Next Article in Journal
Glomerular Deposition of Nephritis-Associated Plasmin Receptor (NAPlr) and Related Plasmin Activity: Key Diagnostic Biomarkers of Bacterial Infection-related Glomerulonephritis
Next Article in Special Issue
New Determinants of Aminoglycoside Resistance and Their Association with the Class 1 Integron Gene Cassettes in Trueperella pyogenes
Previous Article in Journal
Changes of Resurgent Na+ Currents in the Nav1.4 Channel Resulting from an SCN4A Mutation Contributing to Sodium Channel Myotonia
Previous Article in Special Issue
Antimicrobial Resistance in Veterinary Medicine: An Overview
 
 
Search for Articles:
Title / Keyword
Author / Affiliation / Email
Journal
Article Type
 
 
Advanced Search
 
Section
Special Issue
Volume
Issue
Number
Page
 
Journals
IJMS
Volume 21
Issue 7
10.3390/ijms21072594
ijms-logo
Submit to this Journal Review for this Journal Propose a Special Issue
► Article Menu

Article Menu

share Share announcement Help format_quote Cite question_answer Discuss in SciProfiles thumb_up
...
Endorse textsms
...
Comment
first_page
settings
Order Article Reprints
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Antibiotic Susceptibility Profiles of Lactic Acid Bacteria from the Human Vagina and Genetic Basis of Acquired Resistances

by
Auttawit Sirichoat
1,2,
Ana Belén Flórez
1,3,
Lucía Vázquez
1,3,
Pranom Buppasiri
4,
Marutpong Panya
5,
Viraphong Lulitanond
2 and
Baltasar Mayo
1,3,*
1
Departamento de Microbiología y Bioquímica, Instituto de Productos Lácteos de Asturias (IPLA-CSIC), Paseo Río Linares, s/n, 33300 Villaviciosa, Asturias, Spain
2
Department of Microbiology and Research and Diagnostic Center for Emerging Infectious Diseases (RCEID), Faculty of Medicine, Khon Kaen University, Khon Kaen 40002, Thailand
3
Instituto de Investigación Sanitaria del Principado de Asturias (ISPA), Avenida de Roma s/n, 33011 Oviedo, Spain
4
Department of Obstetrics and Gynecology, Faculty of Medicine, Khon Kaen University, Khon Kaen 40002, Thailand
5
College of Medicine and Public Health, Ubon Ratchathani University, Ubon Ratchathani 34190, Thailand
*
Author to whom correspondence should be addressed.
Int. J. Mol. Sci. 2020, 21(7), 2594; https://doi.org/10.3390/ijms21072594
Submission received: 17 March 2020 / Revised: 1 April 2020 / Accepted: 7 April 2020 / Published: 8 April 2020
(This article belongs to the Special Issue Drug Resistance Mechanisms in Bacteria)
Browse Figures
Versions Notes

Abstract

:
Lactic acid bacteria can act as reservoirs of antibiotic resistance genes that can be ultimately transferred to pathogens. The present work reports on the minimum inhibitory concentration (MIC) of 16 antibiotics to 25 LAB isolates of five Lactobacillus and one Bifidobacterium species from the human vagina. Acquired resistances were detected to kanamycin, streptomycin, chloramphenicol, gentamicin, and ampicillin. A PCR analysis of lactobacilli failed to identify genetic determinants involved in any of these resistances. Surprisingly, a tet(W) gene was detected by PCR in two Bifidobacterium bifidum strains, although they proved to be tetracycline-susceptible. In agreement with the PCR results, no acquired genes were identified in the genome of any of the Lactobacillus spp. strains sequenced. A genome analysis of B. bifidum VA07-1AN showed an insertion of two guanines in the middle of tet(W) interrupting the open reading frame. By growing the strain in the presence of tetracycline, stable tetracycline-resistant variants were obtained. An amino acid substitution in the ribosomal protein S12 (K43R) was further identified as the most likely cause of VA07-1AN being streptomycin resistance. The results of this work expand our knowledge of the resistance profiles of vaginal LAB and provide evidence for the genetic basis of some acquired resistances.

Graphical Abstract

1. Introduction

The extensive use of antibiotics has led to the emergence, evolution and spread of antibiotic resistance (AR) in pathogenic and non-pathogenic bacteria associated with humans, animals and the environment [1]. The rapid spread of AR among pathogens coupled with the lack of new antibiotics is a major global health concern [2]. The selective pressure imposed by the presence of antibiotics in the environment has driven the spread of AR by horizontal gene transfer (HGT) events [3]. The antibiotics used to treat infections in humans are commonly the same as those used in veterinary medicine, which has resulted in the rapid dissemination of AR genes among bacteria associated with the food chain [4].
Lactic acid bacteria (LAB) form part of the indigenous microbiota of food, but also that of human and animal mucosa. Many LAB strains are used as starter and adjunct cultures to control food fermentations, while others are employed as probiotics for the prevention and treatment of intestinal diseases [5]. Although phylogenetically unrelated, bifidobacteria, which are found in the same ecological niches as LAB and are used for the same applications, have—for practical reasons—traditionally been included among the true LAB [5]. The European Food Safety Authority (EFSA) has awarded most LAB species ‘Qualified Presumption of Safety (QPS)’ status [6], and they are ‘Generally Recognized as Safe (GRAS status)’ by the U.S. Food and Drug Administration (FDA) [7]. The only criterion that LAB strains have to fulfill to meet QPS requirements is the absence of AR genes against antimicrobials of clinical and veterinary importance [8]. Although LAB are non-pathogenic, they can act as reservoirs of AR genes which might eventually be transferred via HGT to pathogenic bacteria during food manufacture or after consumption [9].
Lactobacilli are among the most dominant populations in the vaginal ecosystem together with other LAB species (e.g., bifidobacteria) [10,11]. These bacteria exist in finely tuned mutualistic relationships with each other and with the host, providing the first line of defense against colonization and infection by pathogens [12]. Selected LAB strains could potentially be used as probiotics for preventing or treating vaginal infections [13]. In order to prevent the spread of AR in the vaginal ecosystem, any strain used as a probiotic must be free of acquired AR genes with transference capability. It is important to note that some LAB strains, including some from the human vagina, have already been reported to carry transferable AR genes [9,14,15,16,17].
The present work characterizes members of the vaginal microbiota of healthy Thai women as part of the search for probiotic candidate strains to be used in the vaginal ecosystem. Dominant LAB from vaginal exudates, all of which produced large amounts of lactic acid, were recovered in culture and identified by molecular methods. The antibiotic resistance/susceptibility profiles of 25 isolates belonging to different LAB species are here reported, along with information on the genetic basis of the acquired resistances encountered.

2. Results

2.1. Isolation, Identification and Typing of Vaginal LAB

Twenty-five vaginal LAB isolates with clear acidification halos on MRS agar supplemented with 0.5% CaCO3 were recovered. All were Gram-positive rods, catalase negative, and γ-hemolytic. They were subsequently identified at the species level by 16S rRNA gene sequencing and sequence comparison. Seven isolates were identified as belonging to Lactobacillus crispatus, six to Lactobacillus salivarius, four to Lactobacillus jensenii, four to Lactobacillus paracasei, two to Lactobacillus reuteri, and two to Bifidobacterium bifidum (Table 1). A fingerprinting analysis by combining the results of RAPD-PCR and rep-PCR techniques detected 21 different strains among the 25 isolates, distributed as follows: L. crispatus (six strains), L. salivarius (five), L. jensenii (three), L. paracasei (three), L. reuteri (two), and B. bifidum (two strains) (Supplementary Figure S1).

