Next Article in Journal
Genome-Wide Association and Prediction of Traits Related to Salt Tolerance in Autotetraploid Alfalfa (Medicago sativa L.)
Previous Article in Journal
Swiprosin-1/EFhD-2 Expression in Cardiac Remodeling and Post-Infarct Repair: Effect of Ischemic Conditioning
 
 
Search for Articles:
Title / Keyword
Author / Affiliation / Email
Journal
Article Type
 
 
Advanced Search
 
Section
Special Issue
Volume
Issue
Number
Page
 
Journals
IJMS
Volume 21
Issue 9
10.3390/ijms21093357
ijms-logo
Submit to this Journal Review for this Journal Propose a Special Issue
► Article Menu

Article Menu

share Share announcement Help format_quote Cite question_answer Discuss in SciProfiles thumb_up
...
Endorse textsms
...
Comment
Correction to Int. J. Mol. Sci. 2019, 20(14), 3532.
first_page
settings
Order Article Reprints
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Correction

Correction: Al-Zamel, N., et al. A Dual GLP-1/GIP Receptor Agonist Does Not Antagonize Glucagon at Its Receptor but May Act as a Biased Agonist at the GLP-1 Receptor. Int. J. Mol. Sci. 2019, 20, 3532.

by
Noura Al-Zamel
1,
Suleiman Al-Sabah
1,*,
Yunus Luqmani
2,
Lobna Adi
1,
Siby Chacko
1,
Tom Dario Schneider
3 and
Cornelius Krasel
4
1
Department of Pharmacology & Toxicology, Faculty of Medicine, Kuwait University, PO Box 24923, 13110 Safat, Kuwait
2
Department of Pharmaceutical Chemistry, Faculty of Pharmacy, Kuwait University, PO Box 24923, 13110 Safat, Kuwait
3
Institute of Forensic Medicine, Department of Forensic Pharmacology and Toxicology, University of Zurich, 190/52 CH-8057 Zurich, Switzerland
4
School of Pharmacy, Institute for Pharmacology and Toxicology, The Philipps University of Marburg, Karl-von-Frisch-Straße, 135033 Marburg, Germany
*
Author to whom correspondence should be addressed.
Int. J. Mol. Sci. 2020, 21(9), 3357; https://doi.org/10.3390/ijms21093357
Submission received: 7 May 2020 / Accepted: 7 May 2020 / Published: 9 May 2020
Versions Notes
The author wishes to make the following correction to this paper [1]. Due to mislabeling, replace: Ijms 21 03357 i001 with Ijms 21 03357 i002
There is an error in the peptide sequence of GIP in Figure 1. Two amino acid residues are missing. The correct sequence for GIP is: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ. The authors would like to apologize for any inconvenience caused to the readers by these changes.

References

  1. Al-Zamel, N.; Al-Sabah, S.; Luqmani, Y.; Adi, L.; Chacko, S.; Schneider, T.D.; Krasel, C. A Dual GLP-1/GIP Receptor Agonist Does Not Antagonize Glucagon at Its Receptor but May Act as a Biased Agonist at the GLP-1 Receptor. Int. J. Mol. Sci. 2019, 20, 3532. [Google Scholar] [CrossRef] [PubMed] [Green Version]

Share and Cite

MDPI and ACS Style

Al-Zamel, N.; Al-Sabah, S.; Luqmani, Y.; Adi, L.; Chacko, S.; Schneider, T.D.; Krasel, C. Correction: Al-Zamel, N., et al. A Dual GLP-1/GIP Receptor Agonist Does Not Antagonize Glucagon at Its Receptor but May Act as a Biased Agonist at the GLP-1 Receptor. Int. J. Mol. Sci. 2019, 20, 3532. Int. J. Mol. Sci. 2020, 21, 3357. https://doi.org/10.3390/ijms21093357

AMA Style

Al-Zamel N, Al-Sabah S, Luqmani Y, Adi L, Chacko S, Schneider TD, Krasel C. Correction: Al-Zamel, N., et al. A Dual GLP-1/GIP Receptor Agonist Does Not Antagonize Glucagon at Its Receptor but May Act as a Biased Agonist at the GLP-1 Receptor. Int. J. Mol. Sci. 2019, 20, 3532. International Journal of Molecular Sciences. 2020; 21(9):3357. https://doi.org/10.3390/ijms21093357

Chicago/Turabian Style

Al-Zamel, Noura, Suleiman Al-Sabah, Yunus Luqmani, Lobna Adi, Siby Chacko, Tom Dario Schneider, and Cornelius Krasel. 2020. "Correction: Al-Zamel, N., et al. A Dual GLP-1/GIP Receptor Agonist Does Not Antagonize Glucagon at Its Receptor but May Act as a Biased Agonist at the GLP-1 Receptor. Int. J. Mol. Sci. 2019, 20, 3532." International Journal of Molecular Sciences 21, no. 9: 3357. https://doi.org/10.3390/ijms21093357

APA Style

Al-Zamel, N., Al-Sabah, S., Luqmani, Y., Adi, L., Chacko, S., Schneider, T. D., & Krasel, C. (2020). Correction: Al-Zamel, N., et al. A Dual GLP-1/GIP Receptor Agonist Does Not Antagonize Glucagon at Its Receptor but May Act as a Biased Agonist at the GLP-1 Receptor. Int. J. Mol. Sci. 2019, 20, 3532. International Journal of Molecular Sciences, 21(9), 3357. https://doi.org/10.3390/ijms21093357

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop