Semi-Quantitative Mass Spectrometry in AML Cells Identifies New Non-Genomic Targets of the EZH2 Methyltransferase
Abstract
:1. Introduction
2. Results
2.1. The EZH2 Interactome in HL-60 Cells
2.2. Changes in the EZH2 Interactome in Response to AtRA
2.3. Identification of Enzymatic Targets of EZH2
3. Discussion
4. Methods
4.1. Cell Culture and AtRA Treatment
4.2. Affinity-Purification and Sample Preparation for Mass Spectrometry
4.3. LC-MS/MS
4.4. Database Searching
4.5. Data Analysis
5. Conclusions
Supplementary Materials
Acknowledgments
Author Contributions
Conflicts of Interest
References
- Pollyea, D.A.; Kohrt, H.E.; Medeiros, B.C. Acute myeloid leukaemia in the elderly: A review. Br. J. Haematol. 2011, 152, 524–542. [Google Scholar] [CrossRef] [PubMed]
- O’Donnell, M.R.; Tallman, M.S.; Abboud, C.N.; Altman, J.K.; Appelbaum, F.R.; Arber, D.A.; Attar, E.; Borate, U.; Coutre, S.E.; Damon, L.E.; et al. Acute myeloid leukemia, version 2.2013. J. Natl. Compr. Cancer Netw. 2013, 11, 1047–1055. [Google Scholar] [CrossRef]
- Rubnitz, J.E. How I treat pediatric acute myeloid leukemia. Blood 2012, 119, 5980–5988. [Google Scholar] [CrossRef] [PubMed]
- Conway O’Brien, E.; Prideaux, S.; Chevassut, T. The epigenetic landscape of acute myeloid leukemia. Adv. Hematol. 2014, 2014, 103175. [Google Scholar] [CrossRef] [PubMed]
- Dohner, H.; Weisdorf, D.J.; Bloomfield, C.D. Acute Myeloid Leukemia. N. Engl. J. Med. 2015, 373, 1136–1152. [Google Scholar] [CrossRef] [PubMed]
- Ferrara, F.; Schiffer, C.A. Acute myeloid leukaemia in adults. Lancet 2013, 381, 484–495. [Google Scholar] [CrossRef]
- Leopold, L.H.; Willemze, R. The treatment of acute myeloid leukemia in first relapse: A comprehensive review of the literature. Leuk. Lymphoma 2002, 43, 1715–1727. [Google Scholar] [CrossRef] [PubMed]
- Greenberg, P.L.; Lee, S.J.; Advani, R.; Tallman, M.S.; Sikic, B.I.; Letendre, L.; Dugan, K.; Lum, B.; Chin, D.L.; Dewald, G.; et al. Mitoxantrone, etoposide, and cytarabine with or without valspodar in patients with relapsed or refractory acute myeloid leukemia and high-risk myelodysplastic syndrome: A phase III trial (E2995). J. Clin. Oncol. 2004, 22, 1078–1086. [Google Scholar] [CrossRef] [PubMed]
- Vogelstein, B.; Papadopoulos, N.; Velculescu, V.E.; Zhou, S.; Diaz, L.A., Jr.; Kinzler, K.W. Cancer genome landscapes. Science 2013, 339, 1546–1558. [Google Scholar] [CrossRef] [PubMed]
- Yang, W.; Ernst, P. SET/MLL family proteins in hematopoiesis and leukemia. Int. J. Hematol. 2017, 105, 7–16. [Google Scholar] [CrossRef] [PubMed]
- Ley, T.J.; Ding, L.; Walter, M.J.; McLellan, M.D.; Lamprecht, T.; Larson, D.E.; Kandoth, C.; Payton, J.E.; Baty, J.; Welch, J.; et al. DNMT3A mutations in acute myeloid leukemia. N. Engl. J. Med. 2010, 363, 2424–2433. [Google Scholar] [CrossRef] [PubMed]
- Harris, W.J.; Huang, X.; Lynch, J.T.; Spencer, G.J.; Hitchin, J.R.; Li, Y.; Ciceri, F.; Blaser, J.G.; Greystoke, B.F.; Jordan, A.M.; et al. The histone demethylase KDM1A sustains the oncogenic potential of MLL-AF9 leukemia stem cells. Cancer Cell 2012, 21, 473–487. [Google Scholar] [CrossRef] [PubMed]
- Lynch, J.T.; Harris, W.J.; Somervaille, T.C. LSD1 inhibition: A therapeutic strategy in cancer? Expert Opin. Ther. Targets 2012, 16, 1239–1249. [Google Scholar] [CrossRef] [PubMed]
- Schenk, T.; Chen, W.C.; Gollner, S.; Howell, L.; Jin, L.; Hebestreit, K.; Klein, H.U.; Popescu, A.C.; Burnett, A.; Mills, K.; et al. Inhibition of the LSD1 (KDM1A) demethylase reactivates the all-trans-retinoic acid differentiation pathway in acute myeloid leukemia. Nat. Med. 2012, 18, 605–611. [Google Scholar] [CrossRef] [PubMed]
- Gil, V.S.; Bhagat, G.; Howell, L.; Zhang, J.; Kim, C.H.; Stengel, S.; Vega, F.; Zelent, A.; Petrie, K. Deregulated expression of HDAC9 in B cells promotes development of lymphoproliferative disease and lymphoma in mice. Dis. Models Mech. 2016, 9, 1483–1495. [Google Scholar] [CrossRef] [PubMed]
- Suzuki, K.; Okuno, Y.; Kawashima, N.; Muramatsu, H.; Okuno, T.; Wang, X.; Kataoka, S.; Sekiya, Y.; Hamada, M.; Murakami, N.; et al. MEF2D-BCL9 Fusion Gene Is Associated With High-Risk Acute B-Cell Precursor Lymphoblastic Leukemia in Adolescents. J. Clin. Oncol. 2016, 34, 3451–3459. [Google Scholar] [CrossRef] [PubMed]
- Sahasrabuddhe, A.A. BMI1: A Biomarker of Hematologic Malignancies. Biomark. Cancer 2016, 8, 65–75. [Google Scholar] [CrossRef] [PubMed]
- Kim, K.H.; Roberts, C.W. Targeting EZH2 in cancer. Nat. Med. 2016, 22, 128–134. [Google Scholar] [CrossRef] [PubMed]
- Morin, R.D.; Johnson, N.A.; Severson, T.M.; Mungall, A.J.; An, J.; Goya, R.; Paul, J.E.; Boyle, M.; Woolcock, B.W.; Kuchenbauer, F.; et al. Somatic mutations altering EZH2 (Tyr641) in follicular and diffuse large B-cell lymphomas of germinal-center origin. Nat. Genet. 2010, 42, 181–185. [Google Scholar] [CrossRef] [PubMed]
- McCabe, M.T.; Graves, A.P.; Ganji, G.; Diaz, E.; Halsey, W.S.; Jiang, Y.; Smitheman, K.N.; Ott, H.M.; Pappalardi, M.B.; Allen, K.E.; et al. Mutation of A677 in histone methyltransferase EZH2 in human B-cell lymphoma promotes hypertrimethylation of histone H3 on lysine 27 (H3K27). Proc. Natl. Acad. Sci. USA 2012, 109, 2989–2994. [Google Scholar] [CrossRef] [PubMed]
- Bodor, C.; O’Riain, C.; Wrench, D.; Matthews, J.; Iyengar, S.; Tayyib, H.; Calaminici, M.; Clear, A.; Iqbal, S.; Quentmeier, H.; et al. EZH2 Y641 mutations in follicular lymphoma. Leukemia 2011, 25, 726–729. [Google Scholar] [CrossRef] [PubMed]
- Nikoloski, G.; Langemeijer, S.M.; Kuiper, R.P.; Knops, R.; Massop, M.; Tonnissen, E.R.; van der Heijden, A.; Scheele, T.N.; Vandenberghe, P.; de Witte, T.; et al. Somatic mutations of the histone methyltransferase gene EZH2 in myelodysplastic syndromes. Nat. Genet. 2010, 42, 665–667. [Google Scholar] [CrossRef] [PubMed]