2.2. Antibiotic Susceptibility

Table 1 shows the MIC values of the 16 tested antibiotics for the 25 vaginal LAB isolates. All isolates were phenotypically susceptible to tetracycline, erythromycin, clindamycin, penicillin, quinupristin-dalfopristin, linezolid and rifampicin. The distribution of neomycin MICs covered more than nine 2-fold dilutions, ranging from ≤0.5 to 256 µg mL−1. Similarly, a wide distribution of MICs was observed for streptomycin (≤0.5 to >256 µg mL−1), ciprofloxacin (≤0.25 to 64 µg mL−1), and chloramphenicol (1 to 8 µg mL−1). The most common resistance phenotypes observed were those to trimethoprim (MIC 16 to ≥64 µg mL−1) and vancomycin (MIC ≥ 128 µg mL−1). Nine isolates were resistant to kanamycin (MIC values 32 to >1024 µg mL−1). The two B. bifidum strains were susceptible to all tested antibiotics except for streptomycin (MIC >256 µg mL−1). Moderate resistance to chloramphenicol was seen in three isolates and for ampicillin in one isolate. Interestingly, L. salivarius VA40-10 was highly resistant to all four aminoglycosides tested (gentamicin, kanamycin, streptomycin, and neomycin).

2.3. Detection of AR Genes by PCR

The presence of genes coding for the commonest AR genes spread among LAB was investigated by PCR. No genes involved in resistance to chloramphenicol (cat), β-lactams (bla), aminoglycosides [aac(6′)-aph(2″) and aad(E)], macrolides [erm(A), erm(B), erm(C), erm(F), mef(A)], tetracycline [tet(M), tet(O), tet(S), tet(K), tet(L)], clindamycin (lsaA) or vancomycin (vanA) were ever detected in any of the isolates (data now shown). In contrast, a PCR analysis for genes encoding ribosomal protection proteins (RPP) causing tetracycline resistance using the degenerate primer pairs DI-DII and Tet1-Tet2 (Supplementary Table S1) produced a positive amplification when DNA from two tetracycline-susceptible B. bifidum isolates was used as a template (Figure 1A). Amplification with gene-specific primers gave a positive result only for the tet(W) gene (Figure 1B). Amplicon sequencing and sequence comparison further proved the presence in these isolates of a tet(W) gene highly homologous to those present in many Gram-positive and Gram-negative bacteria.

2.4. Genome Analysis for AR Genes

Based on the phenotype and genotype results (Table 1; Supplementary Figure S1), six strains were subjected to genome sequencing: L. crispatus VA50-4AN (resistant to kanamycin, ampicillin, and trimethoprim), L. jensenii VA04-2AN (resistant to trimethoprim), L. salivarius VA40-10 (resistant to gentamicin, kanamycin, streptomycin, neomycin, and vancomycin), L. paracasei VA02-1AN (resistant to chloramphenicol and vancomycin), L. reuteri VA24-5 (resistant to vancomycin and trimethoprim), and B. bifidum VA07-1AN (resistant to streptomycin). Supplementary Table S2 shows the general features of their genomes. Their size was, in all cases, around 2.2 Mbp but the number of contigs obtained after assembly ranged from 17 to 300. Supplementary Table S3 summarizes some of the key genetic features of the genomes of the sequenced strains. Genes coding for penicillin binding proteins (PBP) were found in all the genomes, although with different numbers and types for the distinct species. Mutations in PBPs encoding-genes known to confer AR were not identified. One gene coding for a D-alanine-D-alanine ligase (Ddl) was detected in each of the strains. In several LAB species, the presence of phenylalanine at the enzyme active site in Ddl is correlated with intrinsic resistance to vancomycin [18]. In addition, in each of the strains, 9-32 genes were classified by the RAST server as belonging to the category “Virulence, Disease, and Defence”, subcategory “Resistance to Antibiotic and Toxic Compounds”. The majority of these genes encoded components dedicated to homeostasis or resistance to heavy metals, such as copper, mercury, and the cobalt-zinc-cadmium triad. Genes encoding elongation factors, efflux pumps, DNA gyrases, and topoisomerases were also included by RAST in this subcategory.
By comparing the genome sequences against the databases CARD, ResFinder, and ARG-ANNOT, no genes known to be involved in AR in L. jensenii VA04-2AN (resistant to trimethoprim), L. paracasei VA02-1AN (resistant to chloramphenicol and vancomycin), and L. reuteri VA24-5 (resistant to trimethoprim and vancomycin) were detected. The only positive correlation between phenotype and genotype was the presence of a conserved phenylalanine (F) residue in the active site of the Ddl ligase, corresponding to amino acid 261 of the Leuconostoc mesenteroides enzyme [18], in the deduced sequence of all vancomycin-resistant (Vmr) strains, while the susceptible (Vms) strains were characterized by the presence of a tyrosine (Y) residue at this position (Figure 2).
Genome analysis of L. crispatus VA50-4AN, L. salivarius VA40-10, and B. bifidum VA07-1AN identified no genes known to be involved in aminoglycoside resistance. Therefore, mutations in key genes, such as those coding for the ribosomal S12 protein and others acting on the 16S rRNA molecule, were therefore sought by comparing the DNA and deduced protein sequences from our strains with those in databases. No amino acid differences were observed in the sequences of the ribosomal protein S12 for L. crispatus VA50-4AN and L. salivarius VA40-10 from those belonging to susceptible strains of the same species. Further, alignment of the deduced amino acid sequences for the 16S rRNA guanine(527)-N(7)-methyltranferase (RsmG) proteins of the sequenced strains, showed heterogeneity at several positions between themselves and with respect to sequences in databases. In particular, the RsmG sequence of L. crispatus VA50-4AN showed one amino acid change at position 38 (N→H), while that of B. bifidum VA07-1AN showed three amino acid changes at positions 105 (E→A), 150 (G→D), and 206 (R→G), and that of L. salivarius VA40-10 showed six exclusive amino acid changes at positions 12 (G→E), 67 (D→N), 186 (N→D), 199 (I→V), 208 (Q→K), and 209 (V→I). However, by comparing RsmG sequences from resistant and susceptible strains, none of the changes considered could be associated with streptomycin resistance.
As expected, the genome analysis confirmed the presence of tet(W) in B. bifidum VA07-1AN; this gene was also unequivocally identified by searches in the three AR databases used. The tet(W) gene in B. bifidum VA07-1AN was located in a contig of 76,748 bp. Figure 3 shows the genetic organization of the 40-kbp left extreme of the contig that included the tet(W) gene. The tet(W) sequence of VA07-1AN (1922 bp) was almost identical to that described for Bifidobacterium longum LTBL16 (CP034089.1). Similar tet(W) sequences have also been found in the chromosome of strains belonging to other species such as B. bifidum L22 (NG_048301.1), Lachnospiraceae bacterium KGMB03038 (CP041667.1), and Ruminococcus sp. JE7A12 (CP039381.1); and in plasmids, such as pTZC1 from Cutibacterium acnes TP-CU389 (LC473083.1). Compared to tet(W) in B. longum LTBL16, the tet(W) in B. bifidum VA07-1AN contained an insertion of two extra guanine residues (GG) after nucleotide 731 in the ORF resulting in a frameshift, which produced only a short peptide—289 amino acids long compared to 639 residues for the functional Tet(W). This likely explains the susceptibility of VA07-1AN to tetracycline. The tet(W) gene was flanked by ORFs coding for proteins showing the greatest homology to others from B. longum in the upstream region, and proteins typical of B. bifidum in the downstream region (Supplementary Table S4).
The CARD database further identified in the genome of B. bifidum VA07-1AN a single nucleotide polymorphism (SNP) point mutation in the rpsL gene (encoding the ribosomal S12 protein), a variation causing an amino acid substitution (K→R) at position 43 of the protein (Figure 4). This amino acid change has been associated with streptomycin resistance in many species [19].

