Identification of Peptides in Flowers of Sambucus nigra with Antimicrobial Activity against Aquaculture Pathogens
Abstract
:1. Introduction
2. Results and Discussion
2.1. Identification of Peptides from S. nigra Flowers
2.2. Antimicrobial Activity of S. nigra Flowers Peptides
2.3. Bacterial Membrane Damage Induced by S. nigra Flowers Peptides
3. Materials and Methods
3.1. Peptide Extraction
3.2. Mass Spectrometry Analysis for Peptide Identification
3.3. Antibacterial Assay
3.4. SYTOX Green Bacteria Permeabilization Assay
3.5. Scanning Electron Microscopy (SEM)
3.6. Polyphenol Quantification
4. Conclusions
Supplementary Materials
Supplementary File 1Author Contributions
Acknowledgments
Conflicts of Interest
References
- Sofowora, A.; Ogunbodede, E.; Onayade, A. The role and place of medicinal plants in the strategies for disease prevention. Afr. J. Tradit. Complement. Altern. Med. 2013, 10, 210–229. [Google Scholar] [CrossRef] [PubMed]
- Mahady, G.B. Global harmonization of herbal health claims. J. Nutr. 2001, 131, 1120S–1123S. [Google Scholar] [CrossRef] [PubMed]
- Sidor, A.; Gramza-Michałowska, A. Advanced research on the antioxidant and health benefit of elderberry (Sambucus nigra) in food—A review. J. Funct. Foods 2015, 18, 941–958. [Google Scholar] [CrossRef]
- Ho, G.T.T.; Wangensteen, H.; Barsett, H. Elderberry and elderflower extracts, phenolic compounds, and metabolites and their effect on complement, RAW 264.7 macrophages and dendritic cells. Int. J. Mol. Sci. 2017, 18, 584. [Google Scholar] [CrossRef] [PubMed]
- Jabbari, M.; Daneshfard, B.; Emtiazy, M.; Khiveh, A.; Hashempur, M.H. Biological effects and clinical applications of dwarf elder (Sambucus ebulus L): A review. J. Evid. Based Complement. Altern. Med. 2017, 22, 996–1001. [Google Scholar] [CrossRef] [PubMed]
- Krawitz, C.; Mraheil, M.A.; Stein, M.; Imirzalioglu, C.; Domann, E.; Pleschka, S.; Hain, T. Inhibitory activity of a standardized elderberry liquid extract against clinically-relevant human respiratory bacterial pathogens and influenza A and B viruses. BMC Complement. Altern. Med. 2011, 11, 16. [Google Scholar] [CrossRef] [PubMed]
- Nawrot, R.; Barylski, J.; Nowicki, G.; Broniarczyk, J.; Buchwald, W.; Goździcka-Józefiak, A. Plant antimicrobial peptides. Folia Microbiol. 2014, 59, 181–196. [Google Scholar] [CrossRef] [PubMed]
- Tam, J.P.; Wang, S.; Wong, K.H.; Tan, W.L. Antimicrobial peptides from plants. Pharmaceuticals 2015, 8, 711–757. [Google Scholar] [CrossRef] [PubMed]
- Daly, N.L.; Rosengren, K.J.; Craik, D.J. Discovery, structure and biological activities of cyclotides. Adv. Drug Deliv. Rev. 2009, 61, 918–930. [Google Scholar] [CrossRef] [PubMed]
- Ireland, D.C.; Clark, R.J.; Daly, N.L.; Craik, D.J. Isolation, sequencing, and structure−activity relationships of cyclotides. J. Nat. Prod. 2010, 73, 1610–1622. [Google Scholar] [CrossRef] [PubMed]
- Jennings, C.; West, J.; Waine, C.; Craik, D.; Anderson, M. Biosynthesis and insecticidal properties of plant cyclotides: The cyclic knotted proteins from Oldenlandia affinis. Proc. Natl. Acad. Sci. USA 2001, 98, 10614–10619. [Google Scholar] [CrossRef] [PubMed]
- Hintz, T.; Matthews, K.K.; Di, R. The use of plant antimicrobial compounds for food preservation. Biomed Res. Int. 2015, 2015, 246264. [Google Scholar] [CrossRef] [PubMed]
