2012, 8, 104–107. [Google Scholar] [CrossRef]
  37. Jones, M.E.; Cree, A. Tuatara. Curr. Biol. 2012, 22, R986–R987. [Google Scholar] [CrossRef]
  38. Hay, J.M.; Sarre, S.D.; Lambert, D.M.; Allendorf, F.W.; Daugherty, C.H. Genetic diversity and taxonomy: A reassessment of species designation in tuatara (Sphenodon: Reptilia). Conserv. Genet. 2010, 11, 1063–1081. [Google Scholar]
  39. Photo by PhillipC, licensed under the Creative Commons Attribution 2.0 Generic license. Available online: http://en.wikipedia.org/wiki/File:Sphenodon_punctatus_in_Waikanae,_New_Zealand.jpg (accessed on 9 May 2014).
  40. Ramstad, K.M.; Nelson, N.J.; Paine, G.; Beech, D.; Paul, A.; Paul, P.; Allendorf, F.W.; Daugherty, C.H. Species and cultural conservation in New Zealand: maori traditional ecological knowledge of tuatara. Conserv. Biol. 2007, 21, 455–464. [Google Scholar] [CrossRef]
  41. Miller, H.C.; Biggs, P.J.; Voelckel, C.; Nelson, N.J. De novo sequence assembly and characterisation of a partial transcriptome for an evolutionarily distinct reptile, the tuatara (Sphenodon punctatus). BMC Genomics 2012, 13, 439. [Google Scholar] [CrossRef]
  42. Vonk, F.J.; Casewell, N.R.; Henkel, C.V.; Heimberg, A.M.; Jansen, H.J.; McCleary, R.J.; Kerkkamp, H.M.; Vos, R.A.; Guerreiro, I.; Calvete, J.J.; et al. The king cobra genome reveals dynamic gene evolution and adaptation in the snake venom system. Proc. Natl. Acad. Sci. US A 2013, 110, 20651–20656. [Google Scholar] [CrossRef]
  43. Pyron, R.A.; Burbrink, F.T.; Guiher, T.J. Claims of potential expansion throughout the U.S. by invasive python species are contradicted by ecological niche models. PloS One 2008, 3, e2931. [Google Scholar] [CrossRef]
  44. Photo by Greg Hume, licensed under the Creative Commons Attribution 2.0 Generic license. Available online: http://en.wikipedia.org/wiki/File:King_Cobra_25.jpg (accessed on 9 May 2014).
  45. Found inside a water catchment on Lantau. 2011, Photo by: Thomas Brown. This file is licensed under the Creative Commons Attribution 2.0 Generic license. Available online: http://en.wikipedia.org/wiki/File:Naja_atra_juvenile.jpg (accessed on 9 May 2014).
  46. Photo by AshLin. Photo of Banded Krait captured in Binnaguri, N.B., India on 19 Sep 2006. This file is licensed under the Creative Commons Attribution-Share Alike 2.5 Generic license. Available online: http://en.wikipedia.org/wiki/File:AB_054_Banded_Krait.JPG (accessed on 9 May 2014).
  47. Photo by PiccoloNamek at en.wikipedia, licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license. Available online: http://en.wikipedia.org/wiki/File:Anolis_carolinensis.jpg (accessed on 9 May 2014).
  48. Aird, S.D.; Watanabe, Y.; Villar-Briones, A.; Roy, M.C.; Terada, K.; Mikheyev, A.S. Quantitative high-throughput profiling of snake venom gland transcriptomes and proteomes (Ovophis okinavensis and Protobothrops flavoviridis). BMC Genomics 2013, 14, 790. [Google Scholar] [CrossRef]
  49. Dalla Valle, L.; Benato, F.; Maistro, S.; Quinzani, S.; Alibardi, L. Bioinformatic and molecular characterization of beta-defensins-like peptides isolated from the green lizard Anolis carolinensis. Dev. Comp. Immunol. 2012, 36, 222–229. [Google Scholar] [CrossRef]
  50. Erickson, G.M.; Gignac, P.M.; Steppan, S.J.; Lappin, A.K.; Vliet, K.A.; Brueggen, J.D.; Inouye, B.D.; Kledzik, D.; Webb, G.J. Insights into the ecology and evolutionary success of crocodilians revealed through bite-force and tooth-pressure experimentation. PloS One 2012, 7, e31781. [Google Scholar] [CrossRef]
  51. Shirley, M.H.; Vliet, K.A.; Carr, A.N.; Austin, J.D. Rigorous approaches to species delimitation have significant implications for African crocodilian systematics and conservation. Proc. Biol. Sci. 2014, 281, 20132483. [Google Scholar]
  52. An American Alligator (One of two) in captivity at the Columbus Zoo, Powell, Ohio. This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license. Available online: http://en.wikipedia.org/wiki/File:American_Alligator.jpg (accessed on 9 May 2014).