2.5. Restoration of the Tetracycline Resistance Phenotype in B. Bifidum VA07-1AN

When the susceptibility of B. bifidum VA07-1AN to tetracycline was assayed using the MICE test, colonies growing within the inhibition halo were noted. Identification and typing showed them to be tetracycline-resistant variants of VA07-1AN. After plating on antibiotic-containing and antibiotic-free plates, about 0.6% of the colonies from an overnight culture were found to be tetracycline-resistant. Amplification and sequencing of tet(W) genes from 13 tetracycline-resistant variants showed the addition of one guanine nucleotide in most revertants to the guanine stretch where the two Gs disrupting the ORF had been inserted (as in R-1; Figure 5). Other mutations consisting in both nucleotide insertions and deletions in the vicinity of the stretch of Gs were occasionally seen (as in R-11; Figure 5). In either case, there was a net gain of one nucleotide, which, together with the two Gs that disrupted the tet(W) ORF, created a new codon that opened the reading frame of Tet(W) producing a functional protein that provided tetracycline resistance. The MIC of tetracycline in the tetracycline-resistant variants ranged from 48 to 96 μg mL−1. In contrast, growing the antibiotic-resistant variants in the absence of tetracycline for about 80-100 generations showed no tetracycline-susceptible revertants, demonstrating a high stability of the mutations that restored the resistant phenotype.

3. Discussion

LAB contribute to the maintenance of vaginal health via the production of substances (mainly organic acids) that acidify the environment and inhibit the development of pathogens [13]. However, there is an increasing concern that LAB may act as reservoirs of AR determinants, from which they could ultimately be transferred to pathogens [3,20]. Indeed, the existence of lactobacilli and bifidobacteria strains resistant to several antibiotics, by either acquiring mutations or exogenous genes, has been repeatedly reported [21,22,23,24,25]. Therefore, during the selection of probiotics, the susceptibility of lactobacilli and bifidobacteria to antibiotics has to be assessed and the absence in the selected strains of transferable AR genes should be assured [26].
Studies reporting lactobacilli and bifidobacteria to be generally susceptible to tetracycline, erythromycin, chloramphenicol, penicillin, ampicillin, clindamycin, quinupristin-dalfopristin, linezolid and rifampicin have been published over the last 15 years [24,27,28]. In agreement, the phenotypic analysis of the present isolates showed them to be susceptible to these antibiotics, with the exception of ampicillin and chloramphenicol—to which one and three isolates, respectively, were associated with MIC values higher than EFSA’s cut-offs [8]. In contrast, nine isolates showed resistance to one or more aminoglycosides (gentamicin, kanamycin, streptomycin, and neomycin). Resistance to aminoglycosides may occur based on several mechanisms, which include (i) enzymatic modification and inactivation of the antibiotics mediated by aminoglycoside acetyltransferases, nucleotidyltransferases, or phosphotransferases, (ii) increased efflux, (iii) decreased permeability, and (iv) modifications of the 30S ribosomal subunit interfering with the binding of this class of antibiotics [29]. However, most of the MIC values recorded in this study were just one dilution higher than the corresponding cut-off. These small MIC differences might be explained by the normal variation associated with the microdilution assay [30]. Accordingly, none of the aminoglycoside resistance genes searched for by PCR, including the widespread aac(6′)-aph(2″) and aad(E) genes [31], were found in any of the isolates. The genome analysis further discarded the presence of acquired resistances in the sequenced strains, comprising genes and well-characterized mutations involved in aminoglycoside resistance. Given the lack of cytochrome-mediated drug transport, aminoglycoside resistance has been claimed an intrinsic feature of LAB and other anaerobic bacteria [32]. However, large differences in the MIC values for aminoglycosides even in strains from the same species have been reported in the literature [24,27,28]. The cooperation of other non-specific mechanisms, such as increased membrane impermeability, enhanced activity of unspecific efflux pumps and multi-drug transporters, or presence of defective cell wall autolytic systems, may further account for differences in MICs between different species and strains [33].
Resistance to the aminoglycoside streptomycin has largely been associated with mutations in chromosomal genes, for example, in rpsL that codes for the ribosomal protein S12 [34], or in rsmG that codes for the 16S rRNA guanine(527)-N(7)-methyltranferase (RsmG) [35]. Comparison of the deduced proteins from streptomycin-susceptible and -resistant strains of the different lactobacilli species analyzed revealed random differences between the RsmG sequences. However, none of them could be consistently associated with streptomycin resistance. In contrast, a mutation in rpsL causing an amino acid change at position 43 (K→R) was observed in B. bifidum VA07-1AN. The same amino acid replacement has been reported in other streptomycin-resistant strains of bifidobacteria [36] and many other species [19], suggesting this to be the most likely explanation for the high resistance to streptomycin shown by VA07-1AN.
Strong resistance to vancomycin is an intrinsic feature in certain Lactobacillus phylogroups and other LAB species such as Leuconostoc spp. [37] caused by an amino acid replacement in the active site of the DdlA ligase (F261Y), as it has been experimentally demonstrated for Leuconostoc mesenteroides [18] and L. reuteri [38].
Although cut-offs for trimethoprim and ciprofloxacin in LAB and bifidobacteria have yet to be defined, strains of most of the present species were associated with quite high MICs. In fact, the resistance of most Lactobacillus species to these antibiotics has been repeatedly reported [24,28]. Folate auxotrophy in lactobacilli is generally accepted as the intrinsic cause of resistance to trimethoprim [39]. Similarly, reduced affinity of DNA gyrase (GyrA) and topoisomerase IV (ParC) variants for ciprofloxacin and other fluoroquinolones seen in some LAB species has been determined responsible for their insensitivity to this class of antibiotics [40]. Further, the presence of active multidrug efflux systems could contribute to an increase in the MIC for ciprofloxacin in some strains [21]. Since no genes coding for β-lactamases have ever been detected in LAB, non-specific mechanisms, as already discussed for the aminoglycosides, might contribute to the increased MIC of ampicillin in L. crispatus VA50-4AN, as has been reported for L. reuteri [41].
The vaginal lactobacilli in the present study were very susceptible to tetracycline—even though many LAB strains are resistant to it [23,31]. Unexpectedly, PCR analysis detected the presence of tet(W) in the two tetracycline-susceptible B. bifidum strains. This gene has been found to be disseminated among gut-dwelling bacteria of different species from humans and animals [42]. The genome analysis of B. bifidum VA07-1AN showed the gene to contain an insertion of two Gs bases at its center, shifting the ORF and rendering a shorter non-functional peptide. The presence of silent tetracycline resistance genes in bifidobacteria has been reported elsewhere [43,44]. The reactivation of a silent tetracycline resistance phenotype has also been reported for Bifidobacterium animalis subsp. lactis Bb12 [44]. Silent AR genes could therefore represent a hazard, even more so when they can be easily reactivated and the restored gene remains stable afterwards. Therefore, the use of strains harboring such genes in food and feed systems should be avoided.

4. Materials and Methods

4.1. Sample Selection and Collection

This study was approved by the Khon Kaen Ethics Committee in Human Research (HE581191). Vaginal exudates were obtained from healthy women attending the gynecological outpatient clinic of the Srinagarind Hospital, Faculty of Medicine, Khon Kaen University, Thailand. To be included, subjects had to be 20–45 years old, not be pregnant, have regular menstruation, have no underlying diseases, have a healthy vagina (showing no clinical symptoms upon examination by a gynecologist), and not be taking antibiotics. The lateral, anterior, and posterior vaginal walls were swabbed with a sterile cotton-tipped applicator (performed by a gynecologist). Samples were then placed in a sterile container prepared with Amies transport medium (Oxoid, Basingstoke, UK) and kept on ice until delivery to the laboratory.

4.2. Isolation of Lactic Acid Bacteria (LAB)

The collected samples were serially diluted with de Man, Rogosa and Sharpe (MRS) broth (Oxoid) and plated on MRS agar plates containing 0.5% (w/v) CaCO3 (BDH, Poole, UK). These were then incubated under aerobic and anaerobic conditions at 37 °C for 48 h. For anaerobic incubations, liquid or solid MRS medium was supplemented with 0.3 g L−1 L-cysteine-HCl (Merck, Darmstadt, Germany) giving rise to MRS-Cys. After incubation, individual colonies surrounded by clear acidification halos were randomly selected, purified on MRS agar with or without cysteine (depending on their aerobic or anaerobic isolation), and examined according to colony morphology, Gram staining, catalase reaction, and hemolytic activity using sheep blood agar plates (Oxoid). Catalase negative, γ-hemolytic, Gram-positive rods were deemed to be LAB and were stored at −80 °C in MRS broth supplemented with 15% (v/v) glycerol (Merck).

4.3. Identification of Bacteria by 16S rRNA Gene Sequencing

Total genomic DNA from isolates was purified from overnight cultures using the GenElute™ Bacterial Genomic DNA kit (Sigma-Aldrich, St. Louis, MO., USA) following the supplier’s recommendations. Purified genomic DNA was used as a template to amplify a large part of the 16S rRNA gene using the universal primers pair 27F (5′-AGAGTTTGATCCTGGCTCAG-3′) and 1492R (5′-GGTTACCTTGTTACGACTT-3′). The PCR conditions were as follows: one cycle at 95 °C for 5 min, 35 cycles at 94 °C for 30 s, 55 °C for 45 s, and 72 °C for 2 min, and a final extension cycle at 72 °C for 10 min. Amplicons were purified using GenElute™ PCR Clean-Up columns (Sigma-Aldrich) and sequenced. Sequences were compared against those in the NCBI database using the Blast program (https://blast.ncbi.nlm.gov/Blast.cgi), and against those in the Ribosomal Database Project database (https://rdp.cme.msu.edu/). Sequences sharing a percentage identity ≥97% to those in databases were considered to belong to the same species.

4.4. Molecular PCR Fingerprinting

Isolates were genetically typed by random amplification of polymorphic DNA-PCR (RAPD-PCR) with primer M13 (5′-GAGGGTGGCGGTTCT-3′) as reported by Rossetti and Giraffa [45] and primer OPA18 (5′-AGGTGACCGT-3′) as reported by Mättö et al. [46], and by repetitive element palindromic PCR (rep-PCR) using primer BoxA2R (5′-ACGTGGTTTGAAGAGATTTTCG-3′), as reported by Koeuth et al. [47]. The PCR reaction mixtures contained 2 µL of each purified genomic DNA (≈100 ng), 12.5 µL of Taq DNA Polymerase 2x Master Mix RED (Ampliqon, Odense, Denmark), 5 µL of primer (10 µM), and molecular biology grade water (Sigma-Aldrich) in a total volume of 25 µL. The PCR conditions were: one cycle at 95 °C for 7 min, 40 cycles at 95 °C for 30 s, annealing for 30 s at 42 °C for primer M13, 40 °C for primer BoxA2R, or 32 °C for primer OPA18, 72 °C for 4 min, and a final extension cycle at 72 °C for 10 min. PCR profiles were visualized in 2.5% agarose gels after 90 min of electrophoresis at 75 V and photographed under UV light. The banding patterns were clustered using the unweighted pair group method with arithmetic mean (UPGMA), and their pattern similarity expressed via the simple matching (SM) coefficient using GeneTools software v.4.03 (SynGene, Cambridge, UK). The results of the triplicate typing analyses of the isolates by the RAPD-PCR and rep-PCR techniques were 94% reproducible. Consequently, profiles with ≥94% similarity were considered to be the same strain.

4.5. Antibiotic Susceptibility Testing

The minimum inhibitory concentration (MIC) of 16 antibiotics (Table 1) was determined by broth microdilution according to ISO IDF Standard 10932 [48] using VetMIC plates for LAB (SVA, Uppsala, Sweden). Briefly, individual colonies of the isolates were grown on LAB susceptibility test medium (LSM) [49] agar plates or LSM supplemented with cysteine, and then suspended in 2 mL of a 0.9% sterile saline solution to obtain a density corresponding to McFarland standard 1 (≈3 × 108 cfu mL−1). The suspension was further diluted 1000-fold in LSM, and then 100 µL of this suspension were placed in each well of the VetMIC plates. These were then incubated at 37 °C under anaerobic conditions and examined after 48 h incubation. MICs were defined as the concentration at which no visible growth was observed. For some antibiotics, the concentration range of the plates was insufficient to determine the actual MIC for some isolates; these were determined using broth microdilution of the required antibiotics according to the guidelines of the Clinical Laboratory Standards Institute [50], or using the MICE system (Oxoid) following the manufacturer’s recommendations. Resistant strains were distinguished from susceptible strains based on the cut-off values reported by the European Food Safety Authority [8].

4.6. PCR Detection and Identification of AR Genes

Tetracycline resistance genes coding for ribosomal protection proteins (RPPs) were searched for in all isolates by using the universal primers DI-DII [51] and Tet1-Tet2 [52] ( Supplementary Table S1). When a positive result was obtained, additional PCR assays were performed with gene-specific primer pairs for tet(M), tet(S), tet(O) [26], and tet(W) [53]. Isolates were also tested for the presence of genes coding for the tetracycline efflux pumps tet(K) and tet(L) [54]. AR genes providing resistance to erythromycin (erm(A), erm(B), erm(C) [55], erm(F) [56]), and mef(A) [57], chloramphenicol (cat) [58], β-lactam antibiotics (bla) [58], and aminoglycoside (aac(6′)-aph(2″) [59] and aad(E) [60]) were also searched for by standard PCR. The PCR conditions used in each case were those described by the corresponding authors (Supplementary Table 1). In addition, a specific primer pair was designed to amplify genes involved vancomycin (vanA) resistance (Supplementary Table S1). As positive controls, DNA from appropriate strains of our collection carrying well characterized AR genes was used as a template in the different amplification reactions together with that of the strains of this study. When detected, the amplified PCR products were purified and sequenced. Similarities with sequences held in databases were sought using the Blast program as above.

4.7. Genome Sequencing, Annotation, and Analysis

Independent genomic libraries of 0.5 kbp were constructed from the total DNA of six antibiotic resistant strains, and paired-end sequenced at Eurofins Genomics (Konstanz, Germany) using an Illumina HiSeq 1000 System sequencer. Quality-filtered reads were assembled in contigs using Spades software v.3.6.2. (http://cab.spbu.ru/software/spades/). Genomes were annotated using the RAST annotation system (http://rast.nmpdr.org/) and the NCBI Prokaryotic Genome Annotation Pipeline (http://www.ncbi.nlm.nih.gov/genome/annotation_prok/). DNA and deduced protein sequences of interest were examined individually for homology against non-redundant DNA and protein databases using the Blast program. The homology of DNA and proteins was further investigated by searching the antibiotic resistance databases CARD (http://arpcard.mcmaster.ca/), ResFinder (https://cge.cbs.dtu.dk/services/ResFinder/) and ARG-ANNOT (https://www.mediterranee-infection.com/acces-ressources/base-de-donnees/arg-annot-2/).