- Ernst, T.; Chase, A.J.; Score, J.; Hidalgo-Curtis, C.E.; Bryant, C.; Jones, A.V.; Waghorn, K.; Zoi, K.; Ross, F.M.; Reiter, A.; et al. Inactivating mutations of the histone methyltransferase gene EZH2 in myeloid disorders. Nat. Genet. 2010, 42, 722–726. [Google Scholar] [CrossRef] [PubMed]
- Makishima, H.; Jankowska, A.M.; Tiu, R.V.; Szpurka, H.; Sugimoto, Y.; Hu, Z.; Saunthararajah, Y.; Guinta, K.; Keddache, M.A.; Putnam, P.; et al. Novel homo- and hemizygous mutations in EZH2 in myeloid malignancies. Leukemia 2010, 24, 1799–1804. [Google Scholar] [CrossRef] [PubMed]
- Ernst, P.; Fisher, J.K.; Avery, W.; Wade, S.; Foy, D.; Korsmeyer, S.J. Definitive hematopoiesis requires the mixed-lineage leukemia gene. Dev. Cell 2004, 6, 437–443. [Google Scholar] [CrossRef]
- Grimwade, D.; Hills, R.K.; Moorman, A.V.; Walker, H.; Chatters, S.; Goldstone, A.H.; Wheatley, K.; Harrison, C.J.; Burnett, A.K.; National Cancer Research Institute Adult Leukaemia Working Group. Refinement of cytogenetic classification in acute myeloid leukemia: Determination of prognostic significance of rare recurring chromosomal abnormalities among 5876 younger adult patients treated in the United Kingdom Medical Research Council trials. Blood 2010, 116, 354–365. [Google Scholar] [PubMed]
- Thiel, A.T.; Feng, Z.; Pant, D.K.; Chodosh, L.A.; Hua, X. The trithorax protein partner menin acts in tandem with EZH2 to suppress C/EBPα and differentiation in MLL-AF9 leukemia. Haematologica 2013, 98, 918–927. [Google Scholar] [CrossRef] [PubMed]
- Tanaka, S.; Miyagi, S.; Sashida, G.; Chiba, T.; Yuan, J.; Mochizuki-Kashio, M.; Suzuki, Y.; Sugano, S.; Nakaseko, C.; Yokote, K.; et al. EZH2 augments leukemogenicity by reinforcing differentiation blockage in acute myeloid leukemia. Blood 2012, 120, 1107–1117. [Google Scholar] [CrossRef] [PubMed]
- Shi, J.; Wang, E.; Zuber, J.; Rappaport, A.; Taylor, M.; Johns, C.; Lowe, S.W.; Vakoc, C.R. The Polycomb complex PRC2 supports aberrant self-renewal in a mouse model of MLL-AF9;NrasG12D acute myeloid leukemia. Oncogene 2013, 32, 930–938. [Google Scholar] [CrossRef] [PubMed]
- Mills, A.A. Throwing the cancer switch: Reciprocal roles of polycomb and trithorax proteins. Nat. Rev. Cancer 2010, 10, 669–682. [Google Scholar] [CrossRef] [PubMed]
- Gupta, R.A.; Shah, N.; Wang, K.C.; Kim, J.; Horlings, H.M.; Wong, D.J.; Tsai, M.C.; Hung, T.; Argani, P.; Rinn, J.L.; et al. Long non-coding RNA HOTAIR reprograms chromatin state to promote cancer metastasis. Nature 2010, 464, 1071–1076. [Google Scholar] [CrossRef] [PubMed]
- Shi, B.; Liang, J.; Yang, X.; Wang, Y.; Zhao, Y.; Wu, H.; Sun, L.; Zhang, Y.; Chen, Y.; Li, R.; et al. Integration of estrogen and Wnt signaling circuits by the polycomb group protein EZH2 in breast cancer cells. Mol. Cell. Biol. 2007, 27, 5105–5119. [Google Scholar] [CrossRef] [PubMed]
- Lee, S.T.; Li, Z.; Wu, Z.; Aau, M.; Guan, P.; Karuturi, R.K.; Liou, Y.C.; Yu, Q. Context-specific regulation of NF-κB target gene expression by EZH2 in breast cancers. Mol. Cell 2011, 43, 798–810. [Google Scholar] [CrossRef] [PubMed]