- Tavares, L.S.; Santos, M.O.; Viccini, L.F.; Moreira, J.S.; Miller, R.N.G.; Franco, O.L. Biotechnological potential of antimicrobial peptides from flowers. Peptides 2008, 29, 1842–1851. [Google Scholar] [CrossRef] [PubMed]
- Estomba, D.; Ladio, A.; Lozada, M. Medicinal wild plant knowledge and gathering patterns in a mapuche community from north-western patagonia. J. Ethnopharmacol. 2006, 103, 109–119. [Google Scholar] [CrossRef] [PubMed]
- Guerrero, C.J.; Ciampi, P.L.; Castilla, C.A.; Medel, S.F.; Schalchli, S.H.; Hormazabal, U.E.; Bensch, T.E.; Alberdi, L.M. Antioxidant capacity, anthocyanins, and total phenols of wild and cultivated berries in Chile. Chil. J. Agric. Res. 2010, 70, 537–544. [Google Scholar] [CrossRef]
- Taneja, S.C.; Qazi, G.N. Bioactive Molecules in medicinal plants: A perspective on their therapeutic action. In Drug Discovery and Development; John Wiley & Sons, Inc.: Hoboken, NJ, USA, 2006; pp. 1–50. ISBN 9780470085226. [Google Scholar]
- Ciocoiu, M.; Mirón, A.; Mares, L.; Tutunaru, D.; Pohaci, C.; Groza, M.; Badescu, M. The effects of Sambucus nigra polyphenols on oxidative stress and metabolic disorders in experimental diabetes mellitus. J. Physiol. Biochem. 2009, 65, 297–304. [Google Scholar] [CrossRef] [PubMed]
- Salvador, Â.C.; Silvestre, A.J.D.; Rocha, S.M. Unveiling elderflowers (Sambucus nigra L.) volatile terpenic and norisoprenoids profile: Effects of different postharvest conditions. Food Chem. 2017, 229, 276–285. [Google Scholar] [CrossRef] [PubMed]
- Schmitzer, V.; Veberic, R.; Slatnar, A.; Stampar, F. Elderberry (Sambucus nigra L.) wine: A product rich in health promoting compounds. J. Agric. Food Chem. 2010, 58, 10143–10146. [Google Scholar] [CrossRef] [PubMed]
- Veberic, R.; Jakopic, J.; Stampar, F.; Schmitzer, V. European elderberry (Sambucus nigra L.) rich in sugars, organic acids, anthocyanins and selected polyphenols. Food Chem. 2009, 114, 511–515. [Google Scholar] [CrossRef]
- Claeson, P.; Göransson, U.; Johansson, S.; Luijendijk, T.; Bohlin, L. Fractionation protocol for the isolation of polypeptides from plant biomass. J. Nat. Prod. 1998, 61, 77–81. [Google Scholar] [CrossRef] [PubMed]
- Nguyen, G.K.T.; Zhang, S.; Wang, W.; Wong, C.T.T.; Nguyen, N.T.K.; Tam, J.P. Discovery of a linear cyclotide from the bracelet subfamily and its disulfide mapping by top-down mass spectrometry. J. Biol. Chem. 2011, 286, 44833–44844. [Google Scholar] [CrossRef] [PubMed]
- Nguyen, G.K.T.; Lian, Y.; Pang, E.W.H.; Nguyen, P.Q.T.; Tran, T.D.; Tam, J.P. Discovery of linear cyclotides in monocot plant Panicum laxum of Poaceae family provides new insights into evolution and distribution of cyclotides in plants. J. Biol. Chem. 2013, 288, 3370–3380. [Google Scholar] [CrossRef] [PubMed]
- Narayani, M.; Chadha, A.; Srivastava, S. Cyclotides from the indian medicinal plant Viola odorata (Banafsha): Identification and characterization. J. Nat. Prod. 2017, 80, 1972–1980. [Google Scholar] [CrossRef] [PubMed]
- Poth, A.G.; Colgrave, M.L.; Philip, R.; Kerenga, B.; Daly, N.L.; Anderson, M.A.; Craik, D.J. Discovery of cyclotides in the fabaceae plant family provides new insights into the cyclization, evolution, and distribution of circular proteins. ACS Chem. Biol. 2011, 6, 345–355. [Google Scholar] [CrossRef] [PubMed]