4.8. Stability of the Disrupted tet(W) Gene of B. Bifidum

To check the stability of the tetracycline-susceptible phenotype in B. bifidum VA07-1AN, the strain was grown overnight in MRS-Cys broth at 37 °C in anaerobiosis. Dilutions of the cultures were plated on MRS-Cys agar with and without tetracycline. Under the same culture conditions, tetracycline-resistant revertants with a repaired tet(W) gene were transferred in liquid MRS-Cys without antibiotic for 5 days (80–100 generations). Dilutions of the cultures were the plated in MRS-Cys agar and the colonies replicated in MRS-Cys plates with and without tetracycline.

4.9. GenBank Accession Numbers

Genome sequences were deposited in GenBank under BioProject PRJNA604908 with biosample accession numbers SAMN14087162, SAMN14087187, SAMN14087200, SAMN14087229, SAMN14087235, and SAMN14087237.

5. Conclusions

The present results reveal some vaginal LAB showing acquired resistance to several antibiotics. PCR amplification and genome analysis allowed us to uncover the genetic basis of most resistances. Some of these acquired resistances appear to be due to non-specific mechanisms (increased activity of efflux pumps, higher cell-wall impermeability) or to mutations in housekeeping genes, although an acquired AR gene, tet(W)—silent but still recoverable—was identified in one strain. This stresses the importance of checking both the phenotype and genotype of LAB when selecting candidates for probiotics.

Supplementary Materials

Supplementary materials can be found at https://www.mdpi.com/1422-0067/21/7/2594/s1.

Author Contributions

A.S. isolated the strains, performed experimental work, and drafted the manuscript. A.B.F. and L.V. contributed to antimicrobial testing and genome analysis. P.B. and M.P. contributed to planning the research and reviewed the drafts. V.L. and B.M. planned this study, provided financial and material resources, and edit and review the manuscript. All authors have read and agreed to the published version of the manuscript.

Funding

This study was supported by projects from the Royal Golden Jubilee (RGJ)-PhD Program Grant of the Thailand Research Fund (TRF), Thailand (Ref. PHD/0133/2558), and Asturias Principality, Spain (Ref. IDI/2018/000114).