- Xu, K.; Wu, Z.J.; Groner, A.C.; He, H.H.; Cai, C.; Lis, R.T.; Wu, X.; Stack, E.C.; Loda, M.; Liu, T.; et al. EZH2 oncogenic activity in castration-resistant prostate cancer cells is Polycomb-independent. Science 2012, 338, 1465–1469. [Google Scholar] [CrossRef] [PubMed]
- Kim, E.; Kim, M.; Woo, D.H.; Shin, Y.; Shin, J.; Chang, N.; Oh, Y.T.; Kim, H.; Rheey, J.; Nakano, I.; et al. Phosphorylation of EZH2 activates STAT3 signaling via STAT3 methylation and promotes tumorigenicity of glioblastoma stem-like cells. Cancer Cell 2013, 23, 839–852. [Google Scholar] [CrossRef] [PubMed]
- Dasgupta, M.; Dermawan, J.K.; Willard, B.; Stark, G.R. STAT3-driven transcription depends upon the dimethylation of K49 by EZH2. Proc. Natl. Acad. Sci. USA 2015, 112, 3985–3990. [Google Scholar] [CrossRef] [PubMed]
- He, A.; Shen, X.; Ma, Q.; Cao, J.; von Gise, A.; Zhou, P.; Wang, G.; Marquez, V.E.; Orkin, S.H.; Pu, W.T. PRC2 directly methylates GATA4 and represses its transcriptional activity. Genes Dev. 2012, 26, 37–42. [Google Scholar] [CrossRef] [PubMed]
- Lee, J.M.; Lee, J.S.; Kim, H.; Kim, K.; Park, H.; Kim, J.Y.; Lee, S.H.; Kim, I.S.; Kim, J.; Lee, M.; et al. EZH2 generates a methyl degron that is recognized by the DCAF1/DDB1/CUL4 E3 ubiquitin ligase complex. Mol. Cell 2012, 48, 572–586. [Google Scholar] [CrossRef] [PubMed]
- Gunawan, M.; Venkatesan, N.; Loh, J.T.; Wong, J.F.; Berger, H.; Neo, W.H.; Li, L.Y.; La Win, M.K.; Yau, Y.H.; Guo, T.; et al. The methyltransferase EZH2 controls cell adhesion and migration through direct methylation of the extranuclear regulatory protein talin. Nat. Immunol. 2015, 16, 505–516. [Google Scholar] [CrossRef] [PubMed]
- Breitman, T.R.; Selonick, S.E.; Collins, S.J. Induction of differentiation of the human promyelocytic leukemia cell line (HL-60) by retinoic acid. Proc. Natl. Acad. Sci. USA 1980, 77, 2936–2940. [Google Scholar] [CrossRef] [PubMed]
- Ma, K.; Vitek, O.; Nesvizhskii, A.I. A statistical model-building perspective to identification of MS/MS spectra with PeptideProphet. BMC Bioinform. 2012, 13 (Suppl. S16). [Google Scholar] [CrossRef] [PubMed]
- Mellacheruvu, D.; Wright, Z.; Couzens, A.L.; Lambert, J.P.; St-Denis, N.A.; Li, T.; Miteva, Y.V.; Hauri, S.; Sardiu, M.E.; Low, T.Y.; et al. The CRAPome: A contaminant repository for affinity purification-mass spectrometry data. Nat. Methods 2013, 10, 730–736. [Google Scholar] [CrossRef] [PubMed]
- Teo, G.; Liu, G.; Zhang, J.; Nesvizhskii, A.I.; Gingras, A.C.; Choi, H. SAINTexpress: Improvements and additional features in Significance Analysis of INTeractome software. J. Proteom. 2014, 100, 37–43. [Google Scholar] [CrossRef] [PubMed]
- Hauri, S.; Comoglio, F.; Seimiya, M.; Gerstung, M.; Glatter, T.; Hansen, K.; Aebersold, R.; Paro, R.; Gstaiger, M.; Beisel, C. A High-Density Map for Navigating the Human Polycomb Complexome. Cell Rep. 2016, 17, 583–595. [Google Scholar] [CrossRef] [PubMed]
- Morris, J.H.; Apeltsin, L.; Newman, A.M.; Baumbach, J.; Wittkop, T.; Su, G.; Bader, G.D.; Ferrin, T.E. clusterMaker: A multi-algorithm clustering plugin for Cytoscape. BMC Bioinform. 2011, 12, 436. [Google Scholar] [CrossRef] [PubMed]
- Bader, G.D.; Hogue, C.W. An automated method for finding molecular complexes in large protein interaction networks. BMC Bioinform. 2003, 4, 2. [Google Scholar] [CrossRef]
- Nepusz, T.; Yu, H.; Paccanaro, A. Detecting overlapping protein complexes in protein-protein interaction networks. Nat. Methods 2012, 9, 471–472. [Google Scholar] [CrossRef] [PubMed]
- Shannon, P.; Markiel, A.; Ozier, O.; Baliga, N.S.; Wang, J.T.; Ramage, D.; Amin, N.; Schwikowski, B.; Ideker, T. Cytoscape: A software environment for integrated models of biomolecular interaction networks. Genome Res. 2003, 13, 2498–2504. [Google Scholar] [CrossRef] [PubMed]
- Maere, S.; Heymans, K.; Kuiper, M. BiNGO: A Cytoscape plugin to assess overrepresentation of gene ontology categories in biological networks. Bioinformatics 2005, 21, 3448–3449. [Google Scholar] [CrossRef] [PubMed]
- Huang da, W.; Sherman, B.T.; Lempicki, R.A. Systematic and integrative analysis of large gene lists using DAVID bioinformatics resources. Nat. Protoc. 2009, 4, 44–57. [Google Scholar] [CrossRef] [PubMed]
- Szklarczyk, D.; Franceschini, A.; Wyder, S.; Forslund, K.; Heller, D.; Huerta-Cepas, J.; Simonovic, M.; Roth, A.; Santos, A.; Tsafou, K.P.; et al. STRING v10: Protein-protein interaction networks, integrated over the tree of life. Nucleic Acids Res. 2015, 43, D447–D452. [Google Scholar] [CrossRef] [PubMed]
- Wang, Y.; Arribas-Layton, M.; Chen, Y.; Lykke-Andersen, J.; Sen, G.L. DDX6 Orchestrates Mammalian Progenitor Function through the mRNA Degradation and Translation Pathways. Mol. Cell 2015, 60, 118–130. [Google Scholar] [CrossRef] [PubMed]
- Guo, A.; Gu, H.; Zhou, J.; Mulhern, D.; Wang, Y.; Lee, K.A.; Yang, V.; Aguiar, M.; Kornhauser, J.; Jia, X.; et al. Immunoaffinity enrichment and mass spectrometry analysis of protein methylation. Mol. Cell. Proteom. 2014, 13, 372–387. [Google Scholar] [CrossRef] [PubMed]
- Cao, X.J.; Arnaudo, A.M.; Garcia, B.A. Large-scale global identification of protein lysine methylation in vivo. Epigenetics 2013, 8, 477–485. [Google Scholar] [CrossRef] [PubMed]
- Polevoda, B.; Sherman, F. Methylation of proteins involved in translation. Mol. Microbiol. 2007, 65, 590–606. [Google Scholar] [CrossRef] [PubMed]
- Laugesen, A.; Hojfeldt, J.W.; Helin, K. Role of the Polycomb Repressive Complex 2 (PRC2) in Transcriptional Regulation and Cancer. Cold Spring Harb. Perspect. Med. 2016, 6. [Google Scholar] [CrossRef] [PubMed]
- McCabe, M.T.; Ott, H.M.; Ganji, G.; Korenchuk, S.; Thompson, C.; Van Aller, G.S.; Liu, Y.; Graves, A.P.; Della Pietra, A.; Diaz, E.; et al. EZH2 inhibition as a therapeutic strategy for lymphoma with EZH2-activating mutations. Nature 2012, 492, 108–112. [Google Scholar] [CrossRef] [PubMed]
- Knutson, S.K.; Wigle, T.J.; Warholic, N.M.; Sneeringer, C.J.; Allain, C.J.; Klaus, C.R.; Sacks, J.D.; Raimondi, A.; Majer, C.R.; Song, J.; et al. A selective inhibitor of EZH2 blocks H3K27 methylation and kills mutant lymphoma cells. Nat. Chem. Biol. 2012, 8, 890–896. [Google Scholar] [CrossRef] [PubMed]
- Knutson, S.K.; Warholic, N.M.; Wigle, T.J.; Klaus, C.R.; Allain, C.J.; Raimondi, A.; Porter Scott, M.; Chesworth, R.; Moyer, M.P.; Copeland, R.A.; et al. Durable tumor regression in genetically altered malignant rhabdoid tumors by inhibition of methyltransferase EZH2. Proc. Natl. Acad. Sci. USA 2013, 110, 7922–7927. [Google Scholar] [CrossRef] [PubMed]
- Wee, Z.N.; Li, Z.; Lee, P.L.; Lee, S.T.; Lim, Y.P.; Yu, Q. EZH2-mediated inactivation of IFN-γ-JAK-STAT1 signaling is an effective therapeutic target in MYC-driven prostate cancer. Cell Rep. 2014, 8, 204–216. [Google Scholar] [CrossRef] [PubMed]
- Kim, W.; Bird, G.H.; Neff, T.; Guo, G.; Kerenyi, M.A.; Walensky, L.D.; Orkin, S.H. Targeted disruption of the EZH2-EED complex inhibits EZH2-dependent cancer. Nat. Chem. Biol. 2013, 9, 643–650. [Google Scholar] [CrossRef] [PubMed]
- Hamrita, B.; Nasr, H.B.; Hammann, P.; Kuhn, L.; Guillier, C.L.; Chaieb, A.; Khairi, H.; Chahed, K. An Elongation factor-like protein (EF-Tu) elicits a humoral response in infiltrating ductal breast carcinomas: An immunoproteomics investigation. Clin. Biochem. 2011, 44, 1097–1104. [Google Scholar] [CrossRef] [PubMed]
- Rehman, I.; Evans, C.A.; Glen, A.; Cross, S.S.; Eaton, C.L.; Down, J.; Pesce, G.; Phillips, J.T.; Yen, O.S.; Thalmann, G.N.; et al. iTRAQ identification of candidate serum biomarkers associated with metastatic progression of human prostate cancer. PLoS ONE 2012, 7, e30885. [Google Scholar] [CrossRef]
- Huang, Y.; Hu, J.D.; Qi, Y.L.; Wu, Y.A.; Zheng, J.; Chen, Y.Y.; Huang, X.L. Effect of knocking down eEF1A1 gene on proliferation and apoptosis in Jurkat cells and its mechanisms. Zhongguo Shi Yan Xue Ye Xue Za Zhi 2012, 20, 835–841. [Google Scholar] [PubMed]
- Bhat, M.; Robichaud, N.; Hulea, L.; Sonenberg, N.; Pelletier, J.; Topisirovic, I. Targeting the translation machinery in cancer. Nat. Rev. Drug Discov. 2015, 14, 261–278. [Google Scholar] [CrossRef] [PubMed]
- Keller, A.; Nesvizhskii, A.I.; Kolker, E.; Aebersold, R. Empirical statistical model to estimate the accuracy of peptide identifications made by MS/MS and database search. Anal. Chem. 2002, 74, 5383–5392. [Google Scholar] [CrossRef] [PubMed]
- Liu, H.; Sadygov, R.G.; Yates, J.R., III. A Model for Random Sampling and Estimation of Relative Protein Abundance in Shotgun Proteomics. Anal. Chem. 2004, 76, 4193–4201. [Google Scholar] [CrossRef] [PubMed]
- Morris, J.H.; Knudsen, G.M.; Verschueren, E.; Johnson, J.R.; Cimermancic, P.; Greninger, A.L.; Pico, A.R. Affinity purification-mass spectrometry and network analysis to understand protein-protein interactions. Nat. Protoc. 2014, 9, 2539–2554. [Google Scholar] [CrossRef] [PubMed]
- Pettersen, E.F.; Goddard, T.D.; Huang, C.C.; Couch, G.S.; Greenblatt, D.M.; Meng, E.C.; Ferrin, T.E. UCSF Chimera—A visualization system for exploratory research and analysis. J. Comput. Chem. 2004, 25, 1605–1612. [Google Scholar] [CrossRef] [PubMed]
GO Category | Description | FDR | Protein Name |
---|---|---|---|
GO.0006415 | Translational termination | 1.27 × 10−43 | RPL10, RPL10A, RPL11, RPL12, RPL13, RPL13A, RPL15, RPL17, RPL18, RPL18A, RPL23, RPL24, RPL27A, RPL3, RPL35, RPL37A, RPL4, RPL5, RPL6, RPL7, RPL8, RPL9, RPLP0, RPLP1, RPLP2, RPS10, RPS12, RPS13, RPS15, RPS19, RPS2, RPS24, RPS27A, RPS3A, RPS4X, RPS6, RPS8 |
GO.0006414 | Translational elongation | 4.54 × 10−42 | RPL10, RPL10A, RPL11, RPL12, RPL13, RPL13A, RPL15, RPL17, RPL18, RPL18A, RPL23, RPL24, RPL27A, RPL3, RPL35, RPL37A, RPL4, RPL5, RPL6, RPL7, RPL8, RPL9, RPLP0, RPLP1, RPLP2, RPS10, RPS12, RPS13, RPS15, RPS19, RPS2, RPS24, RPS27A, RPS3A, RPS4X, RPS6, RPS8 |
GO.0006413 | Translational initiation | 7.98 × 10−41 | PABPC1, RPL10, RPL10A, RPL11, RPL12, RPL13, RPL13A, RPL15, RPL17, RPL18, RPL18A, RPL23, RPL24, RPL27A, RPL3, RPL35, RPL37A, RPL4, RPL5, RPL6, RPL7, RPL8, RPL9, RPLP0, RPLP1, RPLP2, RPS10, RPS12, RPS13, RPS15, RPS19, RPS2, RPS24, RPS27A, RPS3A, RPS4X, RPS6, RPS8 |
GO.0010467 | Gene expression | 2.09 × 10−13 | AEBP2, AICDA, ALYREF, ANPEP, CBX3, DAPK3, DDX5, DMAP1, EED, EZH1, EZH2, FLII, FLNA, HNRNPF, HNRNPH1, HNRNPK, IGF2BP1, JARID2, LCOR, LRRFIP1, MTF2, NOLC1, NONO, PA2G4, PABPC1, PHF1, PHF19, RBBP4, RBBP7, RPL10, RPL12, RPL13, RPL17, RPL18, RPL18A, RPL24, RPL27A, RPL3, RPL35, RPL4, RPL5, RPL6, RPL7, RPL9, RPLP0, RPLP1, RPLP2, RPS10, RPS12, RPS13, RPS19, RPS2, RPS24, RPS27A, RPS3A, RPS6, RPS8, RRP1B, SFPQ, SND1, SRP14, SUZ12, U2AF2, YBX1 |
GO.0045892 | Negative regulation of transcription | 3.03 × 10−2 | AEBP2, CBX3, DDX5, DMAP1, FLNA, HNRNPK, LCOR, LRRFIP1, MTF2, NONO, PA2G4, PARP1, RBBP7, RPS27A, SFPQ, SUZ12, YBX1 |
GO Category | Description | FDR | Protein Name |
---|---|---|---|
GO.0003723 | RNA binding | 4.86 × 10−8 | ATP5A1, CCDC124, CORO1A, FLNA, HNRNPD, HNRNPF, ILF3, MSN, MTDH, PABPC1, PTBP1, RPSA, RRP1B |
Lys monomethylation | Protein Name | Peptide Sequence | Peptide Start Index | Peptide Stop Index | Variable Modifications Identified by Spectrum | Methylated Lys −AtRA | Methylated Lys +AtRA |
CBX3 | WKDSDEADLVLAK | 142 | 154 | K2: Methyl | 12.5% (1/8) | ND (0/0) | |
EZH2 | YSQADALKYVGIER | 728 | 741 | K8: Methyl | 1.5% (2/131) | 1.9% (2/106) | |
Histone H1.2 | KASGPPVSELITK | 34 | 46 | K1: Methyl | 2.1% (2/96) | 5% (1/20) | |
Histone H3.1 | KSAPATGGVKPHR | 28 | 41 | K10: Methyl | 0% (0/18) | 16.7% (1/6) | |
Histone H3.1 | EIAQDFKTDLR | 74 | 84 | K7: Methyl | 5.6% (1/18) | 0% (0/6) | |
