Antimicrobial Peptides with Anti-Candida Activity
Abstract
1. Introduction
2. Antimicrobial Peptides from Plants
2.1. HsAFP1 Peptide
2.2. NaD1 Peptide
2.3. Psd1 Peptide
2.4. RsAFP2 Peptide
3. Antimicrobial Peptides from Humans
3.1. CGA-N46 Peptide
3.2. Psoriasin Peptide
3.3. Human β-Defensins
3.4. Histatins
3.5. LL-37 Peptide
4. Antimicrobial Peptides from Insects and Arachnids
4.1. Gomesin Peptide
4.2. Heliomicin
4.3. Jelleine Peptides
4.4. Lasioglossin Peptides
4.5. Lycosin-I Peptide
4.6. MAF-1A Peptide
4.7. Melectin Peptide
4.8. Melittin Peptide
5. Antimicrobial Peptides from Other Sources
5.1. Bovine Cateslytin
5.2. Dermaseptin Peptides
5.3. NFAP Peptides
6. Conclusions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
References
- Schmiedel, Y.; Zimmerli, S. Common invasive fungal diseases: An overview of invasive candidiasis, aspergillosis, cryptococcosis, and Pneumocystis pneumonia. Swiss Med. Wkly. 2016, 146, w1428. [Google Scholar] [CrossRef] [PubMed]
- Quindós, G.; Marcos-Arias, C.; San-Millán, R.; Mateo, E.; Eraso, E. The continuous changes in the aetiology and epidemiology of invasive candidiasis: From familiar Candida albicans to multiresistant Candida auris. Int. Microbiol. 2018, 21, 107–119. [Google Scholar] [CrossRef] [PubMed]
- Sadeghi, G.; Ebrahimi-Rad, M.; Mousavi, S.F.; Shams-Ghahfarokhi, M.; Razzaghi-Abyaneh, M. Emergence of non-Candida albicans species: Epidemiology, phylogeny and fluconazole susceptibility profile. J. Mycol. Med. 2018, 28, 51–58. [Google Scholar] [CrossRef] [PubMed]
- Wiederhold, N.P. The antifungal arsenal: Alternative drugs and future targets. Int. J. Antimicrob. Agents 2018, 51, 333–339. [Google Scholar] [CrossRef]
- Kumar, P.; Kizhakkedathu, J.N.; Straus, S.K. Antimicrobial peptides: Diversity, mechanism of action and strategies to improve the activity and biocompatibility in vivo. Biomolecules 2018, 8, 4. [Google Scholar] [CrossRef]
- Haney, E.F.; Straus, S.K.; Hancock, R.E.W. Reassessing the host defense peptide landscape. Front. Chem. 2019, 7, 43. [Google Scholar] [CrossRef]
- Fox, J.L. Antimicrobial peptides stage a comeback. Nat. Biotechnol. 2013, 31, 379–382, Erratum in Nat. Biotechnol. 2013, 31, 1066. [Google Scholar] [CrossRef]
- Lay, F.T.; Anderson, M.A. Defensins--components of the innate immune system in plants. Curr. Protein Pept. Sci. 2005, 6, 85–101. [Google Scholar] [CrossRef]
- Aerts, A.M.; François, I.E.; Cammue, B.P.; Thevissen, K. The mode of antifungal action of plant, insect and human defensins. Cell Mol. Life Sci. 2008, 65, 2069–2079. [Google Scholar] [CrossRef]
- Osborn, R.W.; De Samblanx, G.W.; Thevissen, K.; Goderis, I.; Torrekens, S.; Van Leuven, F.; Attenborough, S.; Rees, S.B.; Broekaert, W.F. Isolation and characterisation of plant defensins from seeds of Asteraceae, Fabaceae, Hippocastanaceae and Saxifragaceae. FEBS Lett. 1995, 368, 257–262. [Google Scholar] [CrossRef]
- Almeida, M.S.; Cabral, K.M.; Zingali, R.B.; Kurtenbach, E. Characterization of two novel defense peptides from pea (Pisum sativum) seeds. Arch. Biochem. Biophys. 2000, 378, 278–286. [Google Scholar] [CrossRef] [PubMed]
- Thevissen, K.; Kristensen, H.H.; Thomma, B.P.; Cammue, B.P.; François, I.E. Therapeutic potential of antifungal plant and insect defensins. Drug Discov. Today 2007, 12, 966–971. [Google Scholar] [CrossRef] [PubMed]
- Mello, E.O.; Ribeiro, S.F.; Carvalho, A.O.; Santos, I.S.; Da Cunha, M.; Santa-Catarina, C.; Gomes, V.M. Antifungal activity of PvD1 defensin involves plasma membrane permeabilization, inhibition of medium acidification, and induction of ROS in fungi cells. Curr. Microbiol. 2011, 62, 1209–1217. [Google Scholar] [CrossRef]
- Tavares, P.M.; Thevissen, K.; Cammue, B.P.; François, I.E.; Barreto-Bergter, E.; Taborda, C.P.; Marques, A.F.; Rodrigues, M.L.; Nimrichter, L. In vitro activity of the antifungal plant defensin RsAFP2 against Candida isolates and its in vivo efficacy in prophylactic murine models of candidiasis. Antimicrob. Agents Chemother. 2008, 52, 4522–4525. [Google Scholar] [CrossRef]
- Thevissen, K.; Osborn, R.W.; Acland, D.P.; Broekaert, W.F. Specific, high affinity binding sites for an antifungal plant defensin on Neurospora crassa hyphae and microsomal membranes. J. Biol. Chem. 1997, 272, 32176–32181. [Google Scholar] [CrossRef] [PubMed]
- Cools, T.L.; Vriens, K.; Struyfs, C.; Verbandt, S.; Ramada, M.H.S.; Drijfhout, J.W.; Demuyser, L.; Kucharíková, S.; Van Dijck, P.; Spasic, D.; et al. The antifungal plant defensin HsAFP1 is a phosphatidic acid-interacting peptide inducing membrane permeabilization. Front. Microbiol. 2017, 8, 2295. [Google Scholar] [CrossRef] [PubMed]
- Aerts, A.M.; Bammens, L.; Govaert, G.; Carmona-Gutierrez, D.; Madeo, F.; Cammue, B.P.; Thevissen, K. The antifungal plant defensin HsAFP1 from Heuchera sanguinea induces apoptosis in Candida albicans. Front. Microbiol. 2011, 2, 47. [Google Scholar] [CrossRef]
- Struyfs, C.; Cools, T.L.; De Cremer, K.; Sampaio-Marques, B.; Ludovico, P.; Wasko, B.M.; Kaeberlein, M.; Cammue, B.P.A.; Thevissen, K. The antifungal plant defensin HsAFP1 induces autophagy, vacuolar dysfunction and cell cycle impairment in yeast. Biochim. Biophys. Acta Biomembr. 2020, 1862, 183255. [Google Scholar] [CrossRef]
- Vriens, K.; Cools, T.L.; Harvey, P.J.; Craik, D.J.; Spincemaille, P.; Cassiman, D.; Braem, A.; Vleugels, J.; Nibbering, P.H.; Drijfhout, J.W.; et al. Synergistic activity of the plant defensin HsAFP1 and caspofungin against Candida albicans biofilms and planktonic cultures. PLoS ONE 2015, 10, e0132701. [Google Scholar] [CrossRef]
- Cools, T.L.; Struyfs, C.; Drijfhout, J.W.; Kucharíková, S.; Lobo Romero, C.; Van Dijck, P.; Ramada, M.H.S.; Bloch, C., Jr.; Cammue, B.P.A.; Thevissen, K. A Linear 19-mer plant defensin-derived peptide acts synergistically with caspofungin against Candida albicans biofilms. Front. Microbiol. 2017, 8, 2051. [Google Scholar] [CrossRef]
- Hayes, B.M.; Bleackley, M.R.; Wiltshire, J.L.; Anderson, M.A.; Traven, A.; van der Weerden, N.L. Identification and mechanism of action of the plant defensin NaD1 as a new member of the antifungal drug arsenal against Candida albicans. Antimicrob. Agents Chemother. 2013, 57, 3667–3675. [Google Scholar] [CrossRef] [PubMed]
- Hayes, B.M.E.; Bleackley, M.R.; Anderson, M.A.; van der Weerden, N.L. The Plant Defensin NaD1 Enters the Cytoplasm of Candida Albicans via Endocytosis. J. Fungi 2018, 4, 20. [Google Scholar] [CrossRef]
- Neves de Medeiros, L.; Domitrovic, T.; Cavalcante de Andrade, P.; Faria, J.; Barreto Bergter, E.; Weissmüller, G.; Kurtenbach, E. Psd1 binding affinity toward fungal membrane components as assessed by SPR: The role of glucosylceramide in fungal recognition and entry. Biopolymers 2014, 102, 456–464. [Google Scholar] [CrossRef] [PubMed]
- Gonçalves, S.; Silva, P.M.; Felício, M.R.; de Medeiros, L.N.; Kurtenbach, E.; Santos, N.C. Psd1 Effects on Candida albicans planktonic cells and biofilms. Front. Cell. Infect. Microbiol. 2017, 7, 249. [Google Scholar] [CrossRef] [PubMed]
- Vriens, K.; Cools, T.L.; Harvey, P.J.; Craik, D.J.; Braem, A.; Vleugels, J.; De Coninck, B.; Cammue, B.P.; Thevissen, K. The radish defensins RsAFP1 and RsAFP2 act synergistically with caspofungin against Candida albicans biofilms. Peptides 2016, 75, 71–79. [Google Scholar] [CrossRef]
- Thevissen, K.; Warnecke, D.C.; François, I.E.; Leipelt, M.; Heinz, E.; Ott, C.; Zähringer, U.; Thomma, B.P.; Ferket, K.K.; Cammue, B.P. Defensins from insects and plants interact with fungal glucosylceramides. J. Biol. Chem. 2004, 279, 3900–3905. [Google Scholar] [CrossRef]
- Aerts, A.M.; François, I.E.; Meert, E.M.; Li, Q.T.; Cammue, B.P.; Thevissen, K. The antifungal activity of RsAFP2, a plant defensin from raphanus sativus, involves the induction of reactive oxygen species in Candida albicans. Microb. Physiol. 2007, 13, 243–247. [Google Scholar] [CrossRef]
- Aerts, A.M.; Carmona-Gutierrez, D.; Lefevre, S.; Govaert, G.; François, I.E.; Madeo, F.; Santos, R.; Cammue, B.P.; Thevissen, K. The antifungal plant defensin RsAFP2 from radish induces apoptosis in a metacaspase independent way in Candida albicans. FEBS Lett. 2009, 583, 2513–2516. [Google Scholar] [CrossRef]
- Saito, K.; Takakuwa, N.; Ohnishi, M.; Oda, Y. Presence of glucosylceramide in yeast and its relation to alkali tolerance of yeast. Appl. Microbiol. Biotechnol. 2006, 71, 515–521. [Google Scholar] [CrossRef]