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Hernando-Amado, S.; Coque, T.M.; Baquero, F.; Martínez, J.L. Defining and combating antibiotic resistance from One Health and Global Health perspectives. Nat. Microbiol. 2019, 4, 1432–1442. [Google Scholar] [CrossRef] [PubMed]
  2. WHO. Antimicrobial Resistance: Global Report on Surveillance. 2014. Available online: https://www.who.int/drugresistance/documents/surveillancereport/en/ (accessed on 6 December 2019).
  3. von Wintersdorff, C.J.; Penders, J.; van Niekerk, J.M.; Mills, N.D.; Majumder, S.; van Alphen, L.B.; Savelkoul, P.H.; Wolffs, P.F. Dissemination of antimicrobial resistance in microbial ecosystems through horizontal gene transfer. Front. Microbiol. 2016, 7, 173. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  4. EFSA. The European Union summary report on antimicrobial resistance in zoonotic and indicator bacteria from humans, animals and food in 2016. EFSA J. 2018, 16, e05182. [Google Scholar]
  5. Sáez-Lara, M.J.; Gómez-Llorente, C.; Plaza-Díaz, J.; Gil, A. The role of probiotic lactic acid bacteria and bifidobacteria in the prevention and treatment of inflammatory bowel disease and other related diseases: A systematic review of randomized human clinical trials. BioMed Res. Int. 2015. [Google Scholar] [CrossRef]
  6. EFSA. Update of the list of QPS-recommended biological agents intentionally added to food or feed as notified to EFSA 7: Suitability of taxonomic units notified to EFSA until September 2017. EFSA J. 2018, 16, e05131. [Google Scholar]
  7. FDA. Generally Recognized as Safe (GRAS). Notifications FDA. 2010. Available online: https://www.fda.gov/food/generally-recognized-safe-gras/microorganisms-microbial-derived-ingredients-used-food-partial-list (accessed on 1 October 2019).
  8. EFSA. Guidance on the characterisation of microorganisms used as feed additives or as production organisms. EFSA J. 2018, 16, e05206. [Google Scholar]
  9. Flórez, A.B.; Campedelli, I.; Delgado, S.; Alegría, A.; Salvetti, E.; Felis, G.E.; Mayo, B.; Torriani, S. Antibiotic susceptibility profiles of dairy Leuconostoc, analysis of the genetic basis of atypical resistances and transfer of genes in vitro and in a food matrix. PLoS ONE 2016, 11, e0145203. [Google Scholar]
  10. Martin, D.H. The microbiota of the vagina and its influence on women’s health and disease. Am. J. Med. Sci. 2012, 343, 2–9. [Google Scholar] [CrossRef] [Green Version]
  11. Sirichoat, A.; Buppasiri, P.; Engchanil, C.; Namwat, W.; Faksri, K.; Sankuntaw, N.; Pasomsub, E.; Chantratita, W.; Lulitanond, V. Characterization of vaginal microbiota in Thai women. PeerJ 2018, 6, e5977. [Google Scholar] [CrossRef]
  12. Smith, S.B.; Ravel, J. The vaginal microbiota, host defence and reproductive physiology. J. Physiol. 2017, 595, 451–463. [Google Scholar] [CrossRef] [Green Version]
  13. Tachedjian, G.; Aldunate, M.; Bradshaw, C.S.; Cone, R.A. The role of lactic acid production by probiotic Lactobacillus species in vaginal health. Res. Microbiol. 2017, 168, 782–792. [Google Scholar] [CrossRef] [PubMed]
  14. Nawaz, M.; Wang, J.; Zhou, A.; Ma, C.; Wu, X.; Moore, J.E.; Millar, B.C.; Xu, J. Characterization and transfer of antibiotic resistance in lactic acid bacteria from fermented food products. Curr. Microbiol. 2011, 62, 1081–1089. [Google Scholar] [CrossRef] [PubMed]
  15. Gad, G.F.; Abdel-Hamid, A.M.; Farag, Z.S. Antibiotic resistance in lactic acid bacteria isolated from some pharmaceutical and dairy products. Braz. J. Microbiol. 2014, 45, 25–33. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  16. Fraqueza, M.J. Antibiotic resistance of lactic acid bacteria isolated from dry-fermented sausages. Int. J. Food Microbiol. 2015, 212, 76–88. [Google Scholar] [CrossRef] [PubMed]
  17. Wong, A.; Ngu, D.Y.; Dan, L.A.; Ooi, A.; Lim, R.L. Detection of antibiotic resistance in probiotics of dietary supplements. Nutr. J. 2015, 14, 95. [Google Scholar] [CrossRef] [PubMed]
  18. Park, I.S.; Walsh, C.T. D-Alanyl-D-lactate and D-alanyl-D-alanine synthesis by D-alanyl-D-alanine ligase from vancomycin-resistant Leuconostoc mesenteroides. Effects of a phenylalanine 261 to tyrosine mutation. J. Biol. Chem. 1997, 272, 9210–9214. [Google Scholar] [CrossRef] [Green Version]
  19. Munita, J.M.; Arias, C.A. Mechanisms of antibiotic resistance. Microbiol. Spectr. 2016, 4, 1–37. [Google Scholar] [CrossRef] [Green Version]
  20. Berendonk, T.U.; Manaia, C.M.; Merlin, C.; Fatta-Kassinos, D.; Cytryn, E.; Walsh, F.; Bürgmann, H.; Sørum, H.; Norström, M.; Pons, M.N.; et al. Tackling antibiotic resistance: The environmental framework. Nat. Rev. Microbiol. 2015, 13, 310–317. [Google Scholar] [CrossRef]
  21. Ammor, M.S.; Flórez, A.B.; Mayo, B. Antibiotic resistance in non-enterococcal lactic acid bacteria and bifidobacteria. Food Microbiol. 2007, 24, 559–570. [Google Scholar] [CrossRef]
  22. Duranti, S.; Lugli, G.A.; Mancabelli, L.; Turroni, F.; Milani, C.; Mangifesta, M.; Ferrario, C.; Anzalone, R.; Viappiani, A.; van Sinderen, D.; et al. Prevalence of antibiotic resistance genes among human gut-derived bifidobacteria. Appl. Environ. Microbiol. 2017, 83, e02894-16. [Google Scholar] [CrossRef] [Green Version]
  23. Štšepetova, J.; Taelma, H.; Smidt, I.; Hutt, P.; Lapp, E.; Aotäht, E.; Mändar, R. Assessment of phenotypic and genotypic antibiotic susceptibility of vaginal Lactobacillus sp. J. Appl. Microbiol. 2017, 123, 524–534. [Google Scholar] [CrossRef] [PubMed]
  24. Campedelli, I.; Mathur, H.; Salvetti, E.; Clarke, S.; Rea, M.C.; Torriani, S.; Ross, R.P.; Hill, C.; O’Toole, P.W. Genus-wide assessment of antibiotic resistance in Lactobacillus spp. Appl. Environ. Microbiol. 2018, 85, e01738-18. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  25. Rozman, V.; Lorbeg, P.M.; Accetto, T.; Matijašić, B.B. Characterization of antimicrobial resistance in lactobacilli and bifidobacteria used as probiotics or starter cultures based on integration of phenotypic and in silico data. Int. J. Food. Microbiol. 2020, 314, 108388. [Google Scholar] [CrossRef] [PubMed]
  26. Salvetti, E.; O’Toole, P.W. When regulation challenges innovation: The case of the genus Lactobacillus. Trends Food Sci. Technol. 2017, 66, 187–194. [Google Scholar] [CrossRef]
  27. Delgado, S.; Flórez, A.B.; Mayo, B. Antibiotic susceptibility of Lactobacillus and Bifidobacterium species from the human gastrointestinal tract. Curr. Microbiol. 2005, 50, 202–207. [Google Scholar] [CrossRef] [PubMed]
  28. Abriouel, H.; Casado Munoz, M.D.C.; Lavilla Lerma, L.; Perez Montoro, B.; Bockelmann, W.; Pichner, R.; Kabisch, J.; Cho, G.S.; Franz, C.M.A.P.; Gálvez, A.; et al. New insights in antibiotic resistance of Lactobacillus species from fermented foods. Food Res. Int. 2015, 78, 465–481. [Google Scholar] [CrossRef]
  29. Doi, Y.; Wachino, J.I.; Arakawa, Y. Aminoglycoside resistance: The emergence of acquired 16S ribosomal RNA methyltransferases. Infect. Dis. Clin. N. Am. 2016, 30, 523–537. [Google Scholar] [CrossRef]
  30. Huys, G.; D’Haene, K.; Cnockaert, M.; Tosi, L.; Danielsen, M.; Flórez, A.B.; Mättö, J.; Axelsson, L.; Korhonen, J.; Mayrhofer, S.; et al. Intra- and interlaboratory performances of two commercial antimicrobial susceptibility testing methods for bifidobacteria and nonenterococcal lactic acid bacteria. Antimicrob. Agents Chemother. 2010, 54, 2567–2574. [Google Scholar] [CrossRef] [Green Version]
  31. Ammor, M.S.; Flórez, A.B.; van Hoek, A.H.; de Los Reyes-Gavilán, C.G.; Aarts, H.J.; Margolles, A.; Mayo, B. Molecular characterization of intrinsic and acquired antibiotic resistance in lactic acid bacteria and bifidobacteria. J. Mol. Microbiol. Biotechnol. 2008, 14, 6–15. [Google Scholar] [CrossRef]
  32. Condon, S. Aerobic metabolism of lactic acid bacteria. Irish J. Food Sci. Technol. 1983, 7, 15–25. [Google Scholar]
  33. Elkins, C.A.; Mullis, L.B. Bile-mediated aminoglycoside sensitivity in Lactobacillus species likely results from increased membrane permeability attributable to cholic acid. Appl. Environ. Microbiol. 2004, 70, 7200–7209. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  34. Carter, A.P.; Clemons, W.M.; Brodersen, D.E.; Morgan-Warren, R.J.; Wimberly, B.T.; Ramakrishnan, V. Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics. Nature 2000, 407, 340–348. [Google Scholar] [CrossRef] [PubMed]
  35. Demirci, H.; Murphy, F.V.t.; Murphy, E.L.; Connetti, J.L.; Dahlberg, A.E.; Jogl, G.; Gregory, S.T. Structural analysis of base substitutions in Thermus thermophilus 16S rRNA conferring streptomycin resistance. Antimicrob. Agents Chemother. 2014, 58, 4308–4317. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  36. Kiwaki, M.; Sato, T. Antimicrobial susceptibility of Bifidobacterium breve strains and genetic analysis of streptomycin resistance of probiotic B. breve strain Yakult. Int. J. Food Microbiol. 2009, 134, 211–215. [Google Scholar] [CrossRef] [PubMed]
  37. Goldstein, E.J.; Tyrrell, K.L.; Citron, D.M. Lactobacillus species: Taxonomic complexity and controversial susceptibilities. Clin. Infect. Dis. 2015, 60, S98–S107. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  38. van Pijkeren, J.P.; Britton, R.A. High efficiency recombineering in lactic acid bacteria. Nucleic Acids Res. 2012, 40, e76. [Google Scholar] [CrossRef]
  39. Katla, A.K.; Kruse, H.; Johnsen, G.; Herikstad, H. Antimicrobial susceptibility of starter culture bacteria used in Norwegian dairy products. Int. J. Food Microbiol. 2001, 67, 147–152. [Google Scholar] [CrossRef]
  40. Castro, W.; Navarro, M.; Biot, C. Medicinal potential of ciprofloxacin and its derivatives. Future Med. Chem. 2013, 5, 81–96. [Google Scholar] [CrossRef]
  41. Rosander, A.; Connolly, E.; Roos, S. Removal of antibiotic resistance gene-carrying plasmids from Lactobacillus reuteri ATCC 55730 and characterization of the resulting daughter strain, L. reuteri DSM 17938. Appl. Environ. Microbiol. 2008, 74, 6032–6040. [Google Scholar] [CrossRef] [Green Version]
  42. Thaker, M.; Spanogiannopoulos, P.; Wright, G.D. The tetracycline resistome. Cell. Mol. Life Sci. 2010, 67, 419–431. [Google Scholar] [CrossRef]
  43. Ammor, M.S.; Flórez, A.B.; Alvarez-Martín, P.; Margolles, A.; Mayo, B. Analysis of tetracycline resistance tet(W) genes and their flanking sequences in intestinal Bifidobacterium species. J. Antimicrob. Chemother. 2008, 62, 688–693. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  44. Gueimonde, M.; Flórez, A.B.; van Hoek, A.H.; Stuer-Lauridsen, B.; Strøman, P.; de los Reyes-Gavilán, C.G.; Margolles, A. Genetic basis of tetracycline resistance in Bifidobacterium animalis subsp. lactis. Appl. Environ. Microbiol. 2010, 76, 3364–3369. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  45. Rossetti, L.; Giraffa, G. Rapid identification of dairy lactic acid bacteria by M13-generated, RAPD-PCR fingerprint databases. J. Microbiol. Methods 2005, 63, 135–144. [Google Scholar] [CrossRef] [PubMed]