  53. A Siamese Crocodile (Crocodylus siamensis) at the Jerusalem Biblical Zoo. This file is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license. Available online: http://commons.wikimedia.org/wiki/File:Siamese_Crocodile-Biblical_Zoo.JPG (accessed on 9 May 2014).
  54. Lance, V.A. Alligator physiology and life history: The importance of temperature. Exp. Gerontol. 2003, 38, 801–805. [Google Scholar] [CrossRef]
  55. Brown, D.R.; Schumacher, I.M.; Nogueira, M.F.; Richey, L.J.; Zacher, L.A.; Schoeb, T.R.; Vliet, K.A.; Bennett, R.A.; Jacobson, E.R.; Brown, M.B. Detection of antibodies to a pathogenic mycoplasma in American alligators (Alligator mississippiensis), broad-nosed Caimans (Caiman latirostris), and Siamese crocodiles (Crocodylus siamensis). J. Clin. Microbiol. 2001, 39, 285–292. [Google Scholar] [CrossRef]
  56. Meganathan, P.R.; Dubey, B.; Batzer, M.A.; Ray, D.A.; Haque, I. Molecular phylogenetic analyses of genus Crocodylus (Eusuchia, Crocodylia, Crocodylidae) and the taxonomic position of Crocodylus porosus. Mol. Phylogenet. Evol. 2010, 57, 393–402. [Google Scholar] [CrossRef]
  57. Kommanee, J.; Preecharram, S.; Daduang, S.; Temsiripong, Y.; Dhiravisit, A.; Yamada, Y.; Thammasirirak, S. Antibacterial activity of plasma from crocodile (Crocodylus siamensis) against pathogenic bacteria. Ann. Clin. Microbiol. Antimicrob. 2012, 11, 22. [Google Scholar] [CrossRef]
  58. Theansungnoen, T.; Yaraksa, N.; Daduang, S.; Dhiravisit, A.; Thammasirirak, S. Purification and Characterization of Antioxidant Peptides from Leukocyte Extract of Crocodylus siamensis. Protein J. 2014, 33, 24–31. [Google Scholar]
  59. Srihongthong, S.; Pakdeesuwan, A.; Daduang, S.; Araki, T.; Dhiravisit, A.; Thammasirirak, S. Complete amino acid sequence of globin chains and biological activity of fragmented crocodile hemoglobin (Crocodylus siamensis). Protein J. 2012, 31, 466–476. [Google Scholar]
  60. Jandaruang, J.; Siritapetawee, J.; Thumanu, K.; Songsiriritthigul, C.; Krittanai, C.; Daduang, S.; Dhiravisit, A.; Thammasirirak, S. The effects of temperature and pH on secondary structure and antioxidant activity of Crocodylus siamensis hemoglobin. Protein J. 2012, 31, 43–50. [Google Scholar]
  61. Johnston, M.A.; Porter, D.E.; Scott, G.I.; Rhodes, W.E.; Webster, L.F. Isolation of faecal coliform bacteria from the American alligator (Alligator mississippiensis). J. Appl. Microbiol. 2010, 108, 965–973. [Google Scholar] [CrossRef]
  62. Merchant, M.E.; Mills, K.; Leger, N.; Jerkins, E.; Vliet, K.A.; McDaniel, N. Comparisons of innate immune activity of all known living crocodylian species. Com. Biochem. Physiol. Part B 2006, 143, 133–137. [Google Scholar]
  63. Merchant, M.E.; Leger, N.; Jerkins, E.; Mills, K.; Pallansch, M.B.; Paulman, R.L.; Ptak, R.G. Broad spectrum antimicrobial activity of leukocyte extracts from the American alligator (Alligator mississippiensis). Vet. Immunol. Immunopathol. 2006, 110, 221–228. [Google Scholar] [CrossRef]