- Hashempour, H.; Koehbach, J.; Daly, N.L.; Ghassempour, A.; Gruber, C.W. Characterizing circular peptides in mixtures: Sequence fragment assembly of cyclotides from a violet plant by MALDI-TOF/TOF mass spectrometry. Amino Acids 2013, 44, 581–595. [Google Scholar] [CrossRef] [PubMed]
- Koehbach, J.; Attah, A.F.; Berger, A.; Hellinger, R.; Kutchan, T.M.; Carpenter, E.J.; Rolf, M.; Sonibare, M.A.; Moody, J.O.; Wong, G.K.-S.; et al. Cyclotide discovery in Gentianales revisited-identification and characterization of cyclic cystine-knot peptides and their phylogenetic distribution in Rubiaceae plants. Biopolymers 2013, 100, 438–452. [Google Scholar] [CrossRef] [PubMed]
- Simonsen, S.M.; Sando, L.; Ireland, D.C.; Colgrave, M.L.; Bharathi, R.; Göransson, U.; Craik, D.J. A continent of plant defense peptide diversity: Cyclotides in Australian Hybanthus (Violaceae). Plant Cell 2005, 17, 3176–3189. [Google Scholar] [CrossRef] [PubMed]
- Kathleen, M.M.; Samuel, L.; Felecia, C.; Reagan, E.L.; Kasing, A.; Lesley, M.; Toh, S.C. Antibiotic resistance of diverse bacteria from aquaculture in Borneo. Int. J. Microbiol. 2016, 2016, 2164761. [Google Scholar] [CrossRef] [PubMed]
- Petersen, A.; Andersen, J.S.; Kaewmak, T.; Somsiri, T.; Dalsgaard, A. Impact of integrated fish farming on antimicrobial resistance in a pond environment. Appl. Environ. Microbiol. 2002, 68, 6036–6042. [Google Scholar] [CrossRef] [PubMed]
- Shah, S.Q.A.; Cabello, F.C.; L’Abée-Lund, T.M.; Tomova, A.; Godfrey, H.P.; Buschmann, A.H.; Sørum, H. Antimicrobial resistance and antimicrobial resistance genes in marine bacteria from salmon aquaculture and non-aquaculture sites. Environ. Microbiol. 2014, 16, 1310–1320. [Google Scholar] [CrossRef] [PubMed]
- Smith, P. Antimicrobial resistance in aquaculture. Rev. Sci. Tech. 2008, 27, 243–264. [Google Scholar] [CrossRef] [PubMed]
- Schmidt, A.S.; Bruun, M.S.; Dalsgaard, I.; Pedersen, K.; Larsen, J.L. Occurrence of antimicrobial resistance in fish-pathogenic and environmental bacteria associated with four danish rainbow trout farms. Appl. Environ. Microbiol. 2000, 66, 4908–4915. [Google Scholar] [CrossRef] [PubMed]
- De la Fuente, M.; Miranda, C.D.; Jopia, P.; González-Rocha, G.; Guiliani, N.; Sossa, K.; Urrutia, H. Growth Inhibition of bacterial fish pathogens and quorum-sensing blocking by bacteria recovered from Chilean salmonid farms. J. Aquat. Anim. Health 2015, 27, 112–122. [Google Scholar] [CrossRef] [PubMed]
- Castro, S.B.R.; Leal, C.A.G.; Freire, F.R.; Carvalho, D.A.; Oliveira, D.F.; Figueiredo, H.C.P. Antibacterial activity of plant extracts from Brazil against fish pathogenic bacteria. Braz. J. Microbiol. 2008, 39, 756–760. [Google Scholar] [CrossRef] [PubMed]
- Bulfon, C.; Volpatti, D.; Galeotti, M. In Vitro antibacterial activity of plant ethanolic extracts against fish pathogens. J. World Aquac. Soc. 2014, 45, 545–557. [Google Scholar] [CrossRef]
- Turker, H.; Yıldırım, A.B. Screening for antibacterial activity of some Turkish plants against fish pathogens: A possible alternative in the treatment of bacterial infections. Biotechnol. Biotechnol. Equip. 2015, 29, 281–288. [Google Scholar] [CrossRef] [PubMed]
- Wimley, W.C. Describing the mechanism of antimicrobial peptide action with the interfacial activity model. ACS Chem. Biol. 2010, 5, 905–917. [Google Scholar] [CrossRef] [PubMed]