MT1X | MDPNCSCSPVGSCAC-AGSCKCKECKCTSCK | 1 | 30 | K22: Methyl | 100% (1/1) | ND (0/0) | |
RL36L | KQSGYGGQTKPIFR | 44 | 57 | K10: Methyl | 33.3% (11/33) | 44.4% (8/18) | |
SUZ12 | APQKHGGGGGGGSGPSAGS-GGGGFGGSAAVAAATASGGK | 2 | 40 | K4: Methyl | 1.3% (2/154) | 0% (0/138) | |
Lys dimethylation | eEF1A1 | GSFKYAWVLDK | 52 | 62 | K4: Dimethyl | 11.9% (7/59) | 5.9% (1/17) |
eEF1A1 | MDSTEPPYSQKR | 155 | 166 | K11: Dimethyl | 0% (0/59) | 5.9% (1/17) | |
H3.1 | KSAPATGGVKKPHR | 28 | 41 | K1: Dimethyl | 5.6% (1/18) | 50% (3/6) | |
Histone H4 | KVLRDNIQGITKPAIR | 21 | 36 | K1: Dimethyl | 0% (0/86) | 4.3% (1/23) | |
MYO1D | SKDTCIVISGESGAGKTEASK | 93 | 113 | K2: Dimethyl | ND (0/0) | 100% (3/3) | |
RBP56 | GPMTGSSGGDRGGFK | 196 | 210 | K15: Dimethyl | 36.4% (8/22) | 0% (0/6) | |
TR150 | DSRPSQAAGDNQGDEAKEQ-TFSGGTSQDTK | 186 | 215 | K17: Dimethyl | 21.9% (7/32) | ND (0/0) | |
Lys trimethylation | ADT2 | QYKGIIDCVVR | 50 | 60 | K3: Trimethyl | 19.1% (4/21) | 7.7% (1/13) |
HNRPQ | GGNVGGKR | 558 | 565 | K7: Trimethyl | 25% (1/4) | 16.7% (1/6) | |
MT1X | MDPNCSCSPVGSCACAGSC-KCKECKCTSCK | 1 | 30 | K20: Trimethyl, K25: Trimethyl, K30: Trimethyl | 100% (1/1) | ND (0/0) | |
ALYREF | ADKMDMSLDDIIK | 2 | 14 | K3: Trimethyl | 0% (0/27) | 5.2% (1/19) |
Protein Name | Gene Symbol | Methylation Site | Protein Function |
---|---|---|---|
ADT2 (ADP/ATP Translocase 2) | SLC25A5 | K52me3 | ADP/ATP mitochondrial translocase |
CBX3 (Chromobox 3) | CBX3 | K142me1 | Heterochromatin binding |
eEF1A1 (Elongation factor 1-α1) | EEF1A1 | K55me2, K165me2 | Regulation of elongation |
EZH2 (Enhancer of zeste homology 2) | EZH2 | K735me1 | Protein lysine methyltransferase |
SUZ12 (Polycomb Repressive Complex 2 Subunit) | SUZ12 | K4me1 | Regulation of H3K27 methylation and gene expression |
ALYREF (Aly/REF Export Factor) | ALYREF | K4me3 | Chaperone of basic-region leucine zipper (bZIP) proteins |
© 2017 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
Share and Cite
Sbirkov, Y.; Kwok, C.; Bhamra, A.; Thompson, A.J.; Gil, V.; Zelent, A.; Petrie, K. Semi-Quantitative Mass Spectrometry in AML Cells Identifies New Non-Genomic Targets of the EZH2 Methyltransferase. Int. J. Mol. Sci. 2017, 18, 1440. https://doi.org/10.3390/ijms18071440
Sbirkov Y, Kwok C, Bhamra A, Thompson AJ, Gil V, Zelent A, Petrie K. Semi-Quantitative Mass Spectrometry in AML Cells Identifies New Non-Genomic Targets of the EZH2 Methyltransferase. International Journal of Molecular Sciences. 2017; 18(7):1440. https://doi.org/10.3390/ijms18071440
Chicago/Turabian StyleSbirkov, Yordan, Colin Kwok, Amandeep Bhamra, Andrew J. Thompson, Veronica Gil, Arthur Zelent, and Kevin Petrie. 2017. "Semi-Quantitative Mass Spectrometry in AML Cells Identifies New Non-Genomic Targets of the EZH2 Methyltransferase" International Journal of Molecular Sciences 18, no. 7: 1440. https://doi.org/10.3390/ijms18071440