- Thevissen, K.; de Mello Tavares, P.; Xu, D.; Blankenship, J.; Vandenbosch, D.; Idkowiak-Baldys, J.; Govaert, G.; Bink, A.; Rozental, S.; de Groot, P.W.; et al. The plant defensin RsAFP2 induces cell wall stress, septin mislocalization and accumulation of ceramides in Candida albicans. Mol. Microbiol. 2012, 84, 166–180. [Google Scholar] [CrossRef]
- Pandey, B.; Tyagi, C.; Prajapati, G.K.; Mishra, A.K.; Hashem, A.; Alqarawi, A.A.; Abd Allah, E.F.; Mohanta, T.K. Analysis of mutations of defensin protein using accelerated molecular dynamics simulations. PLoS ONE 2020, 15, e0241679. [Google Scholar] [CrossRef] [PubMed]
- Li, R.F.; Lu, Y.L.; Lu, Y.B.; Zhang, H.R.; Huang, L.; Yin, Y.; Zhang, L.; Liu, S.; Lu, Z.; Sun, Y. Antiproliferative effect and characterization of a novel antifungal peptide derived from human Chromogranin A. Exp. Ther. Med. 2015, 10, 2289–2294. [Google Scholar] [CrossRef] [PubMed]
- Li, R.F.; Yan, X.H.; Lu, Y.B.; Lu, Y.L.; Zhang, H.R.; Chen, S.H.; Liu, S.; Lu, Z.F. Anti-candidal activity of a novel peptide derived from human chromogranin A and its mechanism of action against Candida krusei. Exp. Ther. Med. 2015, 10, 1768–1776. [Google Scholar] [CrossRef] [PubMed]
- Li, R.; Zhang, L.; Zhang, H.; Yi, Y.; Wang, L.; Chen, L.; Zhang, L. Protective effect of a novel antifungal peptide derived from human chromogranin a on the immunity of mice infected with Candida krusei. Exp. Ther. Med. 2017, 13, 2429–2434. [Google Scholar] [CrossRef] [PubMed]
- Li, R.F.; Lu, Z.F.; Sun, Y.N.; Chen, S.H.; Yi, Y.J.; Zhang, H.R.; Yang, S.Y.; Yu, G.H.; Huang, L.; Li, C.N. Molecular design, structural analysis and antifungal activity of derivatives of peptide CGA-N46. Interdiscip. Sci. 2016, 8, 319–326. [Google Scholar] [CrossRef] [PubMed]
- Brauner, A.; Alvendal, C.; Chromek, M.; Stopsack, K.H.; Ehrström, S.; Schröder, J.M.; Bohm-Starke, N. Psoriasin, a novel anti-Candida albicans adhesin. J. Mol. Med. 2018, 96, 537–545. [Google Scholar] [CrossRef]
- Joly, S.; Maze, C.; McCray, P.B., Jr.; Guthmiller, J.M. Human beta-defensins 2 and 3 demonstrate strain-selective activity against oral microorganisms. J. Clin. Microbiol. 2004, 42, 1024–1029. [Google Scholar] [CrossRef]
- Feng, Z.; Jiang, B.; Chandra, J.; Ghannoum, M.; Nelson, S.; Weinberg, A. Human beta-defensins: Differential activity against candidal species and regulation by Candida albicans. J. Dent. Res. 2005, 84, 445–450. [Google Scholar] [CrossRef]
- Vylkova, S.; Li, X.S.; Berner, J.C.; Edgerton, M. Distinct antifungal mechanisms: Beta-defensins require Candida albicans Ssa1 protein, while Trk1p mediates activity of cysteine-free cationic peptides. Antimicrob. Agents Chemother. 2006, 50, 324–331. [Google Scholar] [CrossRef]
- Vylkova, S.; Nayyar, N.; Li, W.; Edgerton, M. Human beta-defensins kill Candida albicans in an energy-dependent and salt-sensitive manner without causing membrane disruption. Antimicrob. Agents Chemother. 2007, 51, 154–161. [Google Scholar] [CrossRef]
- Argimón, S.; Fanning, S.; Blankenship, J.R.; Mitchell, A.P. Interaction between the Candida albicans high-osmolarity glycerol (HOG) pathway and the response to human beta-defensins 2 and 3. Eukaryot. Cell. 2011, 10, 272–275. [Google Scholar] [CrossRef] [PubMed]
- Kotani, H.; Koshizuka, T.; Matsubara, K.; Nishiyama, K.; Sugiyama, T.; Suzutani, T. Relationship between human β-defensin 2 and the vaginal environment. Jpn. J. Infect. Dis. 2020, 73, 214–220. [Google Scholar] [CrossRef] [PubMed]
- Fusco, A.; Savio, V.; Donniacuo, M.; Perfetto, B.; Donnarumma, G. Antimicrobial peptides human beta defensin-2 and -3 protect the gut during Candida albicans infections enhancing the intestinal barrier integrity: In vitro study. Front. Cell. Infect. Microbiol. 2021, 11, 666900. [Google Scholar] [CrossRef] [PubMed]
- Harder, J.; Bartels, J.; Christophers, E.; Schröder, J.M. Isolation and characterization of human beta-defensin-3, a novel human inducible peptide antibiotic. J. Biol. Chem. 2001, 276, 5707–5713. [Google Scholar] [CrossRef]
- Chang, H.T.; Tsai, P.W.; Huang, H.H.; Liu, Y.S.; Chien, T.S.; Lan, C.Y. LL37 and hBD-3 elevate the β-1,3-exoglucanase activity of Candida albicans Xog1p, resulting in reduced fungal adhesion to plastic. Biochem. J. 2012, 441, 963–970. [Google Scholar] [CrossRef]
- Oppenheim, F.G.; Xu, T.; McMillian, F.M.; Levitz, S.M.; Diamond, R.D.; Offner, G.D.; Troxler, R.F. Histatins, a novel family of histidine-rich proteins in human parotid secretion. Isolation, characterization, primary structure, and fungistatic effects on Candida albicans. J. Biol. Chem. 1988, 263, 7472–7477. [Google Scholar] [CrossRef]
- Edgerton, M.; Koshlukova, S.E.; Lo, T.E.; Chrzan, B.G.; Straubinger, R.M.; Raj, P.A. Candidacidal activity of salivary histatins. Identification of a histatin 5-binding protein on Candida albicans. J. Biol. Chem. 1998, 273, 20438–20447. [Google Scholar] [CrossRef]
- Xu, T.; Levitz, S.M.; Diamond, R.D.; Oppenheim, F.G. Anticandidal activity of major human salivary histatins. Infect. Immun. 1991, 59, 2549–2554. [Google Scholar] [CrossRef]
- Puri, S.; Edgerton, M. How does it kill?: Understanding the candidacidal mechanism of salivary histatin 5. Eukaryot. Cell 2014, 13, 958–964. [Google Scholar] [CrossRef]
- Nikawa, H.; Jin, C.; Fukushima, H.; Makihira, S.; Hamada, T. Antifungal activity of histatin-5 against non-albicans Candida species. Oral Microbiol. Immunol. 2001, 16, 250–252. [Google Scholar] [CrossRef]
- Helmerhorst, E.J.; Venuleo, C.; Beri, A.; Oppenheim, F.G. Candida glabrata is unusual with respect to its resistance to cationic antifungal proteins. Yeast 2005, 22, 705–714. [Google Scholar] [CrossRef] [PubMed]
- Pathirana, R.U.; Friedman, J.; Norris, H.L.; Salvatori, O.; McCall, A.D.; Kay, J.; Edgerton, M. Fluconazole-resistant Candida auris is susceptible to salivary histatin 5 killing and to intrinsic host defenses. Antimicrob. Agents Chemother. 2018, 62, e01872-17. [Google Scholar] [CrossRef] [PubMed]
- Pusateri, C.R.; Monaco, E.A.; Edgerton, M. Sensitivity of Candida albicans biofilm cells grown on denture acrylic to antifungal proteins and chlorhexidine. Arch. Oral Biol. 2009, 54, 588–594. [Google Scholar] [CrossRef] [PubMed]
- Konopka, K.; Dorocka-Bobkowska, B.; Gebremedhin, S.; Düzgüneş, N. Susceptibility of Candida biofilms to histatin 5 and fluconazole. Antonie Van Leeuwenhoek 2010, 97, 413–417. [Google Scholar] [CrossRef] [PubMed]
- Moffa, E.B.; Mussi, M.C.; Xiao, Y.; Garrido, S.S.; Machado, M.A.; Giampaolo, E.T.; Siqueira, W.L. Histatin 5 inhibits adhesion of C. albicans to reconstructed human oral epithelium. Front. Microbiol. 2015, 6, 885. [Google Scholar] [CrossRef]
- Peters, B.M.; Zhu, J.; Fidel, P.L., Jr.; Scheper, M.A.; Hackett, W.; El Shaye, S.; Jabra-Rizk, M.A. Protection of the oral mucosa by salivary histatin-5 against Candida albicans in an ex vivo murine model of oral infection. FEMS Yeast Res. 2010, 10, 597–604. [Google Scholar] [CrossRef][Green Version]
- Liao, H.; Liu, S.; Wang, H.; Su, H.; Liu, Z. Efficacy of Histatin5 in a murine model of vulvovaginal candidiasis caused by Candida albicans. Pathog. Dis. 2017, 75, 6. [Google Scholar] [CrossRef]
- Li, X.S.; Reddy, M.S.; Baev, D.; Edgerton, M. Candida albicans Ssa1/2p is the cell envelope binding protein for human salivary histatin 5. J. Biol. Chem. 2003, 278, 28553–28561. [Google Scholar] [CrossRef]
- Jang, W.S.; Bajwa, J.S.; Sun, J.N.; Edgerton, M. Salivary histatin 5 internalization by translocation, but not endocytosis, is required for fungicidal activity in Candida albicans. Mol. Microbiol. 2010, 77, 354–370. [Google Scholar] [CrossRef]
- Kumar, R.; Chadha, S.; Saraswat, D.; Bajwa, J.S.; Li, R.A.; Conti, H.R.; Edgerton, M. Histatin 5 uptake by Candida albicans utilizes polyamine transporters Dur3 and Dur31 proteins. J. Biol. Chem. 2011, 286, 43748–43758. [Google Scholar] [CrossRef]
- Mochon, A.B.; Liu, H. The antimicrobial peptide histatin-5 causes a spatially restricted disruption on the Candida albicans surface, allowing rapid entry of the peptide into the cytoplasm. PLoS Pathog. 2008, 4, e1000190. [Google Scholar] [CrossRef] [PubMed]
- Douglas, L.M.; Martin, S.W.; Konopka, J.B. BAR domain proteins Rvs161 and Rvs167 contribute to Candida albicans endocytosis, morphogenesis, and virulence. Infect. Immun. 2009, 77, 4150–4160. [Google Scholar] [CrossRef] [PubMed]
- Helmerhorst, E.J.; Breeuwer, P.; van’t Hof, W.; Walgreen-Weterings, E.; Oomen, L.C.; Veerman, E.C.; Amerongen, A.V.; Abee, T. The cellular target of histatin 5 on Candida albicans is the energized mitochondrion. J. Biol. Chem. 1999, 274, 7286–7291. [Google Scholar] [CrossRef] [PubMed]