  64. Merchant, M.E.; Roche, C.; Elsey, R.M.; Prudhomme, J. Antibacterial properties of serum from the American alligator (Alligator mississippiensis). Comp. biochem. Physiol. Part B 2003, 136, 505–513. [Google Scholar] [CrossRef]
  65. Preecharram, S.; Jearranaiprepame, P.; Daduang, S.; Temsiripong, Y.; Somdee, T.; Fukamizo, T.; Svasti, J.; Araki, T.; Thammasirirak, S. Isolation and characterisation of crocosin, an antibacterial compound from crocodile (Crocodylus siamensis) plasma. Nihon chikusan Gakkaiho 2010, 81, 393–401. [Google Scholar]
  66. Pata, S.; Yaraksa, N.; Daduang, S.; Temsiripong, Y.; Svasti, J.; Araki, T.; Thammasirirak, S. Characterization of the novel antibacterial peptide Leucrocin from crocodile (Crocodylus siamensis) white blood cell extracts. Dev. Comp. Immunol. 2011, 35, 545–553. [Google Scholar]
  67. Pata, S.; Daduang, S.; Svasti, J.; Thammasirirak, S. Isolation of Lysozyme like protein from crocodile leukocyte extract (Crocodylus siamensis). KMITL Sci. Technol. J. 2007, 7, 70–85. [Google Scholar]
  68. Castoe, T.A.; Pollock, D.D. Chinese alligator genome illustrates molecular adaptations. Cell res. 2013, 23, 1254–1255. [Google Scholar] [CrossRef]
  69. St John, J.A.; Braun, E.L.; Isberg, S.R.; Miles, L.G.; Chong, A.Y.; Gongora, J.; Dalzell, P.; Moran, C.; Bed'hom, B.; Abzhanov, A.; et al. Sequencing three crocodilian genomes to illuminate the evolution of archosaurs and amniotes. Genome Biol. 2012, 13, 415. [Google Scholar] [CrossRef]
  70. Wan, Q.H.; Pan, S.K.; Hu, L.; Zhu, Y.; Xu, P.W.; Xia, J.Q.; Chen, H.; He, G.Y.; He, J.; Ni, X.W.; et al. Genome analysis and signature discovery for diving and sensory properties of the endangered Chinese alligator. Cell Res. 2013, 23, 1091–1105. [Google Scholar] [CrossRef]
  71. Chromek, M.; Arvidsson, I.; Karpman, D. The antimicrobial peptide cathelicidin protects mice from Escherichia coli O157:H7-mediated disease. PloS One 2012, 7, e46476. [Google Scholar] [CrossRef]
  72. Oguro-Okano, M.; Honda, M.; Yamazaki, K.; Okano, K. Mutations in the melanocortin 1 receptor, beta-defensin103 and agouti signaling protein genes, and their association with coat color phenotypes in Akita-inu dogs. J. Vet. Med. Sci. 2011, 73, 853–858. [Google Scholar] [CrossRef]
  73. Schmutz, S.M.; Berryere, T.G. Genes affecting coat colour and pattern in domestic dogs: A review. Anim. Genet. 2007, 38, 539–549. [Google Scholar] [CrossRef]
  74. Zasloff, M. Magainins, a class of antimicrobial peptides from Xenopus skin: isolation, characterization of two active forms, and partial cDNA sequence of a precursor. Proc. Natl. Acad. Sci. USA 1987, 84, 5449–5453. [Google Scholar] [CrossRef]
  75. Wilson, C.L.; Schmidt, A.P.; Pirila, E.; Valore, E.V.; Ferri, N.; Sorsa, T.; Ganz, T.; Parks, W.C. Differential Processing of {alpha}- and {beta}-Defensin Precursors by Matrix Metalloproteinase-7 (MMP-7). J. Biol. Chem. 2009, 284, 8301–8311. [Google Scholar]
  76. Zhao, L.; Lu, W. Defensins in innate immunity. Curr. Opin. Hematol. 2014, 21, 37–42. [Google Scholar] [CrossRef]
  77. Lehrer, R.I.; Lu, W. alpha-Defensins in human innate immunity. Immunol. Rev. 2012, 245, 84–112. [Google Scholar] [CrossRef]
  78. Garcia, J.R.; Jaumann, F.; Schulz, S.; Krause, A.; Rodriguez-Jimenez, J.; Forssmann, U.; Adermann, K.; Kluver, E.; Vogelmeier, C.; Becker, D.; et al. Identification of a novel, multifunctional beta-defensin (human beta-defensin 3) with specific antimicrobial activity. Its interaction with plasma membranes of Xenopus oocytes and the induction of macrophage chemoattraction. Cell Tissue Res. 2001, 306, 257–264. [Google Scholar] [CrossRef]
  79. Kaplinsky, N.J.; Gilbert, S.F.; Cebra-Thomas, J.; Lillevali, K.; Saare, M.; Chang, E.Y.; Edelman, H.E.; Frick, M.A.; Guan, Y.; Hammond, R.M.; et al. The Embryonic Transcriptome of the Red-Eared Slider Turtle. PloS one 2013, 8, e66357. [Google Scholar]
  80. Lorenzo, A. Immunolocalization of a beta-defensin (Tu-BD-1) in the skin and subdermal granulocytes of turtles indicate the presence of an antimicrobial skin barrier. Ann. Anat. 2013, 195, 554–561. [Google Scholar] [CrossRef]
  81. Benato, F.; Dalla Valle, L.; Skobo, T.; Alibardi, L. Biomolecular identification of beta-defensin-like peptides from the skin of the soft-shelled turtle Apalone spinifera. J. Exp. Zool. Part B 2013, 320, 210–217. [Google Scholar] [CrossRef]
  82. Alibardi, L. Ultrastructural immunolocalization of beta-defensin-27 in granulocytes of the dermis and wound epidermis of lizard suggests they contribute to the anti-microbial skin barrier. Anat. Cell Biol. 2013, 46, 246–253. [Google Scholar] [CrossRef]
  83. Alibardi, L. Histochemical, Biochemical and Cell Biological aspects of tail regeneration in lizard, an amniote model for studies on tissue regeneration. Prog. Histochem. Cytochem. 2014, 48, 143–244. [Google Scholar] [CrossRef]
  84. Alibardi, L. Granulocytes of reptilian sauropsids contain beta-defensin-like peptides: a comparative ultrastructural survey. J. Morphol. 2013, 274, 877–886. [Google Scholar] [CrossRef]
  85. Alibardi, L.; Celeghin, A.; Dalla Valle, L. Wounding in lizards results in the release of beta-defensins at the wound site and formation of an antimicrobial barrier. Dev. Comp. Immunol. 2012, 36, 557–565. [Google Scholar] [CrossRef]
  86. Abdel Mageed, A.M.; Isobe, N.; Yoshimura, Y. Immunolocalization of avian beta-defensins in the hen oviduct and their changes in the uterus during eggshell formation. Reproduction 2009, 138, 971–978. [Google Scholar] [CrossRef]
  87. Gong, D.; Wilson, P.W.; Bain, M.M.; McDade, K.; Kalina, J.; Herve-Grepinet, V.; Nys, Y.; Dunn, I.C. Gallin; an antimicrobial peptide member of a new avian defensin family, the ovodefensins, has been subject to recent gene duplication. BMC Immunol. 2010, 11, 12. [Google Scholar]
  88. Herve, V.; Meudal, H.; Labas, V.; Rehault Godbert, S.; Gautron, J.; Berges, M.; Guyot, N.; Delmas, A.F.; Nys, Y.; Landon, C. 3D NMR structure of hen egg gallin (chicken ovo-defensin) reveals a new variation of the beta-defensin fold. J. Biol. Chem. 2014.
  89. Herve-Grepinet, V.; Rehault-Godbert, S.; Labas, V.; Magallon, T.; Derache, C.; Lavergne, M.; Gautron, J.; Lalmanach, A.C.; Nys, Y. Purification and characterization of avian beta-defensin 11, an antimicrobial peptide of the hen egg. Antimicrob. Agents Chemother. 2010, 54, 4401–4409. [Google Scholar] [CrossRef]
  90. Mine, Y.; Oberle, C.; Kassaify, Z. Eggshell matrix proteins as defense mechanism of avian eggs. J. Agric. Food Chem. 2003, 51, 249–253. [Google Scholar] [CrossRef]
  91. Kosciuczuk, E.M.; Lisowski, P.; Jarczak, J.; Strzalkowska, N.; Jozwik, A.; Horbanczuk, J.; Krzyzewski, J.; Zwierzchowski, L.; Bagnicka, E. Cathelicidins: family of antimicrobial peptides. A review. Mol. Biol. Reports 2012, 39, 10957–10970. [Google Scholar] [CrossRef]
  92. Lehrer, R.I.; Ganz, T. Cathelicidins: A family of endogenous antimicrobial peptides. Curr. Opin. Hematol. 2002, 9, 18–22. [Google Scholar] [CrossRef]
  93. Cole, A.M.; Shi, J.; Ceccarelli, A.; Kim, Y.H.; Park, A.; Ganz, T. Inhibition of neutrophil elastase prevents cathelicidin activation and impairs clearance of bacteria from wounds. Blood 2001, 97, 297–304. [Google Scholar] [CrossRef]
  94. Tongaonkar, P.; Golji, A.E.; Tran, P.; Ouellette, A.J.; Selsted, M.E. High fidelity processing and activation of the human alpha-defensin HNP1 precursor by neutrophil elastase and proteinase 3. PloS One 2012, 7, e32469. [Google Scholar]
  95. Nizet, V.; Gallo, R.L. Cathelicidins and innate defense against invasive bacterial infection. Scand. J. Infect. Dis. 2003, 35, 670–676. [Google Scholar] [CrossRef]
  96. Zanetti, M.; Gennaro, R.; Scocchi, M.; Skerlavaj, B. Structure and biology of cathelicidins. Adv. Exp. Med. Biol. 2000, 479, 203–218. [Google Scholar]
  97. van Dijk, A.; Molhoek, E.M.; Bikker, F.J.; Yu, P.L.; Veldhuizen, E.J.; Haagsman, H.P. Avian cathelicidins: Paradigms for the development of anti-infectives. Vet. Microbiol. 2011, 153, 27–36. [Google Scholar] [CrossRef]
  98. Van Dijk, A.; Veldhuizen, E.J.; van Asten, A.J.; Haagsman, H.P. CMAP27, a novel chicken cathelicidin-like antimicrobial protein. Vet. Immunol. Immunopathol. 2005, 106, 321–327. [Google Scholar] [CrossRef]
  99. Xiao, Y.; Cai, Y.; Bommineni, Y.R.; Fernando, S.C.; Prakash, O.; Gilliland, S.E.; Zhang, G. Identification and functional characterization of three chicken cathelicidins with potent antimicrobial activity. J. Biol. Chem. 2006, 281, 2858–2867. [Google Scholar]
  100. Van Dijk, A.; Tersteeg-Zijderveld, M.H.; Tjeerdsma-van Bokhoven, J.L.; Jansman, A.J.; Veldhuizen, E.J.; Haagsman, H.P. Chicken heterophils are recruited to the site of Salmonella infection and release antibacterial mature Cathelicidin-2 upon stimulation with LPS. Mol. Immunol. 2009, 46, 1517–1526. [Google Scholar] [CrossRef]
  101. Sorensen, O.E.; Borregaard, N. Cathelicidins--nature's attempt at combinatorial chemistry. Comb. Chem. High Throughput Screen. 2005, 8, 273–280. [Google Scholar] [CrossRef]
  102. De Latour, F.A.; Amer, L.S.; Papanstasiou, E.A.; Bishop, B.M.; van Hoek, M.L. Antimicrobial activity of the Naja atra cathelicidin and related small peptides. Biochem. Biophys. Res. Commun. 2010, 396, 825–830. [Google Scholar] [CrossRef]