- Lee, J.; Lee, D.G. Antimicrobial Peptides (AMPs) with dual mechanisms: Membrane disruption and apoptosis. J. Microbiol. Biotechnol. 2015, 25, 759–764. [Google Scholar] [CrossRef] [PubMed]
- Brogden, K.A. Antimicrobial peptides: Pore formers or metabolic inhibitors in bacteria? Nat. Rev. Microbiol. 2005, 3, 238–250. [Google Scholar] [CrossRef] [PubMed]
- Lee, J.-K.; Park, S.-C.; Hahm, K.-S.; Park, Y. Antimicrobial HPA3NT3 peptide analogs: Placement of aromatic rings and positive charges are key determinants for cell selectivity and mechanism of action. Biochim. Biophys. Acta 2013, 1828, 443–454. [Google Scholar] [CrossRef] [PubMed]
- Hartmann, M.; Berditsch, M.; Hawecker, J.; Ardakani, M.F.; Gerthsen, D.; Ulrich, A.S. Damage of the bacterial cell envelope by antimicrobial peptides gramicidin S and PGLa as revealed by transmission and scanning electron microscopy. Antimicrob. Agents Chemother. 2010, 54, 3132–3142. [Google Scholar] [CrossRef] [PubMed]
- Wimley, W.C. Determining the effects of membrane-interacting peptides on membrane integrity. Methods Mol. Biol. 2015, 1324, 89–106. [Google Scholar] [CrossRef] [PubMed]
- Bourbon, C.; Bry, C.; Roggemans, C.; Soulard, C.; Thizon, C.; Garbay, B. Use of a real-time polymerase chain reaction thermocycler to study bacterial cell permeabilization by antimicrobial peptides. Anal. Biochem. 2008, 381, 279–281. [Google Scholar] [CrossRef] [PubMed]
- Murillo, L.A.; Lan, C.; Agabian, N.M.; Larios, S.; Lomonte, B. Original synthetic peptide variant against Candida albicans. Rev. Esp. Quimioter. 2007, 20, 330–333. [Google Scholar] [PubMed]
- Meincken, M.; Holroyd, D.L.; Rautenbach, M. Atomic force microscopy study of the effect of antimicrobial peptides on the cell envelope of Escherichia coli. Antimicrob. Agents Chemother. 2005, 49, 4085–4092. [Google Scholar] [CrossRef] [PubMed]
- Hale, J.D.; Hancock, R.E. Alternative mechanisms of action of cationic antimicrobial peptides on bacteria. Expert Rev. Anti-Infect. Ther. 2007, 5, 951–959. [Google Scholar] [CrossRef] [PubMed]
- Shai, Y. Mode of action of membrane active antimicrobial peptides. Biopolymers 2002, 66, 236–248. [Google Scholar] [CrossRef] [PubMed]
- Huang, H.W.; Charron, N.E. Understanding membrane-active antimicrobial peptides. Q. Rev. Biophys. 2017, 50, e10. [Google Scholar] [CrossRef] [PubMed]
- Gründemann, C.; Koehbach, J.; Huber, R.; Gruber, C.W. Do plant cyclotides have potential as immunosuppressant peptides? J. Nat. Prod. 2012, 75, 167–174. [Google Scholar] [CrossRef] [PubMed]
- Colgrave, M.L.; Poth, A.G.; Kaas, Q.; Craik, D.J. A new “era” for cyclotide sequencing. Biopolymers 2010, 94, 592–601. [Google Scholar] [CrossRef] [PubMed]
- Wang, C.K.L.; Kaas, Q.; Chiche, L.; Craik, D.J. CyBase: A database of cyclic protein sequences and structures, with applications in protein discovery and engineering. Nucleic Acids Res. 2007, 36, D206–D210. [Google Scholar] [CrossRef] [PubMed]
- Mulvenna, J.P.; Wang, C.; Craik, D.J. CyBase: A database of cyclic protein sequence and structure. Nucleic Acids Res. 2006, 34, D192–D194. [Google Scholar] [CrossRef] [PubMed]
- Mitta, G.; Vandenbulcke, F.; Hubert, F.; Roch, P. Mussel defensins are synthesised and processed in granulocytes then released into the plasma after bacterial challenge. J. Cell Sci. 1999, 112 Pt 2, 4233–4242. [Google Scholar] [PubMed]
- Schmitt, P.; Mercado, L.; Díaz, M.; Guzmán, F.; Arenas, G.; Marshall, S.H. Characterization and functional recovery of a novel antimicrobial peptide (CECdir-CECret) from inclusion bodies after expression in Escherichia coli. Peptides 2008, 29, 512–519. [Google Scholar] [CrossRef] [PubMed]
- Jofré, C.; Guzmán, F.; Cárdenas, C.; Albericio, F.; Marshall, S.H. A natural peptide and its variants derived from the processing of infectious pancreatic necrosis virus (IPNV) displaying enhanced antimicrobial activity: A novel alternative for the control of bacterial diseases. Peptides 2011, 32, 852–858. [Google Scholar] [CrossRef] [PubMed]
- Álvarez, C.; Acosta, F.; Montero, D.; Guzmán, F.; Torres, E.; Vega, B.; Mercado, L. Synthetic hepcidin from fish: Uptake and protection against Vibrio anguillarum in sea bass (Dicentrarchus labrax). Fish Shellfish Immunol. 2016, 55, 662–670. [Google Scholar] [CrossRef] [PubMed]
- Miller, R.A.; Walker, R.D.; Baya, A.; Clemens, K.; Coles, M.; Hawke, J.P.; Henricson, B.E.; Hsu, H.M.; Mathers, J.J.; Oaks, J.L.; et al. Antimicrobial susceptibility testing of aquatic bacteria: Quality control disk diffusion ranges for Escherichia coli ATCC 25922 and Aeromonas salmonicida subsp. salmonicida ATCC 33658 at 22 and 28 degrees C. J. Clin. Microbiol. 2003, 41, 4318–4323. [Google Scholar] [CrossRef] [PubMed]
- Alvarez, C.A.; Guzmán, F.; Cárdenas, C.; Marshall, S.H.; Mercado, L. Antimicrobial activity of trout hepcidin. Fish Shellfish Immunol. 2014, 41, 93–101. [Google Scholar] [CrossRef] [PubMed]
- Singleton, V.L.; Rossi, J.A. Colorimetry of total phenolics with phosphomolybdic-phosphotungstic acid reagents. Am. J. Enol. Vitic. 1965, 16, 144–158. [Google Scholar]
Sample Availability: Samples of the compounds reported in this paper are available from the authors. |
Detected Sequence a | Reported Cysteine-Rich Peptides (CRP) | Family CRP |
---|---|---|
GEYCGESCYLIPCFTPGCYCVSRQCVNKN b | chassatide_C10 (Chassalia_chartacea) | Cyclotide |
GIPCAESCVWIPCTVTKMLGCSCKDKVCYN c | Glopa E (Gloeospermum pauciflorum Hekking) | Cyclotide |
LICSSTCLRIPCSPRCTVRHHICYLN b | Caripe 4 (Carapichea Ipecacuanha) | Cyclotide |
GLPVCGETCAGGRCNTPGCSCSWPVCTRN b | Vaby C (viola abyssinica) | Cyclotide |
GIGCGESCVWIPCVSAAIGCSCSNKICYRN b | Phyb_A (Petunia hybrida) | Cyclotide |
© 2018 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
Share and Cite
Álvarez, C.A.; Barriga, A.; Albericio, F.; Romero, M.S.; Guzmán, F. Identification of Peptides in Flowers of Sambucus nigra with Antimicrobial Activity against Aquaculture Pathogens. Molecules 2018, 23, 1033. https://doi.org/10.3390/molecules23051033
Álvarez CA, Barriga A, Albericio F, Romero MS, Guzmán F. Identification of Peptides in Flowers of Sambucus nigra with Antimicrobial Activity against Aquaculture Pathogens. Molecules. 2018; 23(5):1033. https://doi.org/10.3390/molecules23051033
Chicago/Turabian StyleÁlvarez, Claudio Andrés, Andrés Barriga, Fernando Albericio, María Soledad Romero, and Fanny Guzmán. 2018. "Identification of Peptides in Flowers of Sambucus nigra with Antimicrobial Activity against Aquaculture Pathogens" Molecules 23, no. 5: 1033. https://doi.org/10.3390/molecules23051033