- Komatsu, T.; Salih, E.; Helmerhorst, E.J.; Offner, G.D.; Oppenheim, F.G. Influence of histatin 5 on Candida albicans mitochondrial protein expression assessed by quantitative mass spectrometry. J. Proteome Res. 2011, 10, 646–655. [Google Scholar] [CrossRef] [PubMed]
- Helmerhorst, E.J.; Troxler, R.F.; Oppenheim, F.G. The human salivary peptide histatin 5 exerts its antifungal activity through the formation of reactive oxygen species. Proc. Natl. Acad. Sci. USA 2001, 98, 14637–14642. [Google Scholar] [CrossRef]
- Puri, S.; Li, R.; Ruszaj, D.; Tati, S.; Edgerton, M. Iron binding modulates candidacidal properties of salivary histatin 5. J. Dent. Res. 2015, 94, 201–208. [Google Scholar] [CrossRef]
- den Hertog, A.L.; van Marle, J.; van Veen, H.A.; Van’t Hof, W.; Bolscher, J.G.; Veerman, E.C.; Nieuw Amerongen, A.V. Candidacidal effects of two antimicrobial peptides: Histatin 5 causes small membrane defects, but LL-37 causes massive disruption of the cell membrane. Biochem. J. 2005, 388, 689–695. [Google Scholar] [CrossRef]
- Li, M.; Chen, Q.; Tang, R.; Shen, Y.; Liu, W.D. The expression of β-defensin-2, 3 and LL-37 induced by Candida albicans phospholipomannan in human keratinocytes. J. Dermatol. Sci. 2011, 61, 72–75. [Google Scholar] [CrossRef]
- Tsai, P.W.; Yang, C.Y.; Chang, H.T.; Lan, C.Y. Human antimicrobial peptide LL-37 inhibits adhesion of Candida albicans by interacting with yeast cell-wall carbohydrates. PLoS ONE 2011, 6, e17755. [Google Scholar] [CrossRef]
- Tsai, P.W.; Yang, C.Y.; Chang, H.T.; Lan, C.Y. Characterizing the role of cell-wall β-1,3-exoglucanase Xog1p in Candida albicans adhesion by the human antimicrobial peptide LL-37. PLoS ONE 2011, 6, e21394. [Google Scholar] [CrossRef]
- Tsai, P.W.; Cheng, Y.L.; Hsieh, W.P.; Lan, C.Y. Responses of Candida albicans to the human antimicrobial peptide LL-37. J. Microbiol. 2014, 52, 581–589. [Google Scholar] [CrossRef] [PubMed]
- Ordonez, S.R.; Amarullah, I.H.; Wubbolts, R.W.; Veldhuizen, E.J.; Haagsman, H.P. Fungicidal mechanisms of cathelicidins LL-37 and CATH-2 revealed by live-cell imaging. Antimicrob. Agents Chemother. 2014, 58, 2240–2248. [Google Scholar] [CrossRef] [PubMed]
- den Hertog, A.L.; van Marle, J.; Veerman, E.C.; Valentijn-Benz, M.; Nazmi, K.; Kalay, H.; Grün, C.H.; Van´t Hof, W.; Bolscher, J.G.; Nieuw Amerongen, A.V. The human cathelicidin peptide LL-37 and truncated variants induce segregation of lipids and proteins in the plasma membrane of Candida albicans. Biol. Chem. 2006, 387, 1495–1502. [Google Scholar] [CrossRef] [PubMed]
- Hsu, C.M.; Liao, Y.L.; Chang, C.K.; Lan, C.Y. Candida albicans Sfp1 is involved in the cell wall and endoplasmic reticulum stress responses induced by human antimicrobial peptide LL-37. Int. J. Mol. Sci. 2021, 22, 10633. [Google Scholar] [CrossRef]
- Scarsini, M.; Tomasinsig, L.; Arzese, A.; D’Este, F.; Oro, D.; Skerlavaj, B. Antifungal activity of cathelicidin peptides against planktonic and biofilm cultures of Candida species isolated from vaginal infections. Peptides 2015, 71, 211–221. [Google Scholar] [CrossRef]
- Luo, Y.; McLean, D.T.; Linden, G.J.; McAuley, D.F.; McMullan, R.; Lundy, F.T. The naturally occurring host defense peptide, LL-37, and its truncated mimetics KE-18 and KR-12 have selected biocidal and antibiofilm activities against Candida albicans, Staphylococcus aureus, and Escherichia coli in vitro. Front. Microbiol. 2017, 8, 544. [Google Scholar] [CrossRef]
- Rather, I.A.; Sabir, J.S.M.; Asseri, A.H.; Ali, S. Antifungal activity of human cathelicidin LL-37, a membrane disrupting peptide, by triggering oxidative stress and cell cycle arrest in Candida auris. J. Fungi 2022, 8, 204. [Google Scholar] [CrossRef]
- Troeira Henriques, S.; Lawrence, N.; Chaousis, S.; Ravipati, A.S.; Cheneval, O.; Benfield, A.H.; Elliott, A.G.; Kavanagh, A.M.; Cooper, M.A.; Chan, L.Y.; et al. Redesigned spider peptide with improved antimicrobial and anticancer properties. ACS Chem. Biol. 2017, 12, 2324–2334. [Google Scholar] [CrossRef]
- Rossi, D.C.; Muñoz, J.E.; Carvalho, D.D.; Belmonte, R.; Faintuch, B.; Borelli, P.; Miranda, A.; Taborda, C.P.; Daffre, S. Therapeutic use of a cationic antimicrobial peptide from the spider Acanthoscurria gomesiana in the control of experimental candidiasis. BMC Microbiol. 2012, 12, 28. [Google Scholar] [CrossRef]
- Fázio, M.A.; Oliveira, V.X., Jr.; Bulet, P.; Miranda, M.T.; Daffre, S.; Miranda, A. Structure-activity relationship studies of gomesin: Importance of the disulfide bridges for conformation, bioactivities, and serum stability. Biopolymers 2006, 84, 205–218. [Google Scholar] [CrossRef]
- Moraes, L.G.; Fázio, M.A.; Vieira, R.F.; Nakaie, C.R.; Miranda, M.T.; Schreier, S.; Daffre, S.; Miranda, A. Conformational and functional studies of gomesin analogues by CD, EPR and fluorescence spectroscopies. Biochim. Biophys. Acta 2007, 1768, 52–58. [Google Scholar] [CrossRef] [PubMed]
- Lamberty, M.; Ades, S.; Uttenweiler-Joseph, S.; Brookhart, G.; Bushey, D.; Hoffmann, J.A.; Bulet, P. Insect immunity. Isolation from the lepidopteran Heliothis virescens of a novel insect defensin with potent antifungal activity. J. Biol. Chem. 1999, 274, 9320–9326. [Google Scholar] [CrossRef] [PubMed]
- Landon, C.; Barbault, F.; Legrain, M.; Menin, L.; Guenneugues, M.; Schott, V.; Vovelle, F.; Dimarcq, J.L. Lead optimization of antifungal peptides with 3D NMR structures analysis. Protein Sci. 2004, 13, 703–713. [Google Scholar] [CrossRef] [PubMed]
- Fontana, R.; Mendes, M.A.; de Souza, B.M.; Konno, K.; César, L.M.; Malaspina, O.; Palma, M.S. Jelleines: A family of antimicrobial peptides from the royal jelly of honeybees (Apis mellifera). Peptides 2004, 25, 919–928. [Google Scholar] [CrossRef] [PubMed]
- Jia, F.; Wang, J.; Peng, J.; Zhao, P.; Kong, Z.; Wang, K.; Yan, W.; Wang, R. The in vitro, in vivo antifungal activity and the action mode of Jelleine-I against Candida species. Amino Acids 2018, 50, 229–239. [Google Scholar] [CrossRef]
- Martins, D.B.; Pacca, C.C.; da Silva, A.M.B.; de Souza, B.M.; de Almeida, M.T.G.; Palma, M.S.; Arcisio-Miranda, M.; Dos Santos Cabrera, M.P. Comparing activity, toxicity and model membrane interactions of Jelleine-I and Trp/Arg analogs: Analysis of peptide aggregation. Amino Acids 2020, 52, 725–741. [Google Scholar] [CrossRef]
- Slaninová, J.; Putnová, H.; Borovičková, L.; Šácha, P.; Ceřovský, V.; Monincová, L.; Fučik, V. The antifungal effect of peptides from hymenoptera venom and their analogs. Open Life Sci. 2011, 6, 150–159. [Google Scholar] [CrossRef]
- Kodedová, M.; Sychrová, H. High-throughput fluorescence screening assay for the identification and comparison of antimicrobial peptides’ activity on various yeast species. J. Biotechnol. 2016, 233, 26–33. [Google Scholar] [CrossRef]
- Vrablikova, A.; Czernekova, L.; Cahlikova, R.; Novy, Z.; Petrik, M.; Imran, S.; Novak, Z.; Krupka, M.; Cerovsky, V.; Turanek, J.; et al. Lasioglossins LLIII affect the morphogenesis of Candida albicans and reduces the duration of experimental vaginal candidiasis in mice. Microbiol. Immunol. 2017, 61, 474–481. [Google Scholar] [CrossRef]
- Tan, L.; Bai, L.; Wang, L.; He, L.; Li, G.; Du, W.; Shen, T.; Xiang, Z.; Wu, J.; Liu, Z.; et al. Antifungal activity of spider venom-derived peptide lycosin-I against Candida tropicalis. Microbiol. Res. 2018, 216, 120–128. [Google Scholar] [CrossRef]
- Wang, T.; Xiu, J.; Zhang, Y.; Wu, J.; Ma, X.; Wang, Y.; Guo, G.; Shang, X. Transcriptional responses of Candida albicans to antimicrobial peptide MAF-1A. Front. Microbiol. 2017, 8, 894. [Google Scholar] [CrossRef] [PubMed]
- Cheng, R.; Li, W.; Sample, K.M.; Xu, Q.; Liu, L.; Yu, F.; Nie, Y.; Zhang, X.; Luo, Z. Characterization of the transcriptional response of Candida parapsilosis to the antifungal peptide MAF-1A. PeerJ 2020, 8, e9767. [Google Scholar] [CrossRef] [PubMed]
- Cheng, R.; Xu, Q.; Hu, F.; Li, H.; Yang, B.; Duan, Z.; Zhang, K.; Wu, J.; Li, W.; Luo, Z. Antifungal activity of MAF-1A peptide against Candida albicans. Int. Microbiol. 2021, 24, 233–242. [Google Scholar] [CrossRef] [PubMed]
- Do, N.; Weindl, G.; Grohmann, L.; Salwiczek, M.; Koksch, B.; Korting, H.C.; Schäfer-Korting, M. Cationic membrane-active peptides-anticancer and antifungal activity as well as penetration into human skin. Exp. Dermatol. 2014, 23, 326–331. [Google Scholar] [CrossRef]
- Park, C.; Lee, D.G. Melittin induces apoptotic features in Candida albicans. Biochem. Biophys. Res. Commun. 2010, 394, 170–172. [Google Scholar] [CrossRef]
- Lee, J.; Lee, D.G. Melittin triggers apoptosis in Candida albicans through the reactive oxygen species-mediated mitochondria/caspase-dependent pathway. FEMS Microbiol. Lett. 2014, 355, 36–42. [Google Scholar] [CrossRef]
- Memariani, H.; Memariani, M. Anti-fungal properties and mechanisms of melittin. Appl. Microbiol. Biotechnol. 2020, 104, 6513–6526. [Google Scholar] [CrossRef]
- Dartevelle, P.; Ehlinger, C.; Zaet, A.; Boehler, C.; Rabineau, M.; Westermann, B.; Strub, J.M.; Cianferani, S. D-Cateslytin: A new antifungal agent for the treatment of oral Candida albicans associated infections. Sci. Rep. 2018, 8, 9235. [Google Scholar] [CrossRef]
- Briolat, J.; Wu, S.D.; Mahata, S.K.; Gonthier, B.; Bagnard, D.; Chasserot-Golaz, S.; Helle, K.B.; Aunis, D.; Metz-Boutigue, M.H. New antimicrobial activity for the catecholamine release-inhibitory peptide from chromogranin A. Cell. Mol. Life Sci. 2005, 62, 377–385. [Google Scholar] [CrossRef]
- Mancino, D.; Kharouf, N.; Scavello, F.; Hellé, S.; Salloum-Yared, F.; Mutschler, A.; Mathieu, E.; Lavalle, P.; Metz-Boutigue, M.H.; Haïkel, Y. The catestatin-derived peptides are new actors to fight the development of oral candidosis. Int. J. Mol. Sci. 2022, 23, 2066. [Google Scholar] [CrossRef]
- Savoia, D.; Guerrini, R.; Marzola, E.; Salvadori, S. Synthesis and antimicrobial activity of dermaseptin S1 analogues. Bioorganic Med. Chem. 2008, 16, 8205–8209. [Google Scholar] [CrossRef] [PubMed]
- Mor, A.; Hani, K.; Nicolas, P. The vertebrate peptide antibiotics dermaseptins have overlapping structural features but target specific microorganisms. J. Biol. Chem. 1994, 269, 31635–31641. [Google Scholar] [CrossRef]
- Belmadani, A.; Semlali, A.; Rouabhia, M. Dermaseptin-S1 decreases Candida albicans growth, biofilm formation and the expression of hyphal wall protein 1 and aspartic protease genes. J. Appl. Microbiol. 2018, 125, 72–83. [Google Scholar] [CrossRef] [PubMed]
- Shi, D.; Hou, X.; Wang, L.; Gao, Y.; Wu, D.; Xi, X.; Zhou, M.; Kwok, H.F.; Duan, J.; Chen, T.; et al. Two novel dermaseptin-like antimicrobial peptides with anticancer activities from the skin secretion of Pachymedusa dacnicolor. Toxins 2016, 8, 144. [Google Scholar] [CrossRef]
- Tóth, L.; Kele, Z.; Borics, A.; Nagy, L.G.; Váradi, G.; Virágh, M.; Takó, M.; Vágvölgyi, C.; Galgóczy, L. NFAP2, a novel cysteine-rich anti-yeast protein from Neosartorya fischeri NRRL 181: Isolation and characterization. AMB Express 2016, 6, 75. [Google Scholar] [CrossRef]
- Tóth, L.; Váradi, G.; Borics, A.; Batta, G.; Kele, Z.; Vendrinszky, Á.; Tóth, R.; Ficze, H.; Tóth, G.K.; Vágvölgyi, C.; et al. Anti-Candidal Activity and Functional Mapping of Recombinant and Synthetic Neosartorya fischeri Antifungal Protein 2 (NFAP2). Front. Microbiol. 2018, 9, 393. [Google Scholar] [CrossRef]
- Kovács, R.; Holzknecht, J.; Hargitai, Z.; Papp, C.; Farkas, A.; Borics, A.; Tóth, L.; Váradi, G.; Tóth, G.K.; Kovács, I.; et al. In Vivo applicability of Neosartorya fischeri antifungal protein 2 (NFAP2) in treatment of vulvovaginal candidiasis. Antimicrob. Agents Chemother. 2019, 63, e01777-18. [Google Scholar] [CrossRef]
- Lay, F.T.; Brugliera, F.; Anderson, M.A. Isolation and properties of floral defensins from ornamental tobacco and petunia. Plant Physiol. 2003, 131, 1283–1293. [Google Scholar] [CrossRef]
- van der Weerden, N.L.; Lay, F.T.; Anderson, M.A. The plant defensin, NaD1, enters the cytoplasm of Fusarium oxysporum hyphae. J. Biol. Chem. 2008, 283, 14445–14452. [Google Scholar] [CrossRef]
- Dracatos, P.M.; van der Weerden, N.L.; Carroll, K.T.; Johnson, E.D.; Plummer, K.M.; Anderson, M.A. Inhibition of cereal rust fungi by both class I and II defensins derived from the flowers of Nicotiana alata. Mol. Plant Pathol. 2014, 15, 67–79. [Google Scholar] [CrossRef]
- Poon, I.K.; Baxter, A.A.; Lay, F.T.; Mills, G.D.; Adda, C.G.; Payne, J.A.; Phan, T.K.; Ryan, G.F.; White, J.A.; Veener, P.K.; et al. Phosphoinositide-mediated oligomerization of a defensin induces cell lysis. Elife 2014, 3, e01808. [Google Scholar] [CrossRef] [PubMed]
- Payne, J.A.; Bleackley, M.R.; Lee, T.H.; Shafee, T.M.; Poon, I.K.; Hulett, M.D.; Aguilar, M.I.; van der Weerden, N.L.; Anderson, M.A. The plant defensin NaD1 introduces membrane disorder through a specific interaction with the lipid, phosphatidylinositol 4,5 bisphosphate. Biochim. Biophys. Acta 2016, 1858, 1099–1109. [Google Scholar] [CrossRef]
- Anthony, N.; Darmanin, C.; Bleackley, M.R.; Parisi, K.; Cadenazzi, G.; Holmes, S.; Anderson, M.A.; Nugent, K.A.; Abbey, B. Ptychographic imaging of NaD1 induced yeast cell death. Biomed. Opt. Express 2019, 10, 4964–4974. [Google Scholar] [CrossRef] [PubMed]
- Almeida, M.S.; Cabral, K.M.; Kurtenbach, E.; Almeida, F.C.; Valente, A.P. Solution structure of Pisum sativum defensin 1 by high resolution NMR: Plant defensins, identical backbone with different mechanisms of action. J. Mol. Biol. 2002, 315, 749–757. [Google Scholar] [CrossRef] [PubMed]
- Gonçalves, S.; Teixeira, A.; Abade, J.; de Medeiros, L.N.; Kurtenbach, E.; Santos, N.C. Evaluation of the membrane lipid selectivity of the pea defensin Psd1. Biochim. Biophys. Acta 2012, 1818, 1420–1426. [Google Scholar] [CrossRef] [PubMed]
- Lobo, D.S.; Pereira, I.B.; Fragel-Madeira, L.; Medeiros, L.N.; Cabral, L.M.; Faria, J.; Bellio, M.; Campos, R.C.; Linden, R.; Kurtenbach, E. Antifungal Pisum sativum defensin 1 interacts with Neurospora crassa cyclin F related to the cell cycle. Biochemistry 2007, 46, 987–996. [Google Scholar] [CrossRef]
- Amaral, V.S.G.D.; Santos, S.A.C.S.; de Andrade, P.C.; Nowatzki, J.; Júnior, N.S.; de Medeiros, L.N.; Gitirana, L.B.; Pascutti, P.G.; Almeida, V.H.; Monteiro, R.Q.; et al. Pisum sativum defensin 1 eradicates mouse metastatic lung nodules from B16F10 melanoma cells. Int. J. Mol. Sci. 2020, 21, 2662. [Google Scholar] [CrossRef]
- Prado Montes de Oca, E. Antimicrobial peptide elicitors: New hope for the post-antibiotic era. Innate Immun. 2013, 19, 227–241. [Google Scholar] [CrossRef]
- Bosso, M.; Ständker, L.; Kirchhoff, F.; Münch, J. Exploiting the human peptidome for novel antimicrobial and anticancer agents. Bioorganic Med. Chem. 2018, 26, 2719–2726. [Google Scholar] [CrossRef]
- Okasha, H.; Samir, S.; Nasr, S.M. Purified recombinant human Chromogranin A N46 peptide with remarkable anticancer effect on human colon cancer cells. Bioorganic Chem. 2021, 115, 105266. [Google Scholar] [CrossRef]
- Donato, R.; Cannon, B.R.; Sorci, G.; Riuzzi, F.; Hsu, K.; Weber, D.J.; Geczy, C.L. Functions of S100 proteins. Curr. Mol. Med. 2013, 13, 24–57. [Google Scholar] [CrossRef] [PubMed]
- Leśniak, W.; Graczyk-Jarzynka, A. The S100 proteins in epidermis: Topology and function. Biochim. Biophys. Acta 2015, 1850, 2563–2572. [Google Scholar] [CrossRef] [PubMed]
- Madsen, P.; Rasmussen, H.H.; Leffers, H.; Honoré, B.; Dejgaard, K.; Olsen, E.; Kiil, J.; Walbum, E.; Andersen, A.H.; Basse, B.; et al. Molecular cloning, occurrence, and expression of a novel partially secreted protein “psoriasin” that is highly up-regulated in psoriatic skin. J. Investig. Dermatol. 1991, 97, 701–712. [Google Scholar] [CrossRef] [PubMed]
- Henseler, T.; Christophers, E. Disease concomitance in psoriasis. J. Am. Acad. Dermatol. 1995, 32, 982–986. [Google Scholar] [CrossRef]
- Harder, J.; Schröder, J.M. Psoriatic scales: A promising source for the isolation of human skin-derived antimicrobial proteins. J. Leukoc. Biol. 2005, 77, 476–486. [Google Scholar] [CrossRef]
- Gläser, R.; Harder, J.; Lange, H.; Bartels, J.; Christophers, E.; Schröder, J.M. Antimicrobial psoriasin (S100A7) protects human skin from Escherichia coli infection. Nat. Immunol. 2005, 6, 57–64. [Google Scholar] [CrossRef]
- Mildner, M.; Stichenwirth, M.; Abtin, A.; Eckhart, L.; Sam, C.; Gläser, R.; Schröder, J.M.; Gmeiner, R.; Mlitz, V.; Pammer, J.; et al. Psoriasin (S100A7) is a major Escherichia coli-cidal factor of the female genital tract. Mucosal Immunol. 2010, 3, 602–609. [Google Scholar] [CrossRef]
- Hein, K.Z.; Takahashi, H.; Tsumori, T.; Yasui, Y.; Nanjoh, Y.; Toga, T.; Wu, Z.; Grötzinger, J.; Jung, S.; Wehkamp, J.; et al. Disulphide-reduced psoriasin is a human apoptosis-inducing broad-spectrum fungicide. Proc. Natl. Acad. Sci. USA 2015, 112, 13039–13044. [Google Scholar] [CrossRef]
- Ganz, T.; Lehrer, R.I. Defensins. Curr. Opin. Immunol. 1994, 6, 584–589. [Google Scholar] [CrossRef]
- Huttner, K.M.; Bevins, C.L. Antimicrobial peptides as mediators of epithelial host defense. Pediatr. Res. 1999, 45, 785–794. [Google Scholar] [CrossRef]
- Kagan, B.L.; Ganz, T.; Lehrer, R.I. Defensins: A family of antimicrobial and cytotoxic peptides. Toxicology 1994, 87, 131–149. [Google Scholar] [CrossRef]
- Bauer, F.; Schweimer, K.; Klüver, E.; Conejo-Garcia, J.R.; Forssmann, W.G.; Rösch, P.; Adermann, K.; Sticht, H. Structure determination of human and murine beta-defensins reveals structural conservation in the absence of significant sequence similarity. Protein Sci. 2001, 10, 2470–2479. [Google Scholar] [CrossRef] [PubMed]
- Schneider, J.J.; Unholzer, A.; Schaller, M.; Schäfer-Korting, M.; Korting, H.C. Human defensins. J. Mol. Med. 2005, 83, 587–595. [Google Scholar] [CrossRef] [PubMed]
- Weinberg, A.; Krisanaprakornkit, S.; Dale, B.A. Epithelial antimicrobial peptides: Review and significance for oral applications. Crit. Rev. Oral Biol. Med. 1998, 9, 399–414. [Google Scholar] [CrossRef]
- Mathews, M.; Jia, H.P.; Guthmiller, J.M.; Losh, G.; Graham, S.; Johnson, G.K.; Tack, B.F.; McCray, P.B., Jr. Production of beta-defensin antimicrobial peptides by the oral mucosa and salivary glands. Infect. Immun. 1999, 67, 2740–2745. [Google Scholar] [CrossRef]
- García, J.R.; Jaumann, F.; Schulz, S.; Krause, A.; Rodríguez-Jiménez, J.; Forssmann, U.; Adermann, K.; Klüver, E.; Vogelmeier, C.; Becker, D.; et al. Identification of a novel, multifunctional beta-defensin (human beta-defensin 3) with specific antimicrobial activity. Its interaction with plasma membranes of Xenopus oocytes and the induction of macrophage chemoattraction. Cell Tissue Res. 2001, 306, 257–264. [Google Scholar] [CrossRef]
- Jia, H.P.; Schutte, B.C.; Schudy, A.; Linzmeier, R.; Guthmiller, J.M.; Johnson, G.K.; Tack, B.F.; Mitros, J.P.; Rosenthal, A.; Ganz, T.; et al. Discovery of new human beta-defensins using a genomics-based approach. Gene 2001, 263, 211–218. [Google Scholar]
- García, J.R.; Krause, A.; Schulz, S.; Rodríguez-Jiménez, F.J.; Klüver, E.; Adermann, K.; Forssmann, U.; Frimpong-Boateng, A.; Bals, R.; Forssmann, W.G. Human beta-defensin 4: A novel inducible peptide with a specific salt-sensitive spectrum of antimicrobial activity. FASEB J. 2001, 15, 1819–1821. [Google Scholar] [CrossRef]
- Schroeder, B.O.; Wu, Z.; Nuding, S.; Groscurth, S.; Marcinowski, M.; Beisner, J.; Buchner, J.; Schaller, M.; Stange, E.F.; Wehkamp, J. Reduction of disulphide bonds unmasks potent antimicrobial activity of human β-defensin 1. Nature 2011, 469, 419–423. [Google Scholar] [CrossRef]
- Pazgier, M.; Hoover, D.M.; Yang, D.; Lu, W.; Lubkowski, J. Human beta-defensins. Cell. Mol. Life 2006, 63, 1294–1313. [Google Scholar] [CrossRef]
- Castagnola, M.; Inzitari, R.; Rossetti, D.V.; Olmi, C.; Cabras, T.; Piras, V.; Nicolussi, P.; Sanna, M.T.; Pellegrini, M.; Giardina, B.; et al. A cascade of 24 histatins (histatin 3 fragments) in human saliva. Suggestions for a pre-secretory sequential cleavage pathway. J. Biol. Chem. 2004, 279, 41436–41443. [Google Scholar] [CrossRef]
- Khurshid, Z.; Najeeb, S.; Mali, M.; Moin, S.F.; Raza, S.Q.; Zohaib, S.; Sefat, F.; Zafar, M.S. Histatin peptides: Pharmacological functions and their applications in dentistry. Saudi Pharm. J. 2017, 25, 25–31. [Google Scholar] [CrossRef] [PubMed]
- Johnson, D.A.; Yeh, C.K.; Dodds, M.W. Effect of donor age on the concentrations of histatins in human parotid and submandibular/sublingual saliva. Arch. Oral Biol. 2000, 45, 731–740. [Google Scholar] [CrossRef]
- Campese, M.; Sun, X.; Bosch, J.A.; Oppenheim, F.G.; Helmerhorst, E.J. Concentration and fate of histatins and acidic proline-rich proteins in the oral environment. Arch. Oral Biol. 2009, 54, 345–353. [Google Scholar] [CrossRef]
- Petruzzelli, R.; Clementi, M.E.; Marini, S.; Coletta, M.; Di Stasio, E.; Giardina, B.; Misiti, F. Respiratory inhibition of isolated mammalian mitochondria by salivary antifungal peptide histatin-5. Biochem. Biophys. Res. Commun. 2003, 311, 1034–1040. [Google Scholar] [CrossRef] [PubMed][Green Version]
- Bochenska, O.; Rapala-Kozik, M.; Wolak, N.; Aoki, W.; Ueda, M.; Kozik, A. The action of ten secreted aspartic proteases of pathogenic yeast Candida albicans on major human salivary antimicrobial peptide, histatin 5. Acta Biochim. Pol. 2016, 63, 403–410. [Google Scholar] [CrossRef]
- Ikonomova, S.P.; Moghaddam-Taaheri, P.; Wang, Y.; Doolin, M.T.; Stroka, K.M.; Hube, B.; Karlsson, A.J. Effects of histatin 5 modifications on antifungal activity and kinetics of proteolysis. Protein Sci. 2020, 29, 480–493. [Google Scholar] [CrossRef]
- Moghaddam-Taaheri, P.; Leissa, J.A.; Eppler, H.B.; Jewell, C.M.; Karlsson, A.J. Histatin 5 variant reduces Candida albicans biofilm viability and inhibits biofilm formation. Fungal Genet. Biol. 2021, 149, 103529. [Google Scholar] [CrossRef]
- Zolin, G.V.S.; Fonseca, F.H.D.; Zambom, C.R.; Garrido, S.S. Histatin 5 metallopeptides and their potential against Candida albicans pathogenicity and drug resistance. Biomolecules 2021, 11, 1209. [Google Scholar] [CrossRef]
- McCaslin, T.G.; Pagba, C.V.; Yohannan, J.; Barry, B.A. Specific metallo-protein interactions and antimicrobial activity in Histatin-5, an intrinsically disordered salivary peptide. Sci. Rep. 2019, 9, 17303. [Google Scholar] [CrossRef]
- Burton, M.F.; Steel, P.G. The chemistry and biology of LL-37. Nat. Prod. Rep. 2009, 26, 1572–1584. [Google Scholar] [CrossRef] [PubMed]
- Sørensen, O.E.; Follin, P.; Johnsen, A.H.; Calafat, J.; Tjabringa, G.S.; Hiemstra, P.S.; Borregaard, N. Human cathelicidin, hCAP-18, is processed to the antimicrobial peptide LL-37 by extracellular cleavage with proteinase 3. Blood 2001, 97, 3951–3959. [Google Scholar] [CrossRef]
- Zanetti, M. Cathelicidins, multifunctional peptides of the innate immunity. J. Leukoc. Biol. 2004, 75, 39–48. [Google Scholar] [CrossRef]
- Zanetti, M. The role of cathelicidins in the innate host defenses of mammals. Curr. Issues Mol. Biol. 2005, 7, 179–196. [Google Scholar] [PubMed]
- Vandamme, D.; Landuyt, B.; Luyten, W.; Schoofs, L. A comprehensive summary of LL-37, the factotum human cathelicidin peptide. Cell. Immunol. 2012, 280, 22–35. [Google Scholar] [CrossRef]
- Ciornei, C.D.; Sigurdardóttir, T.; Schmidtchen, A.; Bodelsson, M. Antimicrobial and chemoattractant activity, lipopolysaccharide neutralization, cytotoxicity, and inhibition by serum of analogs of human cathelicidin LL-37. Antimicrob. Agents Chemother. 2005, 49, 2845–2850. [Google Scholar] [CrossRef] [PubMed]
- Kai-Larsen, Y.; Agerberth, B. The role of the multifunctional peptide LL-37 in host defense. Front. Biosci. 2008, 13, 3760–3767. [Google Scholar] [CrossRef]
- Nijnik, A.; Hancock, R.E. The roles of cathelicidin LL-37 in immune defences and novel clinical applications. Curr. Opin. Hematol. 2009, 16, 41–47. [Google Scholar] [CrossRef]
- Bowdish, D.M.; Davidson, D.J.; Scott, M.G.; Hancock, R.E. Immunomodulatory activities of small host defense peptides. Antimicrob. Agents Chemother. 2005, 49, 1727–1732. [Google Scholar] [CrossRef]
- Overhage, J.; Campisano, A.; Bains, M.; Torfs, E.C.; Rehm, B.H.; Hancock, R.E. Human host defense peptide LL-37 prevents bacterial biofilm formation. Infect. Immun. 2008, 76, 4176–4182. [Google Scholar] [CrossRef]
- Murakami, M.; Ohtake, T.; Dorschner, R.A.; Schittek, B.; Garbe, C.; Gallo, R.L. Cathelicidin anti-microbial peptide expression in sweat, an innate defense system for the skin. J. Investig. Dermatol. 2002, 119, 1090–1095. [Google Scholar] [CrossRef]
- Lippross, S.; Klueter, T.; Steubesand, N.; Oestern, S.; Mentlein, R.; Hildebrandt, F.; Podschun, R.; Pufe, T.; Seekamp, A.; Varoga, D. Multiple trauma induces serum production of host defence peptides. Injury 2012, 43, 137–142. [Google Scholar] [CrossRef] [PubMed]
- Reinholz, M.; Ruzicka, T.; Schauber, J. Cathelicidin LL-37: An antimicrobial peptide with a role in inflammatory skin disease. Ann. Dermatol. 2012, 24, 126–135. [Google Scholar] [CrossRef] [PubMed]
- Turner, J.; Cho, Y.; Dinh, N.N.; Waring, A.J.; Lehrer, R.I. Activities of LL-37, a cathelin-associated antimicrobial peptide of human neutrophils. Antimicrob. Agents Chemother. 1998, 42, 2206–2214. [Google Scholar] [CrossRef]
- Henzler-Wildman, K.A.; Martinez, G.V.; Brown, M.F.; Ramamoorthy, A. Perturbation of the hydrophobic core of lipid bilayers by the human antimicrobial peptide LL-37. Biochemistry 2004, 43, 8459–8469. [Google Scholar] [CrossRef] [PubMed]
- Rapala-Kozik, M.; Bochenska, O.; Zawrotniak, M.; Wolak, N.; Trebacz, G.; Gogol, M.; Ostrowska, D.; Aoki, W.; Ueda, M.; Kozik, A. Inactivation of the antifungal and immunomodulatory properties of human cathelicidin LL-37 by aspartic proteases produced by the pathogenic yeast Candida albicans. Infect. Immun. 2015, 83, 2518–2530. [Google Scholar] [CrossRef] [PubMed]
