Antimicrobial Peptides as Probes in Biosensors Detecting Whole Bacteria: A Review
Abstract
1. Introduction
2. Antimicrobial Peptides as a Mean to Detect Bacteria
2.1. Inhibiting Bactericidal Activity of AMPs as Probes
2.2. Determination of Membrane Binding Fragments
2.3. Exploiting Opportunities Given by Surface Tethering
3. On the Use of AMPs as Ligands for Biosensors
3.1. First Applications of AMPs in Biosensors
3.2. Improving Biosensors Operability by Designing Label-Free Approaches
3.3. Biosensors Based Solely on AMPs for the Recognition of Bacteria
4. Perspectives and Outlook
4.1. Advantages and Limitations of AMP-Based Biosensors for the Detection of Pathogens
4.2. Exploiting the Versatility of AMPs
4.3. Emerging Trends in the Design of Biosensors
5. Conclusions
Funding
Conflicts of Interest
References
- United Nations meeting on antimicrobial resistance. Bull. World Health Organ. 2016, 94, 638–663. [CrossRef]
- Fleischmann, C.; Scherag, A.; Adhikari, N.K.J.; Hartog, C.S.; Tsaganos, T.; Schlattmann, P.; Angus, D.C.; Reinhart, K. Assessment of Global Incidence and Mortality of Hospital-treated Sepsis. Current Estimates and Limitations. Am. J. Respir. Crit. Care Med. 2016, 193, 259–272. [Google Scholar] [CrossRef]
- Boucher, H.W.; Talbot, G.H.; Bradley, J.S.; Edwards, J.E.; Gilbert, D.; Rice, L.B.; Scheld, M.; Spellberg, B.; Bartlett, J. Bad Bugs, No Drugs: No ESKAPE! An Update from the Infectious Diseases Society of America. Clin. Infect. Dis. 2009, 48, 1–12. [Google Scholar] [CrossRef]
- Piotrowska, U.; Sobczak, M.; Oledzka, E. Current state of a dual behaviour of antimicrobial peptides–Therapeutic agents and promising delivery vectors. Chem. Biol. Drug Des. 2017, 90, 1079–1093. [Google Scholar] [CrossRef]
- Zacharof, M.P.; Lovitt, R.W. Bacteriocins Produced by Lactic Acid Bacteria a Review Article. Apcbee Procedia 2012, 2, 50–56. [Google Scholar] [CrossRef]
- Zasloff, M. Antimicrobial peptides of multicellular organisms. Nature 2002, 415, 389–395. [Google Scholar] [CrossRef]
- Tam, J.; Wang, S.; Wong, K.; Tan, W. Antimicrobial Peptides from Plants. Pharmaceuticals 2015, 8, 711–757. [Google Scholar] [CrossRef]
- Mylonakis, E.; Podsiadlowski, L.; Muhammed, M.; Vilcinskas, A. Diversity, evolution and medical applications of insect antimicrobial peptides. Philos. Trans. R. Soc. B Biol. Sci. 2016, 371, 20150290. [Google Scholar] [CrossRef]
- Fjell, C.D.; Hiss, J.A.; Hancock, R.E.W.; Schneider, G. Designing antimicrobial peptides: Form follows function. Nat. Rev. Drug Discov. 2011, 11, 37–51. [Google Scholar] [CrossRef]
- Aguilera-Mendoza, L.; Marrero-Ponce, Y.; Tellez-Ibarra, R.; Llorente-Quesada, M.T.; Salgado, J.; Barigye, S.J.; Liu, J. Overlap and diversity in antimicrobial peptide databases: Compiling a non-redundant set of sequences. Bioinformatics 2015, 31, 2553–2559. [Google Scholar] [CrossRef][Green Version]
- Mergaert, P. Role of antimicrobial peptides in controlling symbiotic bacterial populations. Nat. Prod. Rep. 2018, 35, 336–356. [Google Scholar] [CrossRef]
- Lee, T.-H.; Hall, K.N.; Aguilar, M.-I. Antimicrobial Peptide Structure and Mechanism of Action: A Focus on the Role of Membrane Structure. Curr. Top. Med. Chem. 2015, 16, 25–39. [Google Scholar] [CrossRef] [PubMed]
- Nguyen, L.T.; Haney, E.F.; Vogel, H.J. The expanding scope of antimicrobial peptide structures and their modes of action. Trends Biotechnol. 2011, 29, 464–472. [Google Scholar] [CrossRef]
- Harris, F.; Dennison, S.; Phoenix, D. Anionic Antimicrobial Peptides from Eukaryotic Organisms. Curr. Protein Pept. Sci. 2009, 10, 585–606. [Google Scholar] [CrossRef]
- Henderson, J.M.; Waring, A.J.; Separovic, F.; Lee, K.Y.C. Antimicrobial Peptides Share a Common Interaction Driven by Membrane Line Tension Reduction. Biophys. J. 2016, 111, 2176–2189. [Google Scholar] [CrossRef]
- North, S.H.; Wojciechowski, J.; Chu, V.; Taitt, C.R. Surface immobilization chemistry influences peptide-based detection of lipopolysaccharide and lipoteichoic acid. J. Pept. Sci. 2012, 18, 366–372. [Google Scholar] [CrossRef]
- Strauss, J.; Kadilak, A.; Cronin, C.; Mello, C.M.; Camesano, T.A. Binding, inactivation, and adhesion forces between antimicrobial peptide cecropin P1 and pathogenic E. coli. Colloids Surf. B 2010, 75, 156–164. [Google Scholar] [CrossRef]
- Yu, G.; Baeder, D.Y.; Regoes, R.R.; Rolff, J. Predicting drug resistance evolution: Insights from antimicrobial peptides and antibiotics. Proc. R. Soc. B Biol. Sci. 2018, 285, 20172687. [Google Scholar] [CrossRef]
- Rodriguez-Rojas, A.; Makarova, O.; Rolff, J. Antimicrobials, Stress and Mutagenesis. Plos Pathog. 2014, 10, e1004445. [Google Scholar] [CrossRef]
- Haney, E.F.; Straus, S.K.; Hancock, R.E.W. Reassessing the Host Defense Peptide Landscape. Front. Chem. 2019, 7, 43. [Google Scholar] [CrossRef]
- Zasowski, E.J.; Claeys, K.C.; Lagnf, A.M.; Davis, S.L.; Rybak, M.J. Time Is of the Essence: The Impact of Delayed Antibiotic Therapy on Patient Outcomes in Hospital-Onset Enterococcal Bloodstream Infections. Clin. Infect. Dis. 2016, 62, 1242–1250. [Google Scholar] [CrossRef] [PubMed]
- van Belkum, A.; Bachmann, T.T.; Lüdke, G.; Lisby, J.G.; Kahlmeter, G.; Mohess, A.; Becker, K.; Hays, J.P.; Woodford, N.; Mitsakakis, K.; et al. Developmental roadmap for antimicrobial susceptibility testing systems. Nat. Rev. Microbiol. 2019, 17, 51–62. [Google Scholar] [CrossRef]
- Pliakos, E.E.; Andreatos, N.; Shehadeh, F.; Ziakas, P.D.; Mylonakis, E. The Cost-Effectiveness of Rapid Diagnostic Testing for the Diagnosis of Bloodstream Infections with or without Antimicrobial Stewardship. Clin. Microbiol. Rev. 2018, 31, e00095-17. [Google Scholar] [CrossRef]
- Cendejas-Bueno, E.; Romero-Gómez, M.P.; Mingorance, J. The challenge of molecular diagnosis of bloodstream infections. World J. Microbiol. Biotechnol. 2019, 35, 65. [Google Scholar] [CrossRef] [PubMed]
- Sinha, M.; Jupe, J.; Mack, H.; Coleman, T.P.; Lawrence, S.M.; Fraley, S.I. Emerging Technologies for Molecular Diagnosis of Sepsis. Clin. Microbiol. Rev. 2018, 31, e00089-17. [Google Scholar] [CrossRef] [PubMed]
- Buszewski, B.; Rogowska, A.; Pomastowski, P.; Złoch, M.; Railean-Plugaru, V. Identification of Microorganisms by Modern Analytical Techniques. J. AOAC Int. 2017, 100, 1607–1623. [Google Scholar] [CrossRef] [PubMed]
- Templier, V.; Roux, A.; Roupioz, Y.; Livache, T. Ligands for label-free detection of whole bacteria on biosensors: A review. Trac Trends Anal. Chem. 2016, 79, 71–79. [Google Scholar] [CrossRef]
- Lillehoj, P.B.; Kaplan, C.W.; He, J.; Shi, W.; Ho, C.-M. Rapid, Electrical Impedance Detection of Bacterial Pathogens Using Immobilized Antimicrobial Peptides. J. Lab. Autom. 2013, 19, 42–49. [Google Scholar] [CrossRef]
- Arcidiacono, S.; Pivarnik, P.; Mello, C.M.; Senecal, A. Cy5 labeled antimicrobial peptides for enhanced detection of Escherichia coli O157:H7. Biosens. Bioelectron. 2008, 23, 1721–1727. [Google Scholar] [CrossRef]
- Etayash, H.; Jiang, K.; Thundat, T.; Kaur, K. Impedimetric Detection of Pathogenic Gram-Positive Bacteria Using an Antimicrobial Peptide from Class IIa Bacteriocins. Anal. Chem. 2014, 86, 1693–1700. [Google Scholar] [CrossRef]
- Mannoor, M.S.; Zhang, S.; Link, A.J.; McAlpine, M.C. Electrical detection of pathogenic bacteria via immobilized antimicrobial peptides. Proc. Natl. ACAD Sci. 2010, 107, 19207–19212. [Google Scholar] [CrossRef] [PubMed]
- Dong, Z.-M.; Zhao, G.-C. Label-free detection of pathogenic bacteria via immobilized antimicrobial peptides. Talanta 2015, 137, 55–61. [Google Scholar] [CrossRef] [PubMed]
- Wang, J.; Morton, M.J.; Elliott, C.T.; Karoonuthaisiri, N.; Segatori, L.; Biswal, S.L. Rapid Detection of Pathogenic Bacteria and Screening of Phage-Derived Peptides Using Microcantilevers. Anal. Chem. 2014, 86, 1671–1678. [Google Scholar] [CrossRef] [PubMed]
- Mannoor, M.S.; Tao, H.; Clayton, J.D.; Sengupta, A.; Kaplan, D.L.; Naik, R.R.; Verma, N.; Omenetto, F.G.; McAlpine, M.C. Graphene-based wireless bacteria detection on tooth enamel. Nat. Commun. 2012, 3, 763. [Google Scholar] [CrossRef]
- Liu, X.; Marrakchi, M.; Xu, D.; Dong, H.; Andreescu, S. Biosensors based on modularly designed synthetic peptides for recognition, detection and live/dead differentiation of pathogenic bacteria. Biosens. Bioelectron. 2016, 80, 9–16. [Google Scholar] [CrossRef]
- Welling, M.M.; Lupetti, A.; Balter, H.S.; Lanzzeri, S.; Souto, B.; Rey, A.M.; Savio, E.O.; Paulusma-Annema, A.; Pauwels, E.K.; Nibbering, P.H. 99mTc-labeled antimicrobial peptides for detection of bacterial and Candida albicans infections. J. Nucl. Med. Off. Publ. Soc. Nucl. Med. 2001, 42, 788–794. [Google Scholar]
- Akhtar, M.S.; Imran, M.B.; Nadeem, M.A.; Shahid, A. Antimicrobial Peptides as Infection Imaging Agents: Better Than Radiolabeled Antibiotics. Int. J. Pept. 2012, 2012, 1–19. [Google Scholar] [CrossRef]
- Welling, M.M.; Hensbergen, A.W.; Bunschoten, A.; Velders, A.H.; Scheper, H.; Smits, W.K.; Roestenberg, M.; van Leeuwen, F.W.B. Fluorescent imaging of bacterial infections and recent advances made with multimodal radiopharmaceuticals. Clin. Transl. Imaging 2019, 7, 125–138. [Google Scholar] [CrossRef]
- Azmi, S.; Jiang, K.; Stiles, M.; Thundat, T.; Kaur, K. Detection of Listeria monocytogenes with Short Peptide Fragments from Class IIa Bacteriocins as Recognition Elements. ACS Comb. Sci. 2015, 17, 156–163. [Google Scholar] [CrossRef]
- Hänchen, A.; Rausch, S.; Landmann, B.; Toti, L.; Nusser, A.; Süssmuth, R.D. Alanine Scan of the Peptide Antibiotic Feglymycin: Assessment of Amino Acid Side Chains Contributing to Antimicrobial Activity. ChemBioChem 2013, 14, 625–632. [Google Scholar] [CrossRef]
- Migoń, D.; Jaśkiewicz, M.; Neubauer, D.; Bauer, M.; Sikorska, E.; Kamysz, E.; Kamysz, W. Alanine Scanning Studies of the Antimicrobial Peptide Aurein 1.2. Probiotics Antimicrob. Proteins 2019, 11, 1042–1054. [Google Scholar] [CrossRef]
- Hilpert, K.; Elliott, M.; Jenssen, H.; Kindrachuk, J.; Fjell, C.D.; Körner, J.; Winkler, D.F.H.; Weaver, L.L.; Henklein, P.; Ulrich, A.S.; et al. Screening and Characterization of Surface-Tethered Cationic Peptides for Antimicrobial Activity. Chem. Biol. 2009, 16, 58–69. [Google Scholar] [CrossRef] [PubMed]
- Frank, R. The SPOT-synthesis technique. J. Immunol. Methods 2002, 267, 13–26. [Google Scholar] [CrossRef]
- Torres, M.D.T.; Sothiselvam, S.; Lu, T.K.; de la Fuente-Nunez, C. Peptide Design Principles for Antimicrobial Applications. J. Mol. Biol. 2019, 431, 3547–3567. [Google Scholar] [CrossRef] [PubMed]
- Humblot, V.; Yala, J.-F.; Thebault, P.; Boukerma, K.; Héquet, A.; Berjeaud, J.-M.; Pradier, C.-M. The antibacterial activity of Magainin I immobilized onto mixed thiols Self-Assembled Monolayers. Biomaterials 2009, 30, 3503–3512. [Google Scholar] [CrossRef] [PubMed]
- Glinel, K.; Thebault, P.; Humblot, V.; Pradier, C.M.; Jouenne, T. Antibacterial surfaces developed from bio-inspired approaches. Acta Biomater. 2012, 8, 1670–1684. [Google Scholar] [CrossRef]
- Melo, M.N.; Ferre, R.; Castanho, M.A.R.B. Antimicrobial peptides: Linking partition, activity and high membrane-bound concentrations. Nat. Rev. Microbiol. 2009, 7, 245–250. [Google Scholar] [CrossRef]
- Guralp, S.A.; Gubbuk, I.H.; Kucukkolbasi, S.; Gulari, E. Universal cell capture by immobilized antimicrobial peptide plantaricin. Biochem. Eng. J. 2015, 101, 18–22. [Google Scholar] [CrossRef]
- Bagheri, M.; Beyermann, M.; Dathe, M. Immobilization Reduces the Activity of Surface-Bound Cationic Antimicrobial Peptides with No Influence upon the Activity Spectrum. Antimicrob. Agents Chemother. 2008, 53, 1132–1141. [Google Scholar] [CrossRef]
- Shriver-Lake, L.C.; Anderson, G.P.; Taitt, C.R. Effect of Linker Length on Cell Capture by Poly(ethylene glycol)-Immobilized Antimicrobial Peptides. Langmuir 2017, 33, 2878–2884. [Google Scholar] [CrossRef]
- Gabriel, M.; Nazmi, K.; Veerman, E.C.; Nieuw Amerongen, A.V.; Zentner, A. Preparation of LL-37-Grafted Titanium Surfaces with Bactericidal Activity. Bioconj. Chem. 2006, 17, 548–550. [Google Scholar] [CrossRef]
- Bagheri, M.; Beyermann, M.; Dathe, M. Mode of Action of Cationic Antimicrobial Peptides Defines the Tethering Position and the Efficacy of Biocidal Surfaces. Bioconj. Chem. 2012, 23, 66–74. [Google Scholar] [CrossRef]
- Soares, J.W.; Kirby, R.; Doherty, L.A.; Meehan, A.; Arcidiacono, S. Immobilization and orientation-dependent activity of a naturally occurring antimicrobial peptide. J. Pept. Sci. 2015, 21, 669–679. [Google Scholar] [CrossRef]
- Li, Y.; Wei, S.; Wu, J.; Jasensky, J.; Xi, C.; Li, H.; Xu, Y.; Wang, Q.; Marsh, E.N.G.; Brooks, C.L.; et al. Effects of Peptide Immobilization Sites on the Structure and Activity of Surface-Tethered Antimicrobial Peptides. J. Phys. Chem. C 2015, 119, 7146–7155. [Google Scholar] [CrossRef]
- Reichart, T.M.; Uzarski, J.R.; Mello, C.M. Differential presentation of a single antimicrobial peptide is sufficient to identify LPS from distinct bacterial samples. Analyst 2019, 144, 7242–7249. [Google Scholar] [CrossRef]
- Andrea, A.; Molchanova, N.; Jenssen, H. Antibiofilm Peptides and Peptidomimetics with Focus on Surface Immobilization. Biomolecules 2018, 8, 27. [Google Scholar] [CrossRef] [PubMed]
- Costa, F.; Carvalho, I.F.; Montelaro, R.C.; Gomes, P.; Martins, M.C.L. Covalent immobilization of antimicrobial peptides (AMPs) onto biomaterial surfaces. Acta Biomater. 2011, 7, 1431–1440. [Google Scholar] [CrossRef] [PubMed]
- Soares, J.W.; Morin, K.M.; Mello, C.M. Antimicrobial Peptides for Use in Biosensing Applications. Available online: https://apps.dtic.mil/dtic/tr/fulltext/u2/a433515.pdf (accessed on 20 February 2020).