  103. Dean, S.N.; Bishop, B.M.; van Hoek, M.L. Susceptibility of Pseudomonas aeruginosa Biofilm to Alpha-Helical Peptides: d-enantiomer of LL-37. Front. Microbiol. 2011, 2, 128. [Google Scholar]
  104. Amer, L.S.; Bishop, B.M.; van Hoek, M.L. Antimicrobial and antibiofilm activity of cathelicidins and short, synthetic peptides against Francisella. Biochem. Biophys. Res. Commun. 2010, 396, 246–251. [Google Scholar] [CrossRef]
  105. Dean, S.N.; Bishop, B.M.; van Hoek, M.L. Natural and synthetic cathelicidin peptides with anti-microbial and anti-biofilm activity against Staphylococcus aureus. BMC Microbiol. 2011, 11, 114. [Google Scholar] [CrossRef]
  106. Juba, M.; Porter, D.; Dean, S.; Gillmor, S.; Bishop, B. Characterization and performance of short cationic antimicrobial peptide isomers. Biopolymers 2013, 100, 387–401. [Google Scholar] [CrossRef]
  107. Wang, Y.; Zhang, Z.; Chen, L.; Guang, H.; Li, Z.; Yang, H.; Li, J.; You, D.; Yu, H.; Lai, R. Cathelicidin-BF, a snake cathelicidin-derived antimicrobial peptide, could be an excellent therapeutic agent for acne vulgaris. PloS One 2011, 6, e22120. [Google Scholar]
  108. Hao, Q.; Wang, H.; Wang, J.; Dou, J.; Zhang, M.; Zhou, W.; Zhou, C. Effective antimicrobial activity of Cbf-K16 and Cbf-A7 A13 against NDM-1-carrying Escherichia coli by DNA binding after penetrating the cytoplasmic membrane in vitro. J. Pept. Sci. 2013, 19, 173–180. [Google Scholar] [CrossRef]
  109. Wang, J.; Li, B.; Li, Y.; Dou, J.; Hao, Q.; Tian, Y.; Wang, H.; Zhou, C. BF-30 effectively inhibits ciprofloxacin-resistant bacteria in vitro and in a rat model of vaginosis. Arch. Pharm. Res. 2013. [Google Scholar] [CrossRef]
  110. Dalla Valle, L.; Benato, F.; Paccanaro, M.C.; Alibardi, L. Bioinformatic and molecular characterization of cathelicidin-like peptides isolated from the green lizard Anolis carolinensis (Reptilia: Lepidosauria: Iguanidae). Ital. J. Zool. 2013, 80, 177–186. [Google Scholar] [CrossRef]
  111. Alibardi, L. Ultrastructural immunolocalization of chatelicidin-like peptides in granulocytes of normal and regenerating lizard tissues. Acta Histochem. 2013.
  112. Park, C.H.; Valore, E.V.; Waring, A.J.; Ganz, T. Hepcidin, a urinary antimicrobial peptide synthesized in the liver. J. Biol. Chem. 2001, 276, 7806–7810. [Google Scholar]
  113. Rodriguez, R.; Jung, C.L.; Gabayan, V.; Deng, J.C.; Ganz, T.; Nemeth, E.; Bulut, Y. Hepcidin induction by pathogens and pathogen-derived molecules is strongly dependent on interleukin-6. Infect. Immun. 2014, 82, 745–752. [Google Scholar] [CrossRef]
  114. Hao, J.; Li, Y.W.; Xie, M.Q.; Li, A.X. Molecular cloning, recombinant expression and antibacterial activity analysis of hepcidin from Simensis crocodile (Crocodylus siamensis). Comp. Biochem. Phys. Part B 2012, 163, 309–315. [Google Scholar] [CrossRef]
  115. Hilton, K.B.; Lambert, L.A. Molecular evolution and characterization of hepcidin gene products in vertebrates. Gene 2008, 415, 40–48. [Google Scholar]
  116. Sang, Y.; Ramanathan, B.; Minton, J.E.; Ross, C.R.; Blecha, F. Porcine liver-expressed antimicrobial peptides, hepcidin and LEAP-2: cloning and induction by bacterial infection. Dev. Comp. Immunol. 2006, 30, 357–366. [Google Scholar] [CrossRef]