- Murakami, M.; Lopez-Garcia, B.; Braff, M.; Dorschner, R.A.; Gallo, R.L. Postsecretory processing generates multiple cathelicidins for enhanced topical antimicrobial defense. J. Immunol. 2004, 172, 3070–3077. [Google Scholar] [CrossRef]
- López-García, B.; Lee, P.H.; Yamasaki, K.; Gallo, R.L. Anti-fungal activity of cathelicidins and their potential role in Candida albicans skin infection. J. Investig. Dermatol. 2005, 125, 108–115. [Google Scholar] [CrossRef]
- Wu, W.K.; Wang, G.; Coffelt, S.B.; Betancourt, A.M.; Lee, C.W.; Fan, D.; Wu, K.; Yu, J.; Sung, J.J.; Cho, C.H. Emerging roles of the host defense peptide LL-37 in human cancer and its potential therapeutic applications. Int. J. Cancer 2010, 127, 1741–1747. [Google Scholar] [CrossRef]
- Li, X.; Li, Y.; Han, H.; Miller, D.W.; Wang, G. Solution structures of human LL-37 fragments and NMR-based identification of a minimal membrane-targeting antimicrobial and anticancer region. J. Am. Chem. Soc. 2006, 128, 5776–5785. [Google Scholar] [CrossRef]
- Rico-Mata, R.; De Leon-Rodriguez, L.M.; Avila, E.E. Effect of antimicrobial peptides derived from human cathelicidin LL-37 on Entamoeba histolytica trophozoites. Exp. Parasitol. 2013, 133, 300–306. [Google Scholar] [CrossRef] [PubMed]
- Bulet, P.; Hetru, C.; Dimarcq, J.L.; Hoffmann, D. Antimicrobial peptides in insects; structure and function. Dev. Comp. Immunol. 1999, 23, 329–344. [Google Scholar] [CrossRef]
- Silva, P.I., Jr.; Daffre, S.; Bulet, P. Isolation and characterization of gomesin, an 18-residue cysteine-rich defense peptide from the spider Acanthoscurria gomesiana hemocytes with sequence similarities to horseshoe crab antimicrobial peptides of the tachyplesin family. J. Biol. Chem. 2000, 275, 33464–33470. [Google Scholar] [CrossRef]
- Fukuzawa, A.H.; Vellutini, B.C.; Lorenzini, D.M.; Silva, P.I., Jr.; Mortara, R.A.; da Silva, J.M.; Daffre, S. The role of hemocytes in the immunity of the spider Acanthoscurria gomesiana. Dev. Comp. Immunol. 2008, 32, 716–725. [Google Scholar] [CrossRef]
- Mandard, N.; Sy, D.; Maufrais, C.; Bonmatin, J.M.; Bulet, P.; Hetru, C.; Vovelle, F. Androctonin, a novel antimicrobial peptide from scorpion Androctonus australis: Solution structure and molecular dynamics simulations in the presence of a lipid monolayer. J. Biomol. Struct. Dyn. 1999, 17, 367–380. [Google Scholar] [CrossRef] [PubMed]
- Nakamura, T.; Furunaka, H.; Miyata, T.; Tokunaga, F.; Muta, T.; Iwanaga, S.; Niwa, M.; Takao, T.; Shimonishi, Y. Tachyplesin, a class of antimicrobial peptide from the hemocytes of the horseshoe crab (Tachypleus tridentatus). Isolation and chemical structure. J. Biol. Chem. 1988, 263, 16709–16713. [Google Scholar] [CrossRef]
- Miyata, T.; Tokunaga, F.; Yoneya, T.; Yoshikawa, K.; Iwanaga, S.; Niwa, M.; Takao, T.; Shimonishi, Y. Antimicrobial peptides, isolated from horseshoe crab hemocytes, tachyplesin II, and polyphemusins I and II: Chemical structures and biological activity. J. Biochem. 1989, 106, 663–668. [Google Scholar] [CrossRef]
- Kokryakov, V.N.; Harwig, S.S.; Panyutich, E.A.; Shevchenko, A.A.; Aleshina, G.M.; Shamova, O.V.; Korneva, H.A.; Lehrer, R.I. Protegrins: Leukocyte antimicrobial peptides that combine features of corticostatic defensins and tachyplesins. FEBS Lett. 1993, 327, 231–236. [Google Scholar] [CrossRef]
- Fernandez-Rojo, M.A.; Deplazes, E.; Pineda, S.S.; Brust, A.; Marth, T.; Wilhelm, P.; Martel, N.; Ramm, G.A.; Mancera, R.L.; Alewood, P.F.; et al. Gomesin peptides prevent proliferation and lead to the cell death of devil facial tumour disease cells. Cell Death Discov. 2018, 4, 19. [Google Scholar] [CrossRef]
- Barbosa, F.M.; Daffre, S.; Maldonado, R.A.; Miranda, A.; Nimrichter, L.; Rodrigues, M.L. Gomesin, a peptide produced by the spider Acanthoscurria gomesiana, is a potent anticryptococcal agent that acts in synergism with fluconazole. FEMS Microbiol. Lett. 2007, 274, 279–286. [Google Scholar] [CrossRef]
- Moreira, C.K.; Rodrigues, F.G.; Ghosh, A.; Varotti Fde, P.; Miranda, A.; Daffre, S.; Jacobs-Lorena, M.; Moreira, L.A. Effect of the antimicrobial peptide gomesin against different life stages of Plasmodium spp. Exp. Parasitol. 2007, 116, 346–353. [Google Scholar] [CrossRef] [PubMed]
- Rodrigues, E.G.; Dobroff, A.S.; Cavarsan, C.F.; Paschoalin, T.; Nimrichter, L.; Mortara, R.A.; Santos, E.L.; Fázio, M.A.; Miranda, A.; Daffre, S.; et al. Effective topical treatment of subcutaneous murine B16F10-Nex2 melanoma by the antimicrobial peptide gomesin. Neoplasia 2008, 10, 61–68. [Google Scholar] [CrossRef] [PubMed]
- Soletti, R.C.; del Barrio, L.; Daffre, S.; Miranda, A.; Borges, H.L.; Moura-Neto, V.; Lopez, M.G.; Gabilan, N.H. Peptide gomesin triggers cell death through L-type channel calcium influx, MAPK/ERK, PKC and PI3K signaling and generation of reactive oxygen species. Chem. Biol. Interact. 2010, 186, 135–143. [Google Scholar] [CrossRef]
- Tanner, J.D.; Deplazes, E.; Mancera, R.L. The biological and biophysical properties of the spider peptide gomesin. Molecules 2018, 23, 1733. [Google Scholar] [CrossRef]
- Domingues, T.M.; Riske, K.A.; Miranda, A. Revealing the lytic mechanism of the antimicrobial peptide gomesin by observing giant unilamellar vesicles. Langmuir 2010, 26, 11077–11084. [Google Scholar] [CrossRef]
- Buri, M.V.; Domingues, T.M.; Paredes-Gamero, E.J.; Casaes-Rodrigues, R.L.; Rodrigues, E.G.; Miranda, A. Resistance to degradation and cellular distribution are important features for the antitumor activity of gomesin. PLoS ONE 2013, 8, e80924. [Google Scholar] [CrossRef] [PubMed]
- Zhang, S.; Fu, L.; Wan, M.; Song, J.; Gao, L.; Fang, W. Peripheral antimicrobial peptide gomesin induces membrane protrusion, folding, and laceration. Langmuir 2019, 35, 13233–13242. [Google Scholar] [CrossRef]
- Fázio, M.A.; Jouvensal, L.; Vovelle, F.; Bulet, P.; Miranda, M.T.; Daffre, S.; Miranda, A. Biological and structural characterization of new linear gomesin analogues with improved therapeutic indices. Biopolymers 2007, 88, 386–400. [Google Scholar] [CrossRef]
- Chan, L.Y.; Zhang, V.M.; Huang, Y.H.; Waters, N.C.; Bansal, P.S.; Craik, D.J.; Daly, N.L. Cyclization of the antimicrobial peptide gomesin with native chemical ligation: Influences on stability and bioactivity. Chembiochem 2013, 14, 617–624. [Google Scholar] [CrossRef]
- Lamberty, M.; Caille, A.; Landon, C.; Tassin-Moindrot, S.; Hetru, C.; Bulet, P.; Vovelle, F. Solution structures of the antifungal heliomicin and a selected variant with both antibacterial and antifungal activities. Biochemistry 2001, 40, 11995–12003. [Google Scholar] [CrossRef]
- Fehlbaum, P.; Bulet, P.; Michaut, L.; Lagueux, M.; Broekaert, W.F.; Hetru, C.; Hoffmann, J.A. Insect immunity. Septic injury of Drosophila induces the synthesis of a potent antifungal peptide with sequence homology to plant antifungal peptides. J. Biol. Chem. 1994, 269, 33159–33163. [Google Scholar] [CrossRef]
- Andrès, E. Cationic antimicrobial peptides in clinical development, with special focus on thanatin and heliomicin. Eur. J. Clin. Microbiol. 2012, 31, 881–888. [Google Scholar] [CrossRef] [PubMed]
- Aumer, T.; Voisin, S.N.; Knobloch, T.; Landon, C.; Bulet, P. Impact of an antifungal insect defensin on the proteome of the phytopathogenic fungus Botrytis cinerea. J. Proteome Res. 2020, 19, 1131–1146. [Google Scholar] [CrossRef] [PubMed]
- Cabrera, M.P.; Baldissera, G.; Silva-Gonçalves Lda, C.; Souza, B.M.; Riske, K.A.; Palma, M.S.; Ruggiero, J.R.; Arcisio-Miranda, M. Combining experimental evidence and molecular dynamic simulations to understand the mechanism of action of the antimicrobial octapeptide jelleine-I. Biochemistry 2014, 53, 4857–4868. [Google Scholar] [CrossRef] [PubMed]
- Fujiwara, S.; Imai, J.; Fujiwara, M.; Yaeshima, T.; Kawashima, T.; Kobayashi, K. A potent antibacterial protein in royal jelly. Purification and determination of the primary structure of royalisin. J. Biol. Chem. 1990, 265, 11333–11337. [Google Scholar] [CrossRef]
- Jia, F.; Zhang, Y.; Wang, J.; Peng, J.; Zhao, P.; Zhang, L.; Yao, H.; Ni, J.; Wang, K. The effect of halogenation on the antimicrobial activity, antibiofilm activity, cytotoxicity and proteolytic stability of the antimicrobial peptide Jelleine-I. Peptides 2019, 112, 56–66. [Google Scholar] [CrossRef]
- Zhou, J.; Zhang, L.; He, Y.; Liu, K.; Zhang, F.; Zhang, H.; Lu, Y.; Yang, C.; Wang, Z.; Fareed, M.S.; et al. An optimized analog of antimicrobial peptide Jelleine-1 shows enhanced antimicrobial activity against multidrug resistant P. aeruginosa and negligible toxicity in vitro and in vivo. Eur. J. Med. Chem. 2021, 219, 113433. [Google Scholar] [CrossRef]
- Cerovský, V.; Budesínský, M.; Hovorka, O.; Cvacka, J.; Voburka, Z.; Slaninová, J.; Borovičková, L.; Fucík, V.; Bednárová, L.; Votruba, I.; et al. Lasioglossins: Three novel antimicrobial peptides from the venom of the eusocial bee Lasioglossum laticeps (Hymenoptera: Halictidae). Chembiochem 2009, 10, 2089–2099. [Google Scholar] [CrossRef]
- Slaninová, J.; Mlsová, V.; Kroupová, H.; Alán, L.; Tůmová, T.; Monincová, L.; Borovičková, L.; Fučik, V.; Ceřovský, V. Toxicity study of antimicrobial peptides from wild bee venom and their analogs toward mammalian normal and cancer cells. Peptides 2012, 33, 18–26. [Google Scholar] [CrossRef]
- Battista, F.; Oliva, R.; Del Vecchio, P.; Winter, R.; Petraccone, L. Insights into the action mechanism of the antimicrobial peptide lasioglossin III. Int. J. Mol. Sci. 2021, 22, 2857. [Google Scholar] [CrossRef]
- Bandyopadhyay, S.; Lee, M.; Sivaraman, J.; Chatterjee, C. Model membrane interaction and DNA-binding of antimicrobial peptide Lasioglossin II derived from bee venom. Biochem. Biophys. Res. Commun. 2013, 430, 1–6. [Google Scholar] [CrossRef] [PubMed]
- Vaňková, E.; Kašparová, P.; Dulíčková, N.; Čeřovský, V. Combined effect of lasioglossin LL-III derivative with azoles against Candida albicans virulence factors: Biofilm formation, phospholipases, proteases and hemolytic activity. FEMS Yeast Res. 2020, 20, foaa020. [Google Scholar] [CrossRef] [PubMed]
- Liu, Z.; Deng, M.; Xiang, J.; Ma, H.; Hu, W.; Zhao, Y.; Li, D.W.; Liang, S. A novel spider peptide toxin suppresses tumor growth through dual signaling pathways. Curr. Mol. Med. 2012, 12, 1350–1360. [Google Scholar] [CrossRef]
- Shen, H.; Xie, Y.; Ye, S.; He, K.; Yi, L.; Cui, R. Spider peptide toxin lycosin-I induces apoptosis and inhibits migration of prostate cancer cells. Exp. Biol. Med. 2018, 243, 725–735. [Google Scholar] [CrossRef] [PubMed]
- Zhang, P.; Ma, J.; Yan, Y.; Chen, B.; Liu, B.; Jian, C.; Zhu, B.; Liang, S.; Zeng, Y.; Liu, Z. Arginine modification of lycosin-I to improve inhibitory activity against cancer cells. Org. Biomol. Chem. 2017, 15, 9379–9388. [Google Scholar] [CrossRef]
- Tan, H.; Ding, X.; Meng, S.; Liu, C.; Wang, H.; Xia, L.; Liu, Z.; Liang, S. Antimicrobial potential of lycosin-I, a cationic and amphiphilic peptide from the venom of the spider Lycosa singorensis. Curr. Mol. Med. 2013, 13, 900–910. [Google Scholar] [CrossRef]
- Tang, Y.; Hou, S.; Li, X.; Wu, M.; Ma, B.; Wang, Z.; Jiang, J.; Deng, M.; Duan, Z.; Tang, X.; et al. Anti-parasitic effect on Toxoplasma gondii induced by a spider peptide lycosin-I. Exp. Parasitol. 2019, 198, 17–25. [Google Scholar] [CrossRef]
- Wang, L.; Wang, Y.J.; Liu, Y.Y.; Li, H.; Guo, L.X.; Liu, Z.H.; Shi, X.L.; Hu, M. In vitro potential of Lycosin-I as an alternative antimicrobial drug for treatment of multidrug-resistant Acinetobacter baumannii infections. Antimicrob. Agents Chemother. 2014, 58, 6999–7002. [Google Scholar] [CrossRef]
- Wang, Y.; Wang, L.; Yang, H.; Xiao, H.; Farooq, A.; Liu, Z.; Hu, M.; Shi, X. The spider venom peptide lycosin-II has potent antimicrobial activity against clinically isolated bacteria. Toxins 2016, 8, 119. [Google Scholar] [CrossRef]
- Zhou, J.; Kong, L.; Fang, N.; Mao, B.; Ai, H. Synthesis and functional characterization of MAF-1A peptide derived from the larvae of housefly, Musca domestica (Diptera: Muscidae). J. Med. Entomol. 2016, 53, 1467–1472. [Google Scholar] [CrossRef]
- Cerovský, V.; Hovorka, O.; Cvacka, J.; Voburka, Z.; Bednárová, L.; Borovicková, L.; Slaninová, J.; Fucík, V. Melectin: A novel antimicrobial peptide from the venom of the cleptoparasitic bee Melecta albifrons. ChemBioChem 2008, 9, 2815–2821. [Google Scholar] [CrossRef] [PubMed]
- Kocourková, L.; Novotná, P.; Čujová, S.; Čeřovský, V.; Urbanová, M.; Setnička, V. Conformational study of melectin and antapin antimicrobial peptides in model membrane environments. Spectrochim. Acta Part A Mol. Biomol. Spectrosc. 2017, 170, 247–255. [Google Scholar] [CrossRef] [PubMed]
- Liang, X.; Yan, J.; Lu, Y.; Liu, S.; Chai, X. The antimicrobial peptide melectin shows both antimicrobial and antitumor activity via membrane interference and DNA binding. Drug Des. Dev. Ther. 2021, 15, 1261–1273. [Google Scholar] [CrossRef]
- Habermann, E. Bee and wasp venoms. Science 1972, 177, 314–322. [Google Scholar] [CrossRef]
- Matsuzaki, K.; Yoneyama, S.; Miyajima, K. Pore formation and translocation of melittin. Biophys. J. 1997, 73, 831–838. [Google Scholar] [CrossRef]
- Lee, M.T.; Sun, T.L.; Hung, W.C.; Huang, H.W. Process of inducing pores in membranes by melittin. Proc. Natl. Acad. Sci. USA 2013, 110, 14243–14248. [Google Scholar] [CrossRef]
- Guilhelmelli, F.; Vilela, N.; Albuquerque, P.; Derengowski, L.D.S.; Silva-Pereira, I.; Kyaw, C.M. Antibiotic development challenges: The various mechanisms of action of antimicrobial peptides and of bacterial resistance. Front. Microbiol. 2013, 4, 353. [Google Scholar] [CrossRef]
- Mahata, S.K.; O’Connor, D.T.; Mahata, M.; Yoo, S.H.; Taupenot, L.; Wu, H.; Gill, B.M.; Parmer, R.J. Novel autocrine feedback control of catecholamine release. A discrete chromogranin a fragment is a noncompetitive nicotinic cholinergic antagonist. J. Clin. Investig. 1997, 100, 1623–1633. [Google Scholar] [CrossRef] [PubMed]
- Blaschko, H.; Comline, R.S.; Schneider, F.H.; Silver, M.; Smith, A.D. Secretion of a chromaffin granule protein, chromogranin, from the adrenal gland after splanchnic stimulation. Nature 1967, 215, 58–59. [Google Scholar] [CrossRef]
- Helle, K.B. Regulatory peptides from chromogranin A and secretogranin II: Putative modulators of cells and tissues involved in inflammatory conditions. Regul. Pept. 2010, 165, 45–51. [Google Scholar] [CrossRef]
- Murray, S.S.; Deaven, L.L.; Burton, D.W.; O’Connor, D.I.; Mellon, P.L.; Deftos, L.J. The gene for human chromogranin A (CgA) is located on chromosome 14. Biochem. Biophys. Res. Commun. 1987, 142, 141–146. [Google Scholar] [CrossRef]
- Metz-Boutigue, M.H.; Garcia-Sablone, P.; Hogue-Angeletti, R.; Aunis, D. Intracellular and extracellular processing of chromogranin A. Determination of cleavage sites. Eur. J. Biochem. 1993, 217, 247–257. [Google Scholar] [CrossRef] [PubMed]
- Aslam, R.; Atindehou, M.; Lavaux, T.; Haïkel, Y.; Schneider, F.; Metz-Boutigue, M.H. Chromogranin A-derived peptides are involved in innate immunity. Curr. Med. Chem. 2012, 19, 4115–4123. [Google Scholar] [CrossRef] [PubMed]
- D’amico, M.A.; Ghinassi, B.; Izzicupo, P.; Manzoli, L.; Di Baldassarre, A. Biological function and clinical relevance of chromogranin A and derived peptides. Endocr. Connect. 2014, 3, R45–R54. [Google Scholar] [CrossRef]
- Jean-François, F.; Castano, S.; Desbat, B.; Odaert, B.; Roux, M.; Metz-Boutigue, M.H.; Dufourc, E.J. Aggregation of cateslytin beta-sheets on negatively charged lipids promotes rigid membrane domains. A new mode of action for antimicrobial peptides? Biochemistry 2008, 47, 6394–6402. [Google Scholar] [CrossRef]
- Jean-François, F.; Elezgaray, J.; Berson, P.; Vacher, P.; Dufourc, E.J. Pore formation induced by an antimicrobial peptide: Electrostatic effects. Biophys. J. 2008, 95, 5748–5756. [Google Scholar] [CrossRef]
- Jean-François, F.; Desbat, B.; Dufourc, E.J. Selectivity of cateslytin for fungi: The role of acidic lipid-ergosterol membrane fluidity in antimicrobial action. FASEB J. 2009, 23, 3692–3701. [Google Scholar] [CrossRef]
- Aslam, R.; Marban, C.; Corazzol, C.; Jehl, F.; Delalande, F.; Van Dorsselaer, A.; Prévost, G.; Haïkel, Y.; Taddei, C.; Schneider, F.; et al. Cateslytin, a chromogranin A derived peptide is active against Staphylococcus aureus and resistant to degradation by its proteases. PLoS ONE 2013, 8, e68993. [Google Scholar] [CrossRef]
- Zaet, A.; Dartevelle, P.; Daouad, F.; Ehlinger, C.; Quilés, F.; Francius, G.; Boehler, C.; Bergthold, C.; Frisch, B.; Prévost, G.; et al. D-Cateslytin, a new antimicrobial peptide with therapeutic potential. Sci. Rep. 2017, 7, 15199. [Google Scholar] [CrossRef]
- Shai, Y. Mode of action of membrane active antimicrobial peptides. Biopolymers 2002, 66, 236–248. [Google Scholar] [CrossRef]
- Xu, X.; Lai, R. The chemistry and biological activities of peptides from amphibian skin secretions. Chem. Rev. 2015, 115, 1760–1846. [Google Scholar] [CrossRef] [PubMed]