- Kulagina, N.V.; Lassman, M.E.; Ligler, F.S.; Taitt, C.R. Antimicrobial Peptides for Detection of Bacteria in Biosensor Assays. Anal. Chem. 2005, 77, 6504–6508. [Google Scholar] [CrossRef] [PubMed]
- Kulagina, N.; Shaffer, K.; Ligler, F.; Taitt, C. Antimicrobial peptides as new recognition molecules for screening challenging species. Sens. Actuators B 2007, 121, 150–157. [Google Scholar] [CrossRef]
- Kulagina, N.V.; Shaffer, K.M.; Anderson, G.P.; Ligler, F.S.; Taitt, C.R. Antimicrobial peptide-based array for Escherichia coli and Salmonella screening. Anal. Chim. Acta 2006, 575, 9–15. [Google Scholar] [CrossRef]
- Zampa, M.F.; Araújo, I.M.S.; Costa, V.; Costa, C.H.N.; Santos, J.R.; Zucolotto, V.; Eiras, C.; Leite, J.R.S.A. Leishmanicidal Activity and Immobilization of dermaseptin 01 antimicrobial peptides in ultrathin films for nanomedicine applications. Nanomed. Nanotechnol. Biol. Med. 2009, 5, 352–358. [Google Scholar] [CrossRef]
- Johnson, B.J.; Taitt, C.R.; Gleaves, A.; North, S.H.; Malanoski, A.P.; Leska, I.A.; Archibong, E.; Monk, S.M. Porphyrin-modified antimicrobial peptide indicators for detection of bacteria. Sens. Bio-Sens. Res. 2016, 8, 1–7. [Google Scholar] [CrossRef]
- Yuan, K.; Mei, Q.; Guo, X.; Xu, Y.; Yang, D.; Sánchez, B.J.; Sheng, B.; Liu, C.; Hu, Z.; Yu, G.; et al. Antimicrobial peptide based magnetic recognition elements and Au@Ag-GO SERS tags with stable internal standards: A three in one biosensor for isolation, discrimination and killing of multiple bacteria in whole blood. Chem. Sci. 2018, 9, 8781–8795. [Google Scholar] [CrossRef]
- Chen, Q.; Zhang, L.; Feng, Y.; Shi, F.; Wang, Y.; Wang, P.; Liu, L. Dual-functional peptide conjugated gold nanorods for the detection and photothermal ablation of pathogenic bacteria. J. Mater. Chem. B 2018, 6, 7643–7651. [Google Scholar] [CrossRef] [PubMed]
- Dao, T.N.T.; Yoon, J.; Jin, C.E.; Koo, B.; Han, K.; Shin, Y.; Lee, T.Y. Rapid and sensitive detection of Salmonella based on microfluidic enrichment with a label-free nanobiosensing platform. Sens. Actuators B 2018, 262, 588–594. [Google Scholar] [CrossRef]
- Xiong, J.; Wang, W.; Fu, Z. Fluorimetric sandwich affinity assay for Staphylococcus aureus based on dual-peptide recognition on magnetic nanoparticles. Microchim. Acta 2017, 184, 4197–4202. [Google Scholar] [CrossRef]
- Chang, M.-S.; Yoo, J.H.; Woo, D.H.; Chun, M.-S. Efficient detection of Escherichia coli O157:H7 using a reusable microfluidic chip embedded with antimicrobial peptide-labeled beads. Analyst 2015, 140, 7997–8006. [Google Scholar] [CrossRef] [PubMed]
- Li, N.N.; Li, J.Z.; Liu, P.; Pranantyo, D.; Luo, L.; Chen, J.C.; Kang, E.-T.; Hu, X.F.; Li, C.M.; Xu, L.Q. An antimicrobial peptide with an aggregation-induced emission (AIE) luminogen for studying bacterial membrane interactions and antibacterial actions. Chem. Commun. 2017, 53, 3315–3318. [Google Scholar] [CrossRef] [PubMed]
- Han, J.; Cheng, H.; Wang, B.; Braun, M.S.; Fan, X.; Bender, M.; Huang, W.; Domhan, C.; Mier, W.; Lindner, T.; et al. A Polymer/Peptide Complex-Based Sensor Array That Discriminates Bacteria in Urine. Angew. Chem. Int. Ed. 2017, 56, 15246–15251. [Google Scholar] [CrossRef]
- Yonekita, T.; Ohtsuki, R.; Hojo, E.; Morishita, N.; Matsumoto, T.; Aizawa, T.; Morimatsu, F. Development of a novel multiplex lateral flow assay using an antimicrobial peptide for the detection of Shiga toxin-producing Escherichia coli. J. Microbiol. Methods 2013, 93, 251–256. [Google Scholar] [CrossRef] [PubMed]
- Wilson, D.; Materón, E.M.; Ibáñez-Redín, G.; Faria, R.C.; Correa, D.S.; Oliveira, O.N. Electrical detection of pathogenic bacteria in food samples using information visualization methods with a sensor based on magnetic nanoparticles functionalized with antimicrobial peptides. Talanta 2019, 194, 611–618. [Google Scholar] [CrossRef] [PubMed]
- Hoyos-Nogués, M.; Gil, F.J.; Mas-Moruno, C. Antimicrobial Peptides: Powerful Biorecognition Elements to Detect Bacteria in Biosensing Technologies. Molecules 2018, 23, 1683. [Google Scholar] [CrossRef] [PubMed]
- Chen, Y.; Michael, Z.P.; Kotchey, G.P.; Zhao, Y.; Star, A. Electronic Detection of Bacteria Using Holey Reduced Graphene Oxide. ACS Appl. Mater. Interfaces 2014, 6, 3805–3810. [Google Scholar] [CrossRef] [PubMed]