  46. Mättö, J.; Malinen, E.; Suihko, M.L.; Alander, M.; Palva, A.; Saarela, M. Genetic heterogeneity and functional properties of intestinal bifidobacteria. J. Appl. Microbiol. 2004, 97, 459–470. [Google Scholar] [CrossRef] [PubMed]
  47. Koeuth, T.; Versalovic, J.; Lupski, J.R. Differential subsequence conservation of interspersed repetitive Streptococcus pneumoniae BOX elements in diverse bacteria. Genome. Res. 1995, 5, 408–418. [Google Scholar] [CrossRef] [Green Version]
  48. IDF. Milk and Milk Products: Determination of the Minimal Inhibitory Concentration (MIC) of Antibiotics Applicable to Bifidobacteria and Non-enterococcal Lactic Acid Bacteria. ISO Standard 10932:2010. 2010. Available online: https://www.iso.org/obp/ui/#iso:std:iso:10932:ed-1:v1:en (accessed on 8 April 2020).
  49. Klare, I.; Konstabel, C.; Müller-Bertling, S.; Reissbrodt, R.; Huys, G.; Vancanneyt, M.; Swings, J.; Goossens, H.; Witte, W. Evaluation of new broth media for microdilution antibiotic susceptibility testing of lactobacilli, pediococci, lactococci, and bifidobacteria. Appl. Environ. Microbiol. 2005, 71, 8982–8986. [Google Scholar] [CrossRef] [Green Version]
  50. CLSI. Performance Standards for Antimicrobial Susceptibility Testing, 26th ed.; CLSI Supplement M100S; CLSI: Wayne, NJ, USA, 2016. [Google Scholar]
  51. Clermont, D.; Chesneau, O.; De Cespédès, G.; Horaud, T. New tetracycline resistance determinants coding for ribosomal protection in streptococci and nucleotide sequence of tet(T) isolated from Streptococcus pyogenes A498. Antimicrob. Agents Chemother. 1997, 41, 112–116. [Google Scholar] [CrossRef] [Green Version]
  52. Barbosa, T.M.; Scott, K.P.; Flint, H.J. Evidence for recent intergeneric transfer of a new tetracycline resistance gene, tet(W), isolated from Butyrivibrio fibrisolvens, and the occurrence of tet(O) in ruminal bacteria. Environ. Microbiol. 1999, 1, 53–64. [Google Scholar] [CrossRef]
  53. Gevers, D.; Danielsen, M.; Huys, G.; Swings, J. Molecular characterization of tet(M) genes in Lactobacillus isolates from different types of fermented dry sausage. Appl. Environ. Microbiol. 2003, 69, 1270–1275. [Google Scholar] [CrossRef] [Green Version]
  54. Scott, K.P.; Melville, C.M.; Barbosa, T.M.; Flint, H.J. Occurrence of the new tetracycline resistance gene tet(W) in bacteria from the human gut. Antimicrob. Agents Chemother. 2000, 44, 775–777. [Google Scholar] [CrossRef] [Green Version]
  55. Rizzotti, L.; Simeoni, D.; Cocconcelli, P.; Gazzola, S.; Dellaglio, F.; Torriani, S. Contribution of enterococci to the spread of antibiotic resistance in the production chain of swine meat commodities. J. Food Prot. 2005, 68, 955–965. [Google Scholar] [CrossRef] [PubMed]
  56. Roberts, M.C.; Chung, W.O.; Roe, D.; Xia, M.; Marquez, C.; Borthagaray, G.; Whittington, W.L.; Holmes, K.K. Erythromycin-resistant Neisseria gonorrhoeae and oral commensal Neisseria spp. carry known rRNA methylase genes. Antimicrob. Agents Chemother. 1999, 43, 1367–1372. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  57. Luna, V.A.; Cousin, S., Jr.; Whittington, W.L.; Roberts, M.C. Identification of the conjugative mef gene in clinical Acinetobacter junii and Neisseria gonorrhoeae isolates. Antimicrob. Agents Chemother. 2000, 44, 2503–2506. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  58. Hummel, A.S.; Hertel, C.; Holzapfel, W.H.; Franz, C.M. Antibiotic resistances of starter and probiotic strains of lactic acid bacteria. Appl. Environ. Microbiol. 2007, 73, 730–739. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  59. Rojo-Bezares, B.; Sáenz, Y.; Poeta, P.; Zarazaga, M.; Ruiz-Larrea, F.; Torres, C. Assessment of antibiotic susceptibility within lactic acid bacteria strains isolated from wine. Int. J. Food Microbiol. 2006, 111, 234–240. [Google Scholar] [CrossRef]
  60. Klare, I.; Konstabel, C.; Werner, G.; Huys, G.; Vankerckhoven, V.; Kahlmeter, G.; Hildebrandt, B.; Müller-Bertling, S.; Witte, W.; Goossens, H. Antimicrobial susceptibilities of Lactobacillus, Pediococcus and Lactococcus human isolates and cultures intended for probiotic or nutritional use. J. Antimicrob. Chemother. 2007, 59, 900–912. [Google Scholar] [CrossRef]
Ijms 21 02594 g001 550
Figure 1. PCR amplification of tetracycline resistance genes using the universal primers Tet1 and Tet2 targeting a segment of 1,300 bp of the genes encoding RPP (A) and 1,200 bp of the tet(W) gene with the specific primer pair tetWF-Tet2 (B). Key of samples: Lane 1, DNA from B. bifidum VA07-1AN; lane 2, B. bifidum VA07-2AN; lane 3, Leuconostoc mesenteroides subsp. mesenteroides LbE16 (positive control) [9]; line 4, blank (no template DNA). M, molecular weight marker.
Figure 1. PCR amplification of tetracycline resistance genes using the universal primers Tet1 and Tet2 targeting a segment of 1,300 bp of the genes encoding RPP (A) and 1,200 bp of the tet(W) gene with the specific primer pair tetWF-Tet2 (B). Key of samples: Lane 1, DNA from B. bifidum VA07-1AN; lane 2, B. bifidum VA07-2AN; lane 3, Leuconostoc mesenteroides subsp. mesenteroides LbE16 (positive control) [9]; line 4, blank (no template DNA). M, molecular weight marker.
Ijms 21 02594 g001
Ijms 21 02594 g002 550
Figure 2. Alignment of amino acid sequences around the active site of D-Ala-D-Ala ligases of the five Lactobacillus spp. strains sequenced. Strains with phenylalanine (F) at the enzyme active site (green) show a vancomycin-resistant phenotype, while those having a tyrosine (Y) (pale blue) display a vancomycin-susceptible phenotype.
Figure 2. Alignment of amino acid sequences around the active site of D-Ala-D-Ala ligases of the five Lactobacillus spp. strains sequenced. Strains with phenylalanine (F) at the enzyme active site (green) show a vancomycin-resistant phenotype, while those having a tyrosine (Y) (pale blue) display a vancomycin-susceptible phenotype.
Ijms 21 02594 g002
Ijms 21 02594 g003 550
Figure 3. Diagram showing the genetic organization of ORFs in the contig harboring the tet(W) gene of Bifidobacterium bifidum VA07-1AN. Color key: purple, tet(W) gene (the position of the GG insertion disrupting the ORF is indicated); yellow, conjugation-associated gene; pale blue, gene encoding a transcription regulator; white, genes involved in other processes. The broken line symbol indicates the contig extends beyond this point.
Figure 3. Diagram showing the genetic organization of ORFs in the contig harboring the tet(W) gene of Bifidobacterium bifidum VA07-1AN. Color key: purple, tet(W) gene (the position of the GG insertion disrupting the ORF is indicated); yellow, conjugation-associated gene; pale blue, gene encoding a transcription regulator; white, genes involved in other processes. The broken line symbol indicates the contig extends beyond this point.
Ijms 21 02594 g003
Ijms 21 02594 g004 550
Figure 4. Alignment of the deduced amino acid sequence of S12 ribosomal proteins encoded by the rpsL gene from streptomycin resistant (Smr) and susceptible (Sms) Bifidobacterium bifidum strains. The amino acid replacement K→R at position 43 in the resistant strains is highlighted in pale blue. In bold, the strain of this study (VA07-1AN).
Figure 4. Alignment of the deduced amino acid sequence of S12 ribosomal proteins encoded by the rpsL gene from streptomycin resistant (Smr) and susceptible (Sms) Bifidobacterium bifidum strains. The amino acid replacement K→R at position 43 in the resistant strains is highlighted in pale blue. In bold, the strain of this study (VA07-1AN).
Ijms 21 02594 g004
Ijms 21 02594 g005 550
Figure 5. Chromatograms of amplicons of the tet(W) gene from the original tetracycline-susceptible strain B. bifidum VA07-1AN and two representative tetracycline-resistant revertants (R-1 and R-11). Nucleotide sequences and the corresponding deduced amino acid sequences are displayed below each of the chromatograms. DNA and protein differences with canonical sequences of the tet(W) gene from the tetracycline-resistant Bifidobacterium longum LTBL16 strain (on top of the figure) are highlighted in red.
Figure 5. Chromatograms of amplicons of the tet(W) gene from the original tetracycline-susceptible strain B. bifidum VA07-1AN and two representative tetracycline-resistant revertants (R-1 and R-11). Nucleotide sequences and the corresponding deduced amino acid sequences are displayed below each of the chromatograms. DNA and protein differences with canonical sequences of the tet(W) gene from the tetracycline-resistant Bifidobacterium longum LTBL16 strain (on top of the figure) are highlighted in red.
Ijms 21 02594 g005
Table
Table 1. Minimum inhibitory concentration (MIC) values of 16 antibiotics to the vaginal LAB species and strains of this study.
Table 1. Minimum inhibitory concentration (MIC) values of 16 antibiotics to the vaginal LAB species and strains of this study.
SpeciesStrainAntibiotic a (MIC as µg mL−1)
GENKANSTRNEOTETERYCLICHLAMPPENVANQDALINTMPCIPRIF
L. crispatusVA20-32AN b21621620.060.25410.50.514>64161
VA27-743264811282211432644
VA27-91162220.030.5420.50.51464322
VA28-121162220.060.5420.50.52464322
VA32-172642840.030.52110.512>64648
VA32-17AN412832420.250.5410.511216324
VA50-4AN c≤0.5321240.120.124410.514>64324
L. jenseniiVA04-1AN≤0.54210.25≤0.0160.1240.250.1210.51>6480.25
VA04-2AN≤0.54410.50.030.1220.5110.52>6480.25
VA15-2AN≤0.5≤21≤0.51≤0.016≤0.0320.060.060.50.50.5>6480.25
VA16-11≤0.581240.060.2540.06≤0.0320.52>64160.5
Breakpoint (µg mL−1) d161616-41442-2-----
L. salivariusVA09-486416420.250.25210.251280.250.5≤0.1212
VA16-20≤0.5420.510.060.0620.50.12>1280.50.50.250.50.5
VA37-13≤0.54≤0.5≤0.50.50.060.0620.250.12>1280.50.50.25≤0.250.5
VA40-10128>1024>256256211410.25>12811140.5
VA40-12AN412832420.250.2540.50.25>12810.50.2511
VA40-14AN412832420.250.540.50.25>12810.5≤0.1211
Breakpoint (µg mL−1)166464-81444-n.r.-----
L. paracaseiVA02-1AN≤0.5168120.120.06810.25>128140.540.5
VA24-41168440.120.0640.50.25>128120.2540.5
VA26-3≤0.5168220.120.06410.25>12812120.5
VA27-813216820.060.0680.50.25>128140.2540.5
Breakpoint (µg mL−1)326464-41444-n.r.-----
L. reuteriVA15-3≤0.542≤0.580.12≤0.03412>12812>64320.25
VA24-5≤0.5164≤0.5160.06≤0.03428>1280.54>64320.25
Breakpoint (µg mL−1)86464-321442-n.r.-----
B. bifidumVA07-1AN864>256161≤0.0160.061≤0.03≤0.030.50.50.51682
VA07-2AN3264>256321≤0.016≤0.031≤0.03≤0.0310.50.51681
Breakpoint (µg mL−1)64-128-81142-2-----
a GEN, gentamicin; KAN, kanamycin; STR, streptomycin; NEO, neomycin; TET, tetracycline; ERY, erythromycin; CLI, clindamycin; CHL, chloramphenicol; AMP, ampicillin; PEN, penicillin; VAN, vancomycin; QDA, quinupristin-dalfopristin; LIN, linezolid; TMP, trimethoprim; CIP, ciprofloxacin; RIF, rifampicin. b Strains coded with AN were recovered after growth in anaerobiosis. c Strains in bold were subjected to whole genome sequencing and analysis. d Gray-shaded boxes show MIC of antibiotics higher than the corresponding cut-off values, considering those of the European Food Safety Authority [8]. n.r., naturally resistant; -, breakpoint not established.