  117. Hocquellet, A.; Odaert, B.; Cabanne, C.; Noubhani, A.; Dieryck, W.; Joucla, G.; le Senechal, C.; Milenkov, M.; Chaignepain, S.; Schmitter, J.M.; et al. Structure-activity relationship of human liver-expressed antimicrobial peptide 2. Peptides 2010, 31, 58–66. [Google Scholar] [CrossRef]
  118. Henriques, S.T.; Tan, C.C.; Craik, D.J.; Clark, R.J. Structural and functional analysis of human liver-expressed antimicrobial peptide 2. Chembiochem 2010, 11, 2148–2157. [Google Scholar] [CrossRef]
  119. Krause, A.; Sillard, R.; Kleemeier, B.; Kluver, E.; Maronde, E.; Conejo-Garcia, J.R.; Forssmann, W.G.; Schulz-Knappe, P.; Nehls, M.C.; Wattler, F.; et al. Isolation and biochemical characterization of LEAP-2, a novel blood peptide expressed in the liver. Protein Sci. 2003, 12, 143–152. [Google Scholar] [CrossRef]
  120. Araki, T.; Yamamoto, T.; Torikata, T. Reptile lysozyme: the complete amino acid sequence of soft-shelled turtle lysozyme and its activity. Biosci. Biotechnol. Biochem. 1998, 62, 316–324. [Google Scholar] [CrossRef]
  121. Chijiiwa, Y.; Kawamura, S.; Torikata, T.; Araki, T. Amino acid sequence and activity of green turtle (Chelonia mydas) lysozyme. Protein J. 2006, 25, 336–344. [Google Scholar] [CrossRef]
  122. Prajanban, B.O.; Shawsuan, L.; Daduang, S.; Kommanee, J.; Roytrakul, S.; Dhiravisit, A.; Thammasirirak, S. Identification of five reptile egg whites protein using MALDI-TOF mass spectrometry and LC/MS-MS analysis. J. Proteomics 2012, 75, 1940–1959. [Google Scholar] [CrossRef]
  123. Radis-Baptista, G.; Kerkis, I. Crotamine, a small basic polypeptide myotoxin from rattlesnake venom with cell-penetrating properties. Curr. Pharm. Design 2011, 17, 4351–4361. [Google Scholar] [CrossRef]
  124. Kerkis, I.; Silva Fde, S.; Pereira, A.; Kerkis, A.; Radis-Baptista, G. Biological versatility of crotamine—A cationic peptide from the venom of a South American rattlesnake. Expert Opin. Investig. Drugs 2010, 19, 1515–1525. [Google Scholar] [CrossRef]
  125. Structure of crotamine, a Na+ channel affecting toxin from Crotalus durissus terrificus venom (PDB 1H5O). This image is licensed under the Creative Commons Attribution-Share Alike 3.0 Unported license. Available online: http://en.wikipedia.org/wiki/File:Crotamin_1H5O.png (accessed on 9 May 2014).
  126. Radis-Baptista, G.; Kubo, T.; Oguiura, N.; Prieto da Silva, A.R.; Hayashi, M.A.; Oliveira, E.B.; Yamane, T. Identification of crotasin, a crotamine-related gene of Crotalus durissus terrificus. Toxicon 2004, 43, 751–759. [Google Scholar] [CrossRef]
  127. Yamane, E.S.; Bizerra, F.C.; Oliveira, E.B.; Moreira, J.T.; Rajabi, M.; Nunes, G.L.; de Souza, A.O.; da Silva, I.D.; Yamane, T.; Karpel, R.L.; et al. Unraveling the antifungal activity of a South American rattlesnake toxin crotamine. Biochimie 2013, 95, 231–240. [Google Scholar]
  128. Yaraksa, N.; Anunthawan, T.; Theansungnoen, T.; Daduang, S.; Araki, T.; Dhiravisit, A.; Thammasirirak, S. Design and synthesis of cationic antibacterial peptide based on Leucrocin I sequence, antibacterial peptide from crocodile (Crocodylus siamensis) white blood cell extracts. J. Antibiot. 2013, 67, 205–212. [Google Scholar]
  129. Mak, P. Hemocidins in a functional and structural context of human antimicrobial peptides. Front. Biosci. 2008, 13, 6859–6871. [Google Scholar]
  130. Sheshadri, P.; Abraham, J. Antimicrobial properties of hemoglobin. Immunopharm. Immunotoxicol. 2012, 34, 896–900. [Google Scholar] [CrossRef]
  131. Parish, C.A.; Jiang, H.; Tokiwa, Y.; Berova, N.; Nakanishi, K.; McCabe, D.; Zuckerman, W.; Xia, M.M.; Gabay, J.E. Broad-spectrum antimicrobial activity of hemoglobin. Bioorg. Med. Chem. 2001, 9, 377–382. [Google Scholar]
  132. Anwised, P.; Kabbua, T.; Temsiripong, T.; Dhiravisit, A.; Jitrapakdee, S.; Araki, T.; Yoneda, K.; Thammasirirak, S. Molecular cloning and expression of alpha-globin and beta-globin genes from crocodile (Crocodylus siamensis). Protein J. 2013, 32, 172–182. [Google Scholar]
  133. Santamaria, C.; Larios, S.; Quiros, S.; Pizarro-Cerda, J.; Gorvel, J.P.; Lomonte, B.; Moreno, E. Bactericidal and antiendotoxic properties of short cationic peptides derived from a snake venom Lys49 phospholipase A2. Antimicrob. Agents Chemother. 2005, 49, 1340–1345. [Google Scholar] [CrossRef]
  134. Santamaria, C.; Larios, S.; Angulo, Y.; Pizarro-Cerda, J.; Gorvel, J.P.; Moreno, E.; Lomonte, B. Antimicrobial activity of myotoxic phospholipases A2 from crotalid snake venoms and synthetic peptide variants derived from their C-terminal region. Toxicon 2005, 45, 807–815. [Google Scholar] [CrossRef]
  135. Yu, H.Y.; Huang, K.C.; Yip, B.S.; Tu, C.H.; Chen, H.L.; Cheng, H.T.; Cheng, J.W. Rational design of tryptophan-rich antimicrobial peptides with enhanced antimicrobial activities and specificities. Chembiochem 2010, 11, 2273–2282. [Google Scholar] [CrossRef]
  136. Chu, H.L.; Yu, H.Y.; Yip, B.S.; Chih, Y.H.; Liang, C.W.; Cheng, H.T.; Cheng, J.W. Boosting salt resistance of short antimicrobial peptides. Antimicrob. Agents Chemother. 2013, 57, 4050–4052. [Google Scholar] [CrossRef]
  137. Deslouches, B.; Steckbeck, J.D.; Craigo, J.K.; Doi, Y.; Mietzner, T.A.; Montelaro, R.C. Rational design of engineered cationic antimicrobial peptides consisting exclusively of arginine and tryptophan, and their activity against multidrug-resistant pathogens. Antimicrob. Agents Chemother. 2013, 57, 2511–2521. [Google Scholar] [CrossRef]
  138. Gomes, V.M.; Carvalho, A.O.; Da Cunha, M.; Keller, M.N.; Bloch, C., Jr.; Deolindo, P.; Alves, E.W. Purification and characterization of a novel peptide with antifungal activity from Bothrops jararaca venom. Toxicon 2005, 45, 817–827. [Google Scholar] [CrossRef]
  139. Xie, J.P.; Yue, J.; Xiong, Y.L.; Wang, W.Y.; Yu, S.Q.; Wang, H.H. In vitro activities of small peptides from snake venom against clinical isolates of drug-resistant Mycobacterium tuberculosis. Int. J. Antimicrob. Agents 2003, 22, 172–174. [Google Scholar] [CrossRef]

Share and Cite

MDPI and ACS Style

Van Hoek, M.L. Antimicrobial Peptides in Reptiles. Pharmaceuticals 2014, 7, 723-753. https://doi.org/10.3390/ph7060723

AMA Style

Van Hoek ML. Antimicrobial Peptides in Reptiles. Pharmaceuticals. 2014; 7(6):723-753. https://doi.org/10.3390/ph7060723

Chicago/Turabian Style

Van Hoek, Monique L. 2014. "Antimicrobial Peptides in Reptiles" Pharmaceuticals 7, no. 6: 723-753. https://doi.org/10.3390/ph7060723

APA Style

Van Hoek, M. L. (2014). Antimicrobial Peptides in Reptiles. Pharmaceuticals, 7(6), 723-753. https://doi.org/10.3390/ph7060723

Article Metrics

Back to TopTop