- Shi, X.; Zhang, X.; Yao, Q.; He, F. A novel method for the rapid detection of microbes in blood using pleurocidin antimicrobial peptide functionalized piezoelectric sensor. J. Microbiol. Methods 2016, 133, 69–75. [Google Scholar] [CrossRef]
- Lamy, B.; Dargère, S.; Arendrup, M.C.; Parienti, J.-J.; Tattevin, P. How to Optimize the Use of Blood Cultures for the Diagnosis of Bloodstream Infections? A State-of-the Art. Front. Microbiol. 2016, 7, 697. [Google Scholar] [CrossRef]
- Etayash, H.; Norman, L.; Thundat, T.; Kaur, K. Peptide-Bacteria Interactions using Engineered Surface-Immobilized Peptides from Class IIa Bacteriocins. Langmuir 2013, 29, 4048–4056. [Google Scholar] [CrossRef]
- Jucker, B.A.; Harms, H.; Hug, S.J.; Zehnder, A.J.B. Adsorption of bacterial surface polysaccharides on mineral oxides is mediated by hydrogen bonds. Colloids Surf. B Biointerfaces 1997, 9, 331–343. [Google Scholar] [CrossRef]
- de Freire Bastos, M.d.C.; Coelho, M.L.V.; da Silva Santos, O.C. Resistance to bacteriocins produced by Gram-positive bacteria. Microbiology 2015, 161, 683–700. [Google Scholar] [CrossRef]
- Andrade, C.A.S.; Nascimento, J.M.; Oliveira, I.S.; de Oliveira, C.V.J.; de Melo, C.P.; Franco, O.L.; Oliveira, M.D.L. Nanostructured sensor based on carbon nanotubes and clavanin A for bacterial detection. Colloids Surf. B 2015, 135, 833–839. [Google Scholar] [CrossRef]
- de Miranda, J.L.; Oliveira, M.D.L.; Oliveira, I.S.; Frias, I.A.M.; Franco, O.L.; Andrade, C.A.S. A Simple Nanostructured Biosensor Based on Clavanin A Antimicrobial Peptide for Gram-Negative Bacteria Detection. Biochem Eng J. 2017, 124, 108–114. [Google Scholar] [CrossRef]
- Junior, A.G.S.; Oliveira, M.D.L.; Oliveira, I.S.; Lima-Neto, R.G.; Sá, S.R.; Franco, O.L.; Andrade, C.A.S. A simple nanostructured impedimetric biosensor based on clavanin A peptide for bacterial detection. Sens. Actuators B 2018, 255, 3267–3274. [Google Scholar] [CrossRef]
- Lee, I.H.; Cho, Y.; Lehrer, R.I. Effects of pH and salinity on the antimicrobial properties of clavanins. Infect. Immun. 1997, 65, 2898–2903. [Google Scholar] [CrossRef]
- Lad, M.D.; Birembaut, F.; Clifton, L.A.; Frazier, R.A.; Webster, J.R.P.; Green, R.J. Antimicrobial Peptide-Lipid Binding Interactions and Binding Selectivity. Biophys. J. 2007, 92, 3575–3586. [Google Scholar] [CrossRef] [PubMed]
- Pardoux, É.; Roux, A.; Mathey, R.; Boturyn, D.; Roupioz, Y. Antimicrobial peptide arrays for wide spectrum sensing of pathogenic bacteria. Talanta 2019, 203, 322–327. [Google Scholar] [CrossRef]
- Bouguelia, S.; Roupioz, Y.; Slimani, S.; Mondani, L.; Casabona, M.G.; Durmort, C.; Vernet, T.; Calemczuk, R.; Livache, T. On-chip microbial culture for the specific detection of very low levels of bacteria. Lab. Chip 2013, 13, 4024. [Google Scholar] [CrossRef] [PubMed]
- Morlay, A.; Duquenoy, A.; Piat, F.; Calemczuk, R.; Mercey, T.; Livache, T.; Roupioz, Y. Label-free immuno-sensors for the fast detection of Listeria in food. Measurement 2017, 98, 305–310. [Google Scholar] [CrossRef]
- Templier, V.; Livache, T.; Boisset, S.; Maurin, M.; Slimani, S.; Mathey, R.; Roupioz, Y. Biochips for Direct Detection and Identification of Bacteria in Blood Culture-Like Conditions. Sci. Rep. 2017, 7, 1–10. [Google Scholar] [CrossRef]
- Li, Y.; Afrasiabi, R.; Fathi, F.; Wang, N.; Xiang, C.; Love, R.; She, Z.; Kraatz, H.-B. Impedance based detection of pathogenic E. coli O157:H7 using a ferrocene-antimicrobial peptide modified biosensor. Biosens. Bioelectron. 2014, 58, 193–199. [Google Scholar] [CrossRef]
- Schwartz, O.; Bercovici, M. Microfluidic Assay for Continuous Bacteria Detection Using Antimicrobial Peptides and Isotachophoresis. Anal. Chem 2014, 86, 10106–10113. [Google Scholar] [CrossRef]
- Jiang, K.; Etayash, H.; Azmi, S.; Naicker, S.; Hassanpourfard, M.; Shaibani, P.M.; Thakur, G.; Kaur, K.; Thundat, T. Rapid label-free detection of E. coli using antimicrobial peptide assisted impedance spectroscopy. Anal. Methods 2015, 7, 9744–9748. [Google Scholar] [CrossRef]
- Li, Z.; Yang, H.; Sun, L.; Qi, H.; Gao, Q.; Zhang, C. Electrogenerated chemiluminescence biosensors for the detection of pathogenic bacteria using antimicrobial peptides as capture/signal probes. Sens. Actuators B 2015, 210, 468–474. [Google Scholar] [CrossRef]
- Hoyos-Nogues, M.; Brosel-Oliu, S.; Abramova, N.; Muñoz, F.-X.; Bratov, A.; Mas-Moruno, C.; Gil, F.-J. Impedimetric antimicrobial peptide-based sensor for the early detection of periodontopathogenic bacteria. Biosens. Bioelectron. 2016, 86, 377–385. [Google Scholar] [CrossRef] [PubMed]
- Zhou, C.; Zou, H.; Li, M.; Sun, C.; Ren, D.; Li, Y. Fiber optic surface plasmon resonance sensor for detection of E. coli O157:H7 based on antimicrobial peptides and AgNPs-rGO. Biosens. Bioelectron. 2018, 117, 347–353. [Google Scholar] [CrossRef] [PubMed]
- Lv, E.; Ding, J.; Qin, W. Potentiometric Detection of Listeria monocytogenes via a Short Antimicrobial Peptide Pair-Based Sandwich Assay. Anal. Chem 2018, 90, 13600–13606. [Google Scholar] [CrossRef] [PubMed]
- Riu, J.; Giussani, B. Electrochemical biosensors for the detection of pathogenic bacteria in food. Trac Trends Anal. Chem. 2020, 126, 115863. [Google Scholar] [CrossRef]
- Dubourg, G.; Raoult, D.; Fenollar, F. Emerging methodologies for pathogen identification in bloodstream infections: An update. Expert Rev. Mol. Diagn. 2019, 19, 161–173. [Google Scholar] [CrossRef]
- Rajapaksha, P.; Elbourne, A.; Gangadoo, S.; Brown, R.; Cozzolino, D.; Chapman, J. A review of methods for the detection of pathogenic microorganisms. Anal. 2019, 144, 396–411. [Google Scholar] [CrossRef]
- Kumar, S.S.; Ghosh, A.R. Assessment of bacterial viability: A comprehensive review on recent advances and challenges. Microbiology 2019, 165, 593–610. [Google Scholar] [CrossRef]
- Guido, M.; Tumolo, M.R.; De Donno, A.; Verri, T.; Serio, F.; Bagordo, F.; Zizza, A. In vitro diagnosis of sepsis: A review. Pathol. Lab. Med. Int. 2016, 8, 1–14. [Google Scholar] [CrossRef]
- Idelevich, E.A.; Reischl, U.; Becker, K. New microbiological techniques in the diagnosis of bloodstream infections. Dtsch. Aerzteblatt Online 2018, 115, 822. [Google Scholar] [CrossRef]
- Kumar, S.; Tripathy, S.; Jyoti, A.; Singh, S.G. Recent advances in biosensors for diagnosis and detection of sepsis: A comprehensive review. Biosens. Bioelectron. 2019, 124, 205–215. [Google Scholar] [CrossRef] [PubMed]
- Edmiston, C.E.; Garcia, R.; Barnden, M.; DeBaun, B.; Johnson, H.B. Rapid diagnostics for bloodstream infections: A primer for infection preventionists. Am. J. Infect. Control 2018, 46, 1060–1068. [Google Scholar] [CrossRef] [PubMed]
- Kang, X.; Dong, F.; Shi, C.; Liu, S.; Sun, J.; Chen, J.; Li, H.; Xu, H.; Lao, X.; Zheng, H. DRAMP 2.0, an updated data repository of antimicrobial peptides. Sci. Data 2019, 6, 1–10. [Google Scholar] [CrossRef] [PubMed]
- Wang, G.; Li, X.; Wang, Z. APD3: The antimicrobial peptide database as a tool for research and education. Nucleic Acids Res. 2015, 44, D1087–D1093. [Google Scholar] [CrossRef]
- Mikut, R.; Ruden, S.; Reischl, M.; Breitling, F.; Volkmer, R.; Hilpert, K. Improving short antimicrobial peptides despite elusive rules for activity. Biochim. Biophys. Acta 2016, 1858, 1024–1033. [Google Scholar] [CrossRef]
- Huang, J.X.; Bishop-Hurley, S.L.; Cooper, M.A. Development of Anti-Infectives Using Phage Display: Biological Agents against Bacteria, Viruses, and Parasites. Antimicrob. Agents Chemother. 2012, 56, 4569–4582. [Google Scholar] [CrossRef]
- Lee, E.Y.; Lee, M.W.; Fulan, B.M.; Ferguson, A.L.; Wong, G.C.L. What can machine learning do for antimicrobial peptides, and what can antimicrobial peptides do for machine learning? Interface Focus 2017, 7, 20160153. [Google Scholar] [CrossRef]
- Ye, S.; Nguyen, K.T.; Boughton, A.P.; Mello, C.M.; Chen, Z. Orientation Difference of Chemically Immobilized and Physically Adsorbed Biological Molecules on Polymers Detected at the Solid/Liquid Interfaces in Situ. Langmuir 2010, 26, 6471–6477. [Google Scholar] [CrossRef]
- Wasilewski, T.; Szulczyński, B.; Kamysz, W.; Gębicki, J.; Namieśnik, J. Evaluation of Three Peptide Immobilization Techniques on a QCM Surface Related to Acetaldehyde Responses in the Gas Phase. Sensors 2018, 18, 3942. [Google Scholar] [CrossRef]
- Ligler, F.S.; Gooding, J.J. Lighting Up Biosensors: Now and the Decade To Come. Anal. Chem. 2019, 91, 8732–8738. [Google Scholar] [CrossRef]
- Pashchenko, O.; Shelby, T.; Banerjee, T.; Santra, S. A Comparison of Optical, Electrochemical, Magnetic, and Colorimetric Point-of-Care Biosensors for Infectious Disease Diagnosis. ACS Infect. Dis. 2018, 4, 1162–1178. [Google Scholar] [CrossRef]
- Du, H.; Li, Z.; Wang, Y.; Yang, Q.; Wu, W. Nanomaterial-based Optical Biosensors for the Detection of Foodborne Bacteria. Food Rev. Int. 2020, 1–30. [Google Scholar] [CrossRef]
- Pourakbari, R.; Shadjou, N.; Yousefi, H.; Isildak, I.; Yousefi, M.; Rashidi, M.-R.; Khalilzadeh, B. Recent progress in nanomaterial-based electrochemical biosensors for pathogenic bacteria. Microchim. Acta 2019, 186, 820. [Google Scholar] [CrossRef] [PubMed]
- Sai-Anand, G.; Sivanesan, A.; Benzigar, M.R.; Singh, G.; Gopalan, A.-I.; Baskar, A.V.; Ilbeygi, H.; Ramadass, K.; Kambala, V.; Vinu, A. Recent Progress on the Sensing of Pathogenic Bacteria Using Advanced Nanostructures. Bull. Chem. Soc. Jpn. 2019, 92, 216–244. [Google Scholar] [CrossRef]
- Wang, J.; Wu, H.; Yang, Y.; Yan, R.; Zhao, Y.; Wang, Y.; Chen, A.; Shao, S.; Jiang, P.; Li, Y.-Q. Bacterial species-identifiable magnetic nanosystems for early sepsis diagnosis and extracorporeal photodynamic blood disinfection. Nanoscale 2018, 10, 132–141. [Google Scholar] [CrossRef] [PubMed]
- Bicart-See, A.; Rottman, M.; Cartwright, M.; Seiler, B.; Gamini, N.; Rodas, M.; Penary, M.; Giordano, G.; Oswald, E.; Super, M.; et al. Rapid Isolation of Staphylococcus aureus Pathogens from Infected Clinical Samples Using Magnetic Beads Coated with Fc-Mannose Binding Lectin. PLoS ONE 2016, 11, e0156287. [Google Scholar] [CrossRef]
- Olanrewaju, A.O.; Ng, A.; DeCorwin-Martin, P.; Robillard, A.; Juncker, D. Microfluidic Capillaric Circuit for Rapid and Facile Bacteria Detection. Anal. Chem 2017, 89, 6846–6853. [Google Scholar] [CrossRef]
- Liu, L.; Chen, S.; Xue, Z.; Zhang, Z.; Qiao, X.; Nie, Z.; Han, D.; Wang, J.; Wang, T. Bacterial capture efficiency in fluid bloodstream improved by bendable nanowires. Nat. Commun. 2018, 9, 1–9. [Google Scholar] [CrossRef]
- Zheng, L.; Wan, Y.; Qi, P.; Sun, Y.; Zhang, D.; Yu, L. Lectin functionalized ZnO nanoarrays as a 3D nano-biointerface for bacterial detection. Talanta 2017, 167, 600–606. [Google Scholar] [CrossRef]
- Dao, T.N.T.; Lee, E.Y.; Koo, B.; Jin, C.E.; Lee, T.Y.; Shin, Y. A microfluidic enrichment platform with a recombinase polymerase amplification sensor for pathogen diagnosis. Anal. Biochem. 2018, 544, 87–92. [Google Scholar] [CrossRef]
- Ohlsson, P.; Petersson, K.; Augustsson, P.; Laurell, T. Acoustic impedance matched buffers enable separation of bacteria from blood cells at high cell concentrations. Sci. Rep. 2018, 8, 9156. [Google Scholar] [CrossRef] [PubMed]
- Sande, M.G.; Çaykara, T.; Silva, C.J.; Rodrigues, L.R. New solutions to capture and enrich bacteria from complex samples. Med. Microbiol. Immunol. 2020, 1–7. [Google Scholar] [CrossRef] [PubMed]
- Burklund, A.; Zhang, J.X.J. Microfluidics-Based Organism Isolation from Whole Blood: An Emerging Tool for Bloodstream Infection Diagnosis. Ann. Biomed. Eng. 2019, 47, 1657–1674. [Google Scholar] [CrossRef] [PubMed]
- Zhou, W.; Le, J.; Chen, Y.; Cai, Y.; Hong, Z.; Chai, Y. Recent advances in microfluidic devices for bacteria and fungus research. Trac Trends Anal. Chem. 2019, 112, 175–195. [Google Scholar] [CrossRef]
- Nasseri, B.; Soleimani, N.; Rabiee, N.; Kalbasi, A.; Karimi, M.; Hamblin, M.R. Point-of-care microfluidic devices for pathogen detection. Biosens. Bioelectron. 2018, 117, 112–128. [Google Scholar] [CrossRef]



| Peptide | Sequence | Reported Specificity 1 | Ref. |
|---|---|---|---|
| C16G2cys | TFFRLFNRSFTQALGKGGGKNLRIIRKGIHIIKKYGGGC | Streptococcus mutans | [28] |
| Cecropin P1 | SWLSKTAKKLENSAKKRISEGIAIAIQGGPR | Escherichia coli O157:H7 | [29] |
| G10KHc | KKHRKHRKHRKHGGSGGSKNLRRIIRKGIHIIKKYGC | Pseudomonas aeruginosa | [28] |
| Leucocin A | KYYGNGVHCTKSGCSVNWGEAFSAGVHRLANGGNGFW | Gram-positive species | [30] |
| Magainin I | GIGKFLHSAGKFGKAFVGEIMKS | Gram-negative species | [31] |
| E. coli O157:H7 | [32] | ||
| MSal 020417 | NRPDSAQFWLHHGGGSC | Salmonella spp. | [33] |
| Odorranin-HP | GLLRASSVWGRKYYVDLAGCAKA | Broad-spectrum activity | [34] |
| Synthetic peptide | WK3(QL)6K2G3C | Broad-spectrum activity | [35] |
| Peptide | Target | Threshold (CFU·mL−1) | Duration | Volume/Flowrate | Medium | Transduction Mechanism | Ref. |
|---|---|---|---|---|---|---|---|
| Magainin I | E. coli O157:H7 | 103 | 20 min | 5 µL·min−1 | PBS | EIS | [31] |
| S. typhimurium | 104 | ||||||
| Odorranin-HP | E. coli; S. aureus | 103 | 30 min | 1 µL | PBS | Resistive sensor made in graphene. Biocompatible and wireless communication | [34] |
| H. pylori | 105 | 10 min | 1 µL | Saliva | |||
| Magainin I | E. coli O157:H7 | 103 | 90 min | - | PBS | EIS | [89] |
| Leucocin A | L. monocytogenes; S. aureus; E. faecalis; L. innocua | 103 | 20 min | 20 µL | PBS Milk:PBS (1:9) (only for Listeria) | EIS | [30] |
| G10KHc C16G2cys | P. aeruginosa; S. mutans | 105 | 25 min | A few microlitres | Saline buffer | Microfluidic chip coupled to EIS | [28] |
| MSal 020417 (phage-derived peptide) | Salmonella spp. | 106 | < 10 min | 25.2 µL·min−1 | PBS | Micro-cantilevers | [33] |
| Indolicidin | E. coli O416 | 105 | 2 min | 15 µL·min−1 | PBS | Fluorescently labelled AMPs monitored thanks to UV in a microfluidic chip | [90] |
| 108 | Tap water | ||||||
| Magainin I | E. coli O157:H7 | 104 | 60 min | 50 µL·min−1 | PBS | Conductimetry measurement on completely reduced graphene oxide transistors | [74] |
| Clavanin A | E. faecalis; E. coli; B. subtilis; K. Pneumoniae | 102 | 10 min | 1 µL | PBS | EIS sensor using carbon nanotubes structuration | [80] |
| Magainin I | E. coli O157:H7 | 4 × 102 | 10 min | - | PBS | QCM | [32] |
| 1.5 × 103 | 10 min | - | PBS | EIS | |||
| Leucocin A Leu10 (a leucocin A fragment) Ped3 (a pediocin fragment) | L. monocytogenes | 105 | 60 min | 5 mL·h−1 | PBS | Micro-cantilevers | [39] |
| Colicin V | E. coli O6 | 102 | A few minutes | A few microlitres | PBS | EIS | [91] |
| Magainin I | E. coli O157:H7 | 1.2 × 102 | 30 min | 100 µL | PBS | Electrochemiluminescence amplified by a ruthenium-magainin I complex | [92] |
| WK3(QL)6K2G3C | E. coli; S. aureus; P. aeruginosa; S. epidermidis | 102 | 30 min | 100 µL | Tris-HCl | EIS | [35] |
| Pleurocidin | E. coli | 10 | < 15 min | 2 mL | Sheep blood 50% SPS 0.01 % | Piezoelectrical sensor | [75] |
| E. faecalis; S. aureus; P. aeruginosa; K. pneumoniae; E. cloacae; C. albicans | 102 | ||||||
| Human Lactoferrin (residues 1 to 11) | S. sanguinis | 3.5 × 101 | 30 min | 100 mL | KCl | EIS | [93] |
| 8.6 × 102 | Artificial saliva | ||||||
| Clavanin A | E. coli; S. typhimurium; E. faecalis; S. aureus | 10 | 70 min | 2 µL | PBS | EIS | [81] |
| Magainin I | E. coli O157:H7 | 5 × 102 | 10 min | 200 µL | Water; apple juice; orange juice; mixed fruit and vegetable juices | SPR on fibre bundles amplified with silver nanoparticle-reduced graphene oxide nanocomposites | [94] |
| Clavanin A | E. coli; S. typhimurium; E. faecalis; S. aureus; K. pneumoniae; B. subtilis | 10 | - | 2 µL | PBS | EIS | [82] |
| Paired fragments of Leucocin A | L; monocytogenes | 10 | 60 min | 2 mL | Sea water | One fragment is coupled to magnetic beads for isolation. The other is coupled to HRP for potentiometric spectroscopy. | [95] |
| Melittin | E. coli O146 | 1 (or 3.5 for apple juice) | 25 min | 250 µL (20 µL are needed for a measurement) | PBS; drinkable water & apple juice (only for E. coli) | EIS and peptide covered magnetic beads for concentrating bacteria | [72] |
| S. typhimurium; S. aureus | 10 | ||||||
| Clavanin A; Magainin I; Ped3; PGQ; Leucocin A24 | S. typhimurium | 6 | 9 h | 1 mL | TSB | SPR imaging of living bacteria cultures | [71] |
| S. aureus | 16 | 7 h | |||||
| E. coli O1:K1:H7 | 51 | 11 h | |||||
| S. epidermidis | 2.5 × 103 | 6 h | |||||
| L. monocytogenes | 2.6 × 103 | 19 h |
| Method | Advantages | Drawbacks |
|---|---|---|
| Conventional culturing methods |
|
|
| Polymerase Chain Reaction (PCR) |
|
|
| Mass Spectrometry |
|
|
| Optical biosensors |
|
|
| Label-free biosensors |
|
|
© 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
Share and Cite
Pardoux, É.; Boturyn, D.; Roupioz, Y. Antimicrobial Peptides as Probes in Biosensors Detecting Whole Bacteria: A Review. Molecules 2020, 25, 1998. https://doi.org/10.3390/molecules25081998
Pardoux É, Boturyn D, Roupioz Y. Antimicrobial Peptides as Probes in Biosensors Detecting Whole Bacteria: A Review. Molecules. 2020; 25(8):1998. https://doi.org/10.3390/molecules25081998
Chicago/Turabian StylePardoux, Éric, Didier Boturyn, and Yoann Roupioz. 2020. "Antimicrobial Peptides as Probes in Biosensors Detecting Whole Bacteria: A Review" Molecules 25, no. 8: 1998. https://doi.org/10.3390/molecules25081998
APA StylePardoux, É., Boturyn, D., & Roupioz, Y. (2020). Antimicrobial Peptides as Probes in Biosensors Detecting Whole Bacteria: A Review. Molecules, 25(8), 1998. https://doi.org/10.3390/molecules25081998