- Gibson, B.W.; Tang, D.Z.; Mandrell, R.; Kelly, M.; Spindel, E.R. Bombinin-like peptides with antimicrobial activity from skin secretions of the Asian toad, Bombina orientalis. J. Biol. Chem. 1991, 266, 23103–23111. [Google Scholar] [CrossRef]
- Zasloff, M. Magainins, a class of antimicrobial peptides from Xenopus skin: Isolation, characterization of two active forms, and partial cDNA sequence of a precursor. Proc. Natl. Acad. Sci. USA 1987, 84, 5449–5453. [Google Scholar] [CrossRef] [PubMed]
- Simmaco, M.; Mignogna, G.; Barra, D.; Bossa, F. Antimicrobial peptides from skin secretions of Rana esculenta. Molecular cloning of cDNAs encoding esculentin and brevinins and isolation of new active peptides. J. Biol. Chem. 1994, 269, 11956–11961. [Google Scholar] [CrossRef]
- Amiche, M.; Seon, A.A.; Wroblewski, H.; Nicolas, P. Isolation of dermatoxin from frog skin, an antibacterial peptide encoded by a novel member of the dermaseptin genes family. Eur. J. Biochem. 2000, 267, 4583–4592. [Google Scholar] [CrossRef]
- Amiche, M.; Ladram, A.; Nicolas, P. A consistent nomenclature of antimicrobial peptides isolated from frogs of the subfamily Phyllomedusinae. Peptides 2008, 29, 2074–2082. [Google Scholar] [CrossRef]
- Brand, G.D.; Leite, J.R.; Silva, L.P.; Albuquerque, S.; Prates, M.V.; Azevedo, R.B.; Carregaro, V.; Silva, J.S.; Sá, V.C.; Brandão, R.A.; et al. Dermaseptins from Phyllomedusa oreades and Phyllomedusa distincta. Anti-Trypanosoma cruzi activity without cytotoxicity to mammalian cells. J. Biol. Chem. 2002, 277, 49332–49340. [Google Scholar] [CrossRef]
- Biggin, P.C.; Sansom, M.S. Interactions of alpha-helices with lipid bilayers: A review of simulation studies. Biophys. Chem. 1999, 76, 161–183. [Google Scholar] [CrossRef]
- Samot, J.; Rouabhia, M. Effect of Dermaseptin S4 on C. albicans Growth and EAP1 and HWP1 gene expression. Probiotics Antimicrob. Proteins 2021, 13, 287–298. [Google Scholar] [CrossRef]
- Kovács, L.; Virágh, M.; Takó, M.; Papp, T.; Vágvölgyi, C.; Galgóczy, L. Isolation and characterization of Neosartorya fischeri antifungal protein (NFAP). Peptides 2011, 32, 1724–1731. [Google Scholar] [CrossRef]
- Virágh, M.; Vörös, D.; Kele, Z.; Kovács, L.; Fizil, Á.; Lakatos, G.; Maróti, G.; Batta, G.; Vágvölgyi, C.; Galgóczy, L. Production of a defensin-like antifungal protein NFAP from Neosartorya fischeri in Pichia pastoris and its antifungal activity against filamentous fungal isolates from human infections. Protein Expr. Purif. 2014, 94, 79–84. [Google Scholar] [CrossRef]
- Drayton, M.; Kizhakkedathu, J.N.; Straus, S.K. Towards robust delivery of antimicrobial peptides to combat bacterial resistance. Molecules 2020, 25, 3048. [Google Scholar] [CrossRef]
- Fernández de Ullivarri, M.; Arbulu, S.; Garcia-Gutierrez, E.; Cotter, P.D. Antifungal Peptides as Therapeutic Agents. Front. Cell. Infect. Microbiol. 2020, 10, 105. [Google Scholar] [CrossRef]
Origin of Peptide | Name of Peptide | Sequence of Peptide | Number of aa | |
---|---|---|---|---|
Plants | Heuchera sanguinea (coral bell) | HsAFP1 | DGVKLCDVPSGTWSGHCGSSSKCSQQCKDREHFAYGGACHYQFPSVKCFCKRQC | 54 |
Nicotiana alata flowers (tobacco plant) | NaD1 | RECKTESNTFPGICITKPPCRKACISEKFTDGHCSKILRRCLCTKPC | 47 | |
Pisum sativum seeds (pea) | Psd1 | KTCEHLADTYRGVCFTNASCDDHCKNKAHLISGTCHNWKCFCTQNC | 46 | |
Raphanus sativus | RsAFP2 | QKLCQRPSGTWSGVCGNNNACKNQCIRLEKARHGSCNYVFPAHKCICYFPC | 51 | |
Human | Homo sapiens | CGA-N46 | PMPVSQECFETLRGHERILSILRHQNLLKELQDLALQGAKERAHQQ | 46 |
Psoriasin | MSNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ | 101 | ||
β-Defensin-1 | DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK | 36 | ||
β-Defensin-2 | GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP | 39 | ||
β-Defensin-3 | GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK | 45 | ||
β-Defensin-4 | EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP | 50 | ||
Histatin-5 | DSHAKRHHGYKRKFHEKHHSHRGY | 24 | ||
LL-37 | [LL-37, 37 aa] | 37 | ||
Insects and arachnids | Acanthoscurria gomesiana (spider) | Gomesin | ZCRRLCYKQRCVTYCRGR | 18 |
Heliothis virescens (lepidopteran) | Heliomicin | DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET | 44 | |
Royal Jelly of Apis mellifera (honeybee) | Jelleine-I | PFKISIHL | 8 | |
Jelleine-II | TPFKISIHL | 9 | ||
Jelleine-III | EPFKISIHL | 9 | ||
Jelleine-IV | TPFKISIH | 8 | ||
Lasioglossum laticeps venom (bee) | Lasioglossin I | VNWKKVLGKIIKVAK | 15 | |
Lasioglossin II | VNWKKILGKIIKVAK | 15 | ||
Lasioglossin III | VNWKKILGKIIKVVK | 15 | ||
Lycosa singoriensis venom (spider) | Lycosin-I | KGWFKAMKSIAKFIAKEKLKEHL | 23 | |
Musca domestica (housefly) | MAF-1A | KKFKETADKLIESAKQQLESLAKEMK | 26 | |
Insects and arachnids | Melecta albifrons venom (bee) | Melectin | GFLSILKKVLPKVMAHMK | 18 |
Melittin | GIGAVLKVLTTGLPALISWIKRKRQQ | 26 | ||
Bovine | Bovine cateslytin | RSMRLSFRARGYGFR | 15 | |
Amphibian skin | Phyllomedusinae frogs (leaf frogs) | Dermaseptin DS-1 | ALWKTMLKKLGTMALHAGKAALGAAADTISQGTQ | 34 |
Dermaseptin PD-1 | GMWSKIKETAMAAAKEAAKAAGKTISDMIKQ | 33 | ||
Dermaseptin PD-2 | GMWSKIKNAGKAAAKAAAKAAGKAALDAVSEAI | 33 | ||
Filamentous fungi | Neosartorya fischeri | NFAP2 | IATSPYYACNCPNNCKHKKGSGCKYHSGPSDKSKVISGKCEWQGGQLNCIAT | 52 |
Origin of Peptide | Name of Peptide | Sensitive Candida Species | Target Cell Type | MIC Range (µM) * | References |
---|---|---|---|---|---|
Plants | HsAFP1 | C. albicans, C. krusei | Planktonic and sessile | 10 | [12,17,19,20] |
NaD1 | C. albicans | Planktonic | 2 | [21,22] | |
Psd1 | C. albicans | Planktonic and sessile | 10–20 | [23,24] | |
RsAFP2 | C. albicans, C. tropicalis, C. parapsilosis, C. krusei, C. dubliniensis | Planktonic and sessile | 5–10 | [12,14,25,26,27,28,29,30,31] | |
Human | CGA-N46 | C. albicans, C. glabrata, C. parapsilosis, C. krusei, C. tropicalis | Planktonic | 100–800 | [32,33,34,35] |
Psoriasin | C. albicans | Sessile | - | [36] | |
β-Defensin-2 | C. albicans | Planktonic | 0.9–13.8 | [37,38,39,40,41,42,43] | |
β-Defensin-3 | C. albicans | Planktonic and sessile | 0.3–6.6 | [37,39,40,41,43,44,45] | |
Human | Histatin-5 | C. albicans, C. auris, C. parapsilosis, C. krusei, C. tropicalis, C. guilliermondii | Planktonic and sessile | 1.6–50 | [46,47,48,49,50,51,52,53,54,55,56,57,58,59,60,61,62,63,64,65,66,67] |
LL-37 | C. albicans, C. auris | Planktonic and sessile | 0.8–100 | [45,67,68,69,70,71,72,73,74,75,76,77] | |
Insects and arachnids | Gomesin | C. albicans | Planktonic | 0.32–16 | [78,79,80,81] |
Heliomicin | C. albicans | Planktonic | 2.5- > 50 | [82,83] | |
Jelleine-I | C. albicans, C. glabrata, C. parapsilosis, C. tropicalis, C. krusei, | Planktonic | 2.5–64 | [84,85,86] | |
Jelleine-II | C. albicans | Planktonic | 2.5 | [84] | |
Lasioglossin III | C. albicans, C. glabrata, C. krusei, C. tropicalis, C. dubliniensis | Planktonic and sessile | 0.2–11.5 | [87,88,89] | |
Lycosin-I | C. albicans, C. parapsilosis, C. krusei, C. tropicalis | Planktonic and sessile | 8–256 | [90] | |
MAF-1A | C. albicans | Planktonic | 0.18–35 | [91,92,93] | |
Melectin | C. albicans | Planktonic | 6.5–10.1 | [87] | |
Melittin | C. albicans | Planktonic | 0.4–3.5 | [94,95,96,97] | |
Bovine | Bovine cateslytin | C. albicans, C. glabrata, C. tropicalis | Planktonic | 1.2–8 | [98,99,100] |
Amphibian skin | Dermaseptin DS-1 | C. albicans | Planktonic and sessile | 10- > 24 | [101,102,103] |
Dermaseptin PD-1 and PD-2 | C. albicans | Planktonic | 39.2–10.1 | [104] | |
Filamentous fungi | NFAP2 | C. albicans, C. glabrata C. parapsilosis, | Planktonic and sessile | 0.07–144 | [105,106,107] |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Perez-Rodriguez, A.; Eraso, E.; Quindós, G.; Mateo, E. Antimicrobial Peptides with Anti-Candida Activity. Int. J. Mol. Sci. 2022, 23, 9264. https://doi.org/10.3390/ijms23169264
Perez-Rodriguez A, Eraso E, Quindós G, Mateo E. Antimicrobial Peptides with Anti-Candida Activity. International Journal of Molecular Sciences. 2022; 23(16):9264. https://doi.org/10.3390/ijms23169264
Chicago/Turabian StylePerez-Rodriguez, Aitzol, Elena Eraso, Guillermo Quindós, and Estibaliz Mateo. 2022. "Antimicrobial Peptides with Anti-Candida Activity" International Journal of Molecular Sciences 23, no. 16: 9264. https://doi.org/10.3390/ijms23169264
APA StylePerez-Rodriguez, A., Eraso, E., Quindós, G., & Mateo, E. (2022). Antimicrobial Peptides with Anti-Candida Activity. International Journal of Molecular Sciences, 23(16), 9264. https://doi.org/10.3390/ijms23169264