Share and Cite

MDPI and ACS Style

Sirichoat, A.; Flórez, A.B.; Vázquez, L.; Buppasiri, P.; Panya, M.; Lulitanond, V.; Mayo, B. Antibiotic Susceptibility Profiles of Lactic Acid Bacteria from the Human Vagina and Genetic Basis of Acquired Resistances. Int. J. Mol. Sci. 2020, 21, 2594. https://doi.org/10.3390/ijms21072594

AMA Style

Sirichoat A, Flórez AB, Vázquez L, Buppasiri P, Panya M, Lulitanond V, Mayo B. Antibiotic Susceptibility Profiles of Lactic Acid Bacteria from the Human Vagina and Genetic Basis of Acquired Resistances. International Journal of Molecular Sciences. 2020; 21(7):2594. https://doi.org/10.3390/ijms21072594

Chicago/Turabian Style

Sirichoat, Auttawit, Ana Belén Flórez, Lucía Vázquez, Pranom Buppasiri, Marutpong Panya, Viraphong Lulitanond, and Baltasar Mayo. 2020. "Antibiotic Susceptibility Profiles of Lactic Acid Bacteria from the Human Vagina and Genetic Basis of Acquired Resistances" International Journal of Molecular Sciences 21, no. 7: 2594. https://doi.org/10.3390/ijms21072594

APA Style

Sirichoat, A., Flórez, A. B., Vázquez, L., Buppasiri, P., Panya, M., Lulitanond, V., & Mayo, B. (2020). Antibiotic Susceptibility Profiles of Lactic Acid Bacteria from the Human Vagina and Genetic Basis of Acquired Resistances. International Journal of Molecular Sciences, 21(7), 2594. https://doi.org/10.3390/ijms21072594

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop