Application Value of Antimicrobial Peptides in Gastrointestinal Tumors
Abstract
:1. Introduction
2. Antimicrobial Peptides against Gastrointestinal Tumors
2.1. Oral Cancer
2.2. Esophageal Cancer
2.3. Gastric Cancer
2.4. Liver Cancer
2.5. Pancreatic Cancer
2.6. Colorectal Cancer
3. Anticancer Mechanisms of Antimicrobial Peptides against Gastrointestinal Tumors
3.1. Cell Apoptosis
3.2. Autophagy
3.3. Cell Cycle Arrest
3.4. Membrane Destruction
3.5. Inhibition of Metastasis
4. The Effect of Modification and Optimization of Antimicrobial Peptides on Gastrointestinal Tumors
4.1. Peptide Length
4.2. Peptide Charge
4.3. Peptide Secondary Structure
4.4. Combined and Coupled Peptides
5. Advantages of Antimicrobial Peptides in Anti-Gastrointestinal Tumor Treatments
5.1. High Selectivity
5.2. Drug Resistance
6. Conclusions and Prospects
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
References
- Raheem, N.; Straus, S.K. Mechanisms of Action for Antimicrobial Peptides With Antibacterial and Antibiofilm Functions. Front. Microbiol. 2019, 10, 2866. [Google Scholar] [CrossRef]
- Piotrowska, U.; Sobczak, M.; Oledzka, E. Current state of a dual behaviour of antimicrobial peptides-Therapeutic agents and promising delivery vectors. Chem. Biol. Drug Des. 2017, 90, 1079–1093. [Google Scholar] [CrossRef] [PubMed]
- Hancock, R.E.; Falla, T.; Brown, M. Cationic bactericidal peptides. Adv. Microb. Physiol. 1995, 37, 135–175. [Google Scholar] [CrossRef] [PubMed]
- Entian, K.D.; de Vos, W.M. Genetics of subtilin and nisin biosyntheses: Biosynthesis of lantibiotics. Antonie Van Leeuwenhoek 1996, 69, 109–117. [Google Scholar] [CrossRef] [PubMed]
- Nakano, M.M.; Zuber, P. Molecular biology of antibiotic production in Bacillus. Crit. Rev. Biotechnol. 1990, 10, 223–240. [Google Scholar] [CrossRef] [PubMed]
- Ganz, T. Defensins: Antimicrobial peptides of innate immunity. Nat. Rev. Immunol. 2003, 3, 710–720. [Google Scholar] [CrossRef] [PubMed]
- Brogden, K.A. Antimicrobial peptides: Pore formers or metabolic inhibitors in bacteria? Nat. Rev. Microbiol. 2005, 3, 238–250. [Google Scholar] [CrossRef]
- Zhang, G.; Sunkara, L.T. Avian antimicrobial host defense peptides: From biology to therapeutic applications. Pharmaceuticals 2014, 7, 220–247. [Google Scholar] [CrossRef]
- Hoskin, D.W.; Ramamoorthy, A. Studies on anticancer activities of antimicrobial peptides. Biochim. Biophys. Acta 2008, 1778, 357–375. [Google Scholar] [CrossRef]
- Baindara, P.; Korpole, S.; Grover, V. Bacteriocins: Perspective for the development of novel anticancer drugs. Appl. Microbiol. Biotechnol. 2018, 102, 10393–10408. [Google Scholar] [CrossRef]
- Tornesello, A.L.; Borrelli, A.; Buonaguro, L.; Buonaguro, F.M.; Tornesello, M.L. Antimicrobial Peptides as Anticancer Agents: Functional Properties and Biological Activities. Molecules 2020, 25, 2850. [Google Scholar] [CrossRef]
- Bakare, O.O.; Gokul, A.; Wu, R.; Niekerk, L.A.; Klein, A.; Keyster, M. Biomedical Relevance of Novel Anticancer Peptides in the Sensitive Treatment of Cancer. Biomolecules 2021, 11, 1120. [Google Scholar] [CrossRef] [PubMed]
- Sledge, G.W.; Mamounas, E.P.; Hortobagyi, G.N.; Burstein, H.J.; Goodwin, P.J.; Wolff, A.C. Past, present, and future challenges in breast cancer treatment. J. Clin. Oncol. Off. J. Am. Soc. Clin. Oncol. 2014, 32, 1979–1986. [Google Scholar] [CrossRef] [PubMed]
- Saido-Sakanaka, H.; Ishibashi, J.; Momotani, E.; Amano, F.; Yamakawa, M. In vitro and in vivo activity of antimicrobial peptides synthesized based on the insect defensin. Peptides 2004, 25, 19–27. [Google Scholar] [CrossRef] [PubMed]
- Saxena, M.; van der Burg, S.H.; Melief, C.J.M.; Bhardwaj, N. Therapeutic cancer vaccines. Nat. Rev. Cancer 2021, 21, 360–378. [Google Scholar] [CrossRef] [PubMed]
- Yavari, B.; Mahjub, R.; Saidijam, M.; Raigani, M.; Soleimani, M. The Potential Use of Peptides in Cancer Treatment. Curr. Protein Pept. Sci. 2018, 19, 759–770. [Google Scholar] [CrossRef] [PubMed]
- Ferlay, J.; Colombet, M.; Soerjomataram, I.; Parkin, D.M.; Piñeros, M.; Znaor, A.; Bray, F. Cancer statistics for the year 2020: An overview. Int. J. Cancer 2021, 149, 778–789. [Google Scholar] [CrossRef] [PubMed]
- Karunakaran, M.; Barreto, S.G. Surgery for pancreatic cancer: Current controversies and challenges. Future Oncol. 2021, 17, 5135–5162. [Google Scholar] [CrossRef]
- Baskar, R.; Lee, K.A.; Yeo, R.; Yeoh, K.W. Cancer and radiation therapy: Current advances and future directions. Int. J. Med. Sci. 2012, 9, 193–199. [Google Scholar] [CrossRef]
- Furue, H. Chemotherapy cancer treatment during the past sixty years. Gan Kagaku Ryoho Cancer Chemother. 2003, 30, 1404–1411. [Google Scholar]
- Wu, Y.; Yang, Z.; Cheng, K.; Bi, H.; Chen, J. Small molecule-based immunomodulators for cancer therapy. Acta Pharm. Sin. B 2022, 12, 4287–4308. [Google Scholar] [CrossRef] [PubMed]
- Gupta, K.; Walton, R.; Kataria, S.P. Chemotherapy-Induced Nausea and Vomiting: Pathogenesis, Recommendations, and New Trends. Cancer Treat. Res. Commun. 2021, 26, 100278. [Google Scholar] [CrossRef] [PubMed]
- Freites-Martinez, A.; Shapiro, J.; Goldfarb, S.; Nangia, J.; Jimenez, J.J.; Paus, R.; Lacouture, M.E. Hair disorders in patients with cancer. J. Am. Acad. Dermatol. 2019, 80, 1179–1196. [Google Scholar] [CrossRef] [PubMed]
- Herrmann, J. Adverse cardiac effects of cancer therapies: Cardiotoxicity and arrhythmia. Nat. Rev. Cardiol. 2020, 17, 474–502. [Google Scholar] [CrossRef] [PubMed]
- Helmy, K.Y.; Patel, S.A.; Nahas, G.R.; Rameshwar, P. Cancer immunotherapy: Accomplishments to date and future promise. Ther. Deliv. 2013, 4, 1307–1320. [Google Scholar] [CrossRef] [PubMed]
- Saghatchian, M.; Lesur, A. Management of side effects related to adjuvant hormone therapy in young women with breast cancer. Bull. Du Cancer 2019, 106, S37–S42. [Google Scholar] [CrossRef] [PubMed]
- Li, Y.; Wang, J.; Ma, X.; Tan, L.; Yan, Y.; Xue, C.; Hui, B.; Liu, R.; Ma, H.; Ren, J. A Review of Neoadjuvant Chemoradiotherapy for Locally Advanced Rectal Cancer. Int. J. Biol. Sci. 2016, 12, 1022–1031. [Google Scholar] [CrossRef]
- Papo, N.; Seger, D.; Makovitzki, A.; Kalchenko, V.; Eshhar, Z.; Degani, H.; Shai, Y. Inhibition of tumor growth and elimination of multiple metastases in human prostate and breast xenografts by systemic inoculation of a host defense-like lytic peptide. Cancer Res. 2006, 66, 5371–5378. [Google Scholar] [CrossRef]
- Lehmann, J.; Retz, M.; Sidhu, S.S.; Suttmann, H.; Sell, M.; Paulsen, F.; Harder, J.; Unteregger, G.; Stöckle, M. Antitumor activity of the antimicrobial peptide magainin II against bladder cancer cell lines. Eur. Urol. 2006, 50, 141–147. [Google Scholar] [CrossRef]
- Mader, J.S.; Hoskin, D.W. Cationic antimicrobial peptides as novel cytotoxic agents for cancer treatment. Expert Opin. Investig. Drugs 2006, 15, 933–946. [Google Scholar] [CrossRef]
- Dürr, U.H.; Sudheendra, U.S.; Ramamoorthy, A. LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochim. Biophys. Acta 2006, 1758, 1408–1425. [Google Scholar] [CrossRef] [PubMed]
- Chandler, K.B.; Alamoud, K.A.; Stahl, V.L.; Nguyen, B.C.; Kartha, V.K.; Bais, M.V.; Nomoto, K.; Owa, T.; Monti, S.; Kukuruzinska, M.A.; et al. β-Catenin/CBP inhibition alters epidermal growth factor receptor fucosylation status in oral squamous cell carcinoma. Mol. Omics 2020, 16, 195–209. [Google Scholar] [CrossRef] [PubMed]
- Qiu, X.; Jiang, S.; Xiao, Y.; He, Y.; Ren, T.; Jiang, L.; Liu, R.; Chen, Q. SOX2-dependent expression of dihydroorotate dehydrogenase regulates oral squamous cell carcinoma cell proliferation. Int. J. Oral Sci. 2021, 13, 3. [Google Scholar] [CrossRef] [PubMed]
- Kato, M.G.; Baek, C.H.; Chaturvedi, P.; Gallagher, R.; Kowalski, L.P.; Leemans, C.R.; Warnakulasuriya, S.; Nguyen, S.A.; Day, T.A. Update on oral and oropharyngeal cancer staging-International perspectives. World J. Otorhinolaryngol. Head Neck Surg. 2020, 6, 66–75. [Google Scholar] [CrossRef] [PubMed]
- Montero, P.H.; Patel, S.G. Cancer of the oral cavity. Surg. Oncol. Clin. N. Am. 2015, 24, 491–508. [Google Scholar] [CrossRef] [PubMed]
- Omura, K. Current status of oral cancer treatment strategies: Surgical treatments for oral squamous cell carcinoma. Int. J. Clin. Oncol. 2014, 19, 423–430. [Google Scholar] [CrossRef] [PubMed]
- Day, T.A.; Davis, B.K.; Gillespie, M.B.; Joe, J.K.; Kibbey, M.; Martin-Harris, B.; Neville, B.; Reed, S.G.; Richardson, M.S.; Rosenzweig, S.; et al. Oral cancer treatment. Curr. Treat. Options Oncol. 2003, 4, 27–41. [Google Scholar] [CrossRef]
- Rivera, C. Essentials of oral cancer. Int. J. Clin. Exp. Pathol. 2015, 8, 11884–11894. [Google Scholar]
- Huang, S.H.; O’Sullivan, B. Oral cancer: Current role of radiotherapy and chemotherapy. Med. Oral Patol. Oral Y Cir. Bucal 2013, 18, e233–e240. [Google Scholar] [CrossRef]
- Donnelly, J.G. Pharmacogenetics in cancer chemotherapy: Balancing toxicity and response. Ther. Drug Monit. 2004, 26, 231–235. [Google Scholar] [CrossRef]
- Hartner, L. Chemotherapy for Oral Cancer. Dent. Clin. N. Am. 2018, 62, 87–97. [Google Scholar] [CrossRef] [PubMed]
- Han, Y.; Cui, Z.; Li, Y.H.; Hsu, W.H.; Lee, B.H. In Vitro and in Vivo Anticancer Activity of Pardaxin against Proliferation and Growth of Oral Squamous Cell Carcinoma. Mar. Drugs 2015, 14, 2. [Google Scholar] [CrossRef] [PubMed]
- Solarte, V.A.; Rosas, J.E.; Rivera, Z.J.; Arango-Rodríguez, M.L.; García, J.E.; Vernot, J.P. A Tetrameric Peptide Derived from Bovine Lactoferricin Exhibits Specific Cytotoxic Effects against Oral Squamous-Cell Carcinoma Cell Lines. BioMed Res. Int. 2015, 2015, 630179. [Google Scholar] [CrossRef] [PubMed]
- Chen, X.; Ji, S.; Si, J.; Zhang, X.; Wang, X.; Guo, Y.; Zou, X. Human cathelicidin antimicrobial peptide suppresses proliferation, migration and invasion of oral carcinoma HSC-3 cells via a novel mechanism involving caspase-3 mediated apoptosis. Mol. Med. Rep. 2020, 22, 5243–5250. [Google Scholar] [CrossRef] [PubMed]
- Açil, Y.; Torz, K.; Gülses, A.; Wieker, H.; Gerle, M.; Purcz, N.; Will, O.M.; Eduard Meyer, J.; Wiltfang, J. An experimental study on antitumoral effects of KI-21-3, a synthetic fragment of antimicrobial peptide LL-37, on oral squamous cell carcinoma. J. Cranio-Maxillofac. Surg. 2018, 46, 1586–1592. [Google Scholar] [CrossRef] [PubMed]
- Okumura, K.; Itoh, A.; Isogai, E.; Hirose, K.; Hosokawa, Y.; Abiko, Y.; Shibata, T.; Hirata, M.; Isogai, H. C-terminal domain of human CAP18 antimicrobial peptide induces apoptosis in oral squamous cell carcinoma SAS-H1 cells. Cancer Lett. 2004, 212, 185–194. [Google Scholar] [CrossRef] [PubMed]
- Musrati, A.A.; Tervahartiala, T.; Gürsoy, M.; Könönen, E.; Fteita, D.; Sorsa, T.; Uitto, V.J.; Gürsoy, U.K. Human neutrophil peptide-1 affects matrix metalloproteinase-2, -8 and -9 secretions of oral squamous cell carcinoma cell lines in vitro. Arch. Oral Biol. 2016, 66, 1–7. [Google Scholar] [CrossRef]
- McKeown, S.T.; Lundy, F.T.; Nelson, J.; Lockhart, D.; Irwin, C.R.; Cowan, C.G.; Marley, J.J. The cytotoxic effects of human neutrophil peptide-1 (HNP1) and lactoferrin on oral squamous cell carcinoma (OSCC) in vitro. Oral Oncol. 2006, 42, 685–690. [Google Scholar] [CrossRef]
- Winter, J.; Pantelis, A.; Reich, R.; Martini, M.; Kraus, D.; Jepsen, S.; Allam, J.P.; Novak, N.; Wenghoefer, M. Human beta-defensin-1, -2, and -3 exhibit opposite effects on oral squamous cell carcinoma cell proliferation. Cancer Investig. 2011, 29, 196–201. [Google Scholar] [CrossRef]
- Han, Q.; Wang, R.; Sun, C.; Jin, X.; Liu, D.; Zhao, X.; Wang, L.; Ji, N.; Li, J.; Zhou, Y.; et al. Human beta-defensin-1 suppresses tumor migration and invasion and is an independent predictor for survival of oral squamous cell carcinoma patients. PLoS ONE 2014, 9, e91867. [Google Scholar] [CrossRef]
- Hou, D.; Hu, F.; Mao, Y.; Yan, L.; Zhang, Y.; Zheng, Z.; Wu, A.; Forouzanfar, T.; Pathak, J.L.; Wu, G. Cationic antimicrobial peptide NRC-03 induces oral squamous cell carcinoma cell apoptosis via CypD-mPTP axis-mediated mitochondrial oxidative stress. Redox Biol. 2022, 54, 102355. [Google Scholar] [CrossRef] [PubMed]
- Kamino, Y.; Kurashige, Y.; Uehara, O.; Sato, J.; Nishimura, M.; Yoshida, K.; Arakawa, T.; Nagayasu, H.; Saitoh, M.; Abiko, Y. HBD-2 is downregulated in oral carcinoma cells by DNA hypermethylation, and increased expression of hBD-2 by DNA demethylation and gene transfection inhibits cell proliferation and invasion. Oncol. Rep. 2014, 32, 462–468. [Google Scholar] [CrossRef] [PubMed]
- Murphy, G.; McCormack, V.; Abedi-Ardekani, B.; Arnold, M.; Camargo, M.C.; Dar, N.A.; Dawsey, S.M.; Etemadi, A.; Fitzgerald, R.C.; Fleischer, D.E.; et al. International cancer seminars: A focus on esophageal squamous cell carcinoma. Ann. Oncol. Off. J. Eur. Soc. Med. Oncol. 2017, 28, 2086–2093. [Google Scholar] [CrossRef] [PubMed]
- Xu, P.; Lv, D.; Wang, X.; Wang, Y.; Hou, C.; Gao, K.; Guo, X. Inhibitory effects of Bombyx mori antimicrobial peptide cecropins on esophageal cancer cells. Eur. J. Pharmacol. 2020, 887, 173434. [Google Scholar] [CrossRef] [PubMed]
- Ramos-Martín, F.; Herrera-León, C.; D’Amelio, N. Molecular basis of the anticancer, apoptotic and antibacterial activities of Bombyx mori Cecropin A. Arch. Biochem. Biophys. 2022, 715, 109095. [Google Scholar] [CrossRef] [PubMed]
- Ramos-Martín, F.; Herrera-León, C.; D’Amelio, N. Bombyx mori Cecropin D could trigger cancer cell apoptosis by interacting with mitochondrial cardiolipin. Biochim. Biophys. Acta Biomembr. 2022, 1864, 184003. [Google Scholar] [CrossRef]
- Xia, L.; Wu, Y.; Kang, S.; Ma, J.; Yang, J.; Zhang, F. CecropinXJ, a silkworm antimicrobial peptide, induces cytoskeleton disruption in esophageal carcinoma cells. Acta Biochim. Biophys. Sin. 2014, 46, 867–876. [Google Scholar] [CrossRef]
- Liu, S.; Aweya, J.J.; Zheng, L.; Zheng, Z.; Huang, H.; Wang, F.; Yao, D.; Ou, T.; Zhang, Y. LvHemB1, a novel cationic antimicrobial peptide derived from the hemocyanin of Litopenaeus vannamei, induces cancer cell death by targeting mitochondrial voltage-dependent anion channel 1. Cell Biol. Toxicol. 2022, 38, 87–110. [Google Scholar] [CrossRef]
- Sung, H.; Ferlay, J.; Siegel, R.L.; Laversanne, M.; Soerjomataram, I.; Jemal, A.; Bray, F. Global Cancer Statistics 2020: GLOBOCAN Estimates of Incidence and Mortality Worldwide for 36 Cancers in 185 Countries. CA A Cancer J. Clin. 2021, 71, 209–249. [Google Scholar] [CrossRef]
- Gao, J.; Zhang, X.; Meng, Q.; Jin, H.; Zhu, Z.; Wang, Z.; Qian, W.; Zhang, L.; Liu, Y.; Min, M.; et al. Linked Color Imaging Can Improve Detection Rate of Early Gastric Cancer in a High-Risk Population: A Multi-Center Randomized Controlled Clinical Trial. Dig. Dis. Sci. 2021, 66, 1212–1219. [Google Scholar] [CrossRef]
- Kong, G.M.; Tao, W.H.; Diao, Y.L.; Fang, P.H.; Wang, J.J.; Bo, P.; Qian, F. Melittin induces human gastric cancer cell apoptosis via activation of mitochondrial pathway. World J. Gastroenterol. 2016, 22, 3186–3195. [Google Scholar] [CrossRef] [PubMed]
- Karimi, P.; Islami, F.; Anandasabapathy, S.; Freedman, N.D.; Kamangar, F. Gastric cancer: Descriptive epidemiology, risk factors, screening, and prevention. Cancer Epidemiol. Biomark. Prev. 2014, 23, 700–713. [Google Scholar] [CrossRef] [PubMed]
- Fathizadeh, H.; Saffari, M.; Esmaeili, D.; Moniri, R.; Mahabadi, J.A. Anticancer Effect of Enterocin A-Colicin E1 Fusion Peptide on the Gastric Cancer Cell. Probiotics Antimicrob. Proteins 2021, 13, 1443–1451. [Google Scholar] [CrossRef] [PubMed]
- Pan, W.R.; Chen, P.W.; Chen, Y.L.; Hsu, H.C.; Lin, C.C.; Chen, W.J. Bovine lactoferricin B induces apoptosis of human gastric cancer cell line AGS by inhibition of autophagy at a late stage. J. Dairy Sci. 2013, 96, 7511–7520. [Google Scholar] [CrossRef] [PubMed]
- Huang, J.Y.; Peng, S.F.; Chueh, F.S.; Chen, P.Y.; Huang, Y.P.; Huang, W.W.; Chung, J.G. Melittin suppresses epithelial-mesenchymal transition and metastasis in human gastric cancer AGS cells via regulating Wnt/BMP associated pathway. Biosci. Biotechnol. Biochem. 2021, 85, 2250–2262. [Google Scholar] [CrossRef] [PubMed]
- Ankaiah, D.; Palanichamy, E.; Antonyraj, C.B.; Ayyanna, R.; Perumal, V.; Ahamed, S.I.B.; Arul, V. Cloning, overexpression, purification of bacteriocin enterocin-B and structural analysis, interaction determination of enterocin-A, B against pathogenic bacteria and human cancer cells. Int. J. Biol. Macromol. 2018, 116, 502–512. [Google Scholar] [CrossRef]
- Pan, W.R.; Chen, Y.L.; Hsu, H.C.; Chen, W.J. Antimicrobial peptide GW-H1-induced apoptosis of human gastric cancer AGS cell line is enhanced by suppression of autophagy. Mol. Cell. Biochem. 2015, 400, 77–86. [Google Scholar] [CrossRef]
- Lee, J.H.; Kim, I.W.; Shin, Y.P.; Park, H.J.; Lee, Y.S.; Lee, I.H.; Kim, M.A.; Yun, E.Y.; Nam, S.H.; Ahn, M.Y.; et al. Enantiomeric CopA3 dimer peptide suppresses cell viability and tumor xenograft growth of human gastric cancer cells. Tumor Biol. 2016, 37, 3237–3245. [Google Scholar] [CrossRef]
- Jamasbi, E.; Lucky, S.S.; Li, W.; Hossain, M.A.; Gopalakrishnakone, P.; Separovic, F. Effect of dimerized melittin on gastric cancer cells and antibacterial activity. Amino Acids 2018, 50, 1101–1110. [Google Scholar] [CrossRef]
- Soliman, C.; Eastwood, S.; Truong, V.K.; Ramsland, P.A.; Elbourne, A. The membrane effects of melittin on gastric and colorectal cancer. PLoS ONE 2019, 14, e0224028. [Google Scholar] [CrossRef]
- Wu, Z.; Ding, Z.; Cheng, B.; Cui, Z. The inhibitory effect of human DEFA5 in growth of gastric cancer by targeting BMI1. Cancer Sci. 2021, 112, 1075–1083. [Google Scholar] [CrossRef] [PubMed]
- Wu, W.K.; Sung, J.J.; To, K.F.; Yu, L.; Li, H.T.; Li, Z.J.; Chu, K.M.; Yu, J.; Cho, C.H. The host defense peptide LL-37 activates the tumor-suppressing bone morphogenetic protein signaling via inhibition of proteasome in gastric cancer cells. J. Cell. Physiol. 2010, 223, 178–186. [Google Scholar] [CrossRef] [PubMed]
- Wu, Y.L.; Xia, L.J.; Li, J.Y.; Zhang, F.C. CecropinXJ inhibits the proliferation of human gastric cancer BGC823 cells and induces cell death in vitro and in vivo. Int. J. Oncol. 2015, 46, 2181–2193. [Google Scholar] [CrossRef] [PubMed]
- Mahmoodzadeh, A.; Zarrinnahad, H.; Bagheri, K.P.; Moradia, A.; Shahbazzadeh, D. First report on the isolation of melittin from Iranian honey bee venom and evaluation of its toxicity on gastric cancer AGS cells. J. Chin. Med. Assoc. JCMA 2015, 78, 574–583. [Google Scholar] [CrossRef] [PubMed]
- Ma, X.; Xi, L.; Luo, D.; Liu, R.; Li, S.; Liu, Y.; Fan, L.; Ye, S.; Yang, W.; Yang, S.; et al. Anti-tumor effects of the peptide TMTP1-GG-D(KLAKLAK)(2) on highly metastatic cancers. PLoS ONE 2012, 7, e42685. [Google Scholar] [CrossRef] [PubMed]
- McGlynn, K.A.; Petrick, J.L.; El-Serag, H.B. Epidemiology of Hepatocellular Carcinoma. Hepatology 2021, 73 (Suppl. S1), 4–13. [Google Scholar] [CrossRef] [PubMed]
- Siegel, R.L.; Miller, K.D.; Fuchs, H.E.; Jemal, A. Cancer statistics, 2022. CA A Cancer J. Clin. 2022, 72, 7–33. [Google Scholar] [CrossRef]
- Vogel, A.; Meyer, T.; Sapisochin, G.; Salem, R.; Saborowski, A. Hepatocellular carcinoma. Lancet 2022, 400, 1345–1362. [Google Scholar] [CrossRef]
- Tang, W.; Chen, Z.; Zhang, W.; Cheng, Y.; Zhang, B.; Wu, F.; Wang, Q.; Wang, S.; Rong, D.; Reiter, F.P.; et al. The mechanisms of sorafenib resistance in hepatocellular carcinoma: Theoretical basis and therapeutic aspects. Signal Transduct. Target. Ther. 2020, 5, 87. [Google Scholar] [CrossRef]
- Li, X.; Song, W.; Zhang, M.; Zhao, P. Human β-defensin 1 Functions as a Tumor Suppressor via ER Stress-triggered JNK pathway in Hepatocellular Carcinoma. J. Balk. Union Oncol. 2021, 26, 1365–1372. [Google Scholar]
- Al Kashgry, N.A.T.; Abulreesh, H.H.; El-Sheikh, I.A.; Almaroai, Y.A.; Salem, R.; Mohamed, I.; Waly, F.R.; Osman, G.; Mohamed, M.S.M. Utilization of a recombinant defensin from Maize (Zea mays L.) as a potential antimicrobial peptide. AMB Express 2020, 10, 208. [Google Scholar] [CrossRef] [PubMed]
- Jin, X.B.; Mei, H.F.; Pu, Q.H.; Shen, J.; Lu, X.M.; Chu, F.J.; Zhu, J.Y. Effects of Musca domestica cecropin on the adhesion and migration of human hepatocellular carcinoma BEL-7402 cells. Biol. Pharm. Bull. 2013, 36, 938–943. [Google Scholar] [CrossRef] [PubMed]
- Jin, X.; Mei, H.; Li, X.; Ma, Y.; Zeng, A.H.; Wang, Y.; Lu, X.; Chu, F.; Wu, Q.; Zhu, J. Apoptosis-inducing activity of the antimicrobial peptide cecropin of Musca domestica in human hepatocellular carcinoma cell line BEL-7402 and the possible mechanism. Acta Biochim. Biophys. Sin. 2010, 42, 259–265. [Google Scholar] [CrossRef]
- Lu, J.; Chen, Z.W. Isolation, characterization and anti-cancer activity of SK84, a novel glycine-rich antimicrobial peptide from Drosophila virilis. Peptides 2010, 31, 44–50. [Google Scholar] [CrossRef] [PubMed]
- Xia, L.; Wu, Y.; Ma, J.I.; Yang, J.; Zhang, F. The antibacterial peptide from Bombyx mori cecropinXJ induced growth arrest and apoptosis in human hepatocellular carcinoma cells. Oncol. Lett. 2016, 12, 57–62. [Google Scholar] [CrossRef] [PubMed]
- Okasha, H.; Nasr, S.M.; Samir, S. Recombinant Expression of Cec-B Peptide in Escherichia coli with a Significant Anticancer Effect on Hepatocellular Carcinoma. Curr. Pharm. Biotechnol. 2021, 22, 1235–1245. [Google Scholar] [CrossRef] [PubMed]
- Chen, Y.L.; Li, J.H.; Yu, C.Y.; Lin, C.J.; Chiu, P.H.; Chen, P.W.; Lin, C.C.; Chen, W.J. Novel cationic antimicrobial peptide GW-H1 induced caspase-dependent apoptosis of hepatocellular carcinoma cell lines. Peptides 2012, 36, 257–265. [Google Scholar] [CrossRef]
- Chai, J.; Yang, W.; Gao, Y.; Guo, R.; Peng, Q.; Abdel-Rahman, M.A.; Xu, X. Antitumor Effects of Scorpion Peptide Smp43 through Mitochondrial Dysfunction and Membrane Disruption on Hepatocellular Carcinoma. J. Nat. Prod. 2021, 84, 3147–3160. [Google Scholar] [CrossRef]
- Liu, S.; Aweya, J.J.; Zheng, L.; Wang, F.; Zheng, Z.; Zhong, M.; Lun, J.; Zhang, Y. A Litopenaeus vannamei Hemocyanin-Derived Antimicrobial Peptide (Peptide B11) Attenuates Cancer Cells’ Proliferation. Molecules 2018, 23, 3202. [Google Scholar] [CrossRef]
- Hossain, M.A.; Guilhaudis, L.; Sonnevend, A.; Attoub, S.; van Lierop, B.J.; Robinson, A.J.; Wade, J.D.; Conlon, J.M. Synthesis, conformational analysis and biological properties of a dicarba derivative of the antimicrobial peptide, brevinin-1BYa. Eur. Biophys. J. 2011, 40, 555–564. [Google Scholar] [CrossRef]
- Dong, N.; Zhu, X.; Lv, Y.F.; Ma, Q.Q.; Jiang, J.G.; Shan, A.S. Cell specificity and molecular mechanism of antibacterial and antitumor activities of carboxyl-terminal RWL-tagged antimicrobial peptides. Amino Acids 2014, 46, 2137–2154. [Google Scholar] [CrossRef] [PubMed]
- Peng, X.; Zhou, C.; Hou, X.; Liu, Y.; Wang, Z.; Peng, X.; Zhang, Z.; Wang, R.; Kong, D. Molecular characterization and bioactivity evaluation of two novel bombinin peptides from the skin secretion of Oriental fire-bellied toad, Bombina orientalis. Amino Acids 2018, 50, 241–253. [Google Scholar] [CrossRef] [PubMed]
- Ding, X.; Bian, D.; Li, W.; Xie, Y.; Li, X.; Lv, J.; Tang, R. Host defense peptide LL-37 is involved in the regulation of cell proliferation and production of pro-inflammatory cytokines in hepatocellular carcinoma cells. Amino Acids 2021, 53, 471–484. [Google Scholar] [CrossRef] [PubMed]
- Shi, M.; Zhang, T.; Sun, L.; Luo, Y.; Liu, D.H.; Xie, S.T.; Song, X.Y.; Wang, G.F.; Chen, X.L.; Zhou, B.C.; et al. Calpain, Atg5 and Bak play important roles in the crosstalk between apoptosis and autophagy induced by influx of extracellular calcium. Apoptosis 2013, 18, 435–451. [Google Scholar] [CrossRef] [PubMed]
- Zeng, J.; Wang, J.; Wu, J.; Deng, R.; Zhang, L.; Chen, Q.; Wang, J.; Jin, X.; Gui, S.; Xu, Y.; et al. A novel antimicrobial peptide M1-8 targets the lysosomal pathway to inhibit autolysosome formation and promote apoptosis in liver cancer cells. J. Cell. Mol. Med. 2023, 27, 340–352. [Google Scholar] [CrossRef] [PubMed]
- Zainodini, N.; Hajizadeh, M.R.; Mirzaei, M.R. Evaluation of Apoptotic Gene Expression in Hepatoma Cell Line (HepG2) Following Nisin Treatment. Asian Pac. J. Cancer Prev. APJCP 2021, 22, 1413–1419. [Google Scholar] [CrossRef] [PubMed]
- Nguyen, T.; Guo, R.; Chai, J.; Wu, J.; Liu, J.; Chen, X.; Abdel-Rahman, M.A.; Xia, H.; Xu, X. Smp24, a Scorpion-Venom Peptide, Exhibits Potent Antitumor Effects against Hepatoma HepG2 Cells via Multi-Mechanisms In Vivo and In Vitro. Toxins 2022, 14, 717. [Google Scholar] [CrossRef]
- Ohtake, T.; Fujimoto, Y.; Ikuta, K.; Saito, H.; Ohhira, M.; Ono, M.; Kohgo, Y. Proline-rich antimicrobial peptide, PR-39 gene transduction altered invasive activity and actin structure in human hepatocellular carcinoma cells. Br. J. Cancer 1999, 81, 393–403. [Google Scholar] [CrossRef]
- Wu, C.; Geng, X.; Wan, S.; Hou, H.; Yu, F.; Jia, B.; Wang, L. Cecropin-P17, an analog of Cecropin B, inhibits human hepatocellular carcinoma cell HepG-2 proliferation via regulation of ROS, Caspase, Bax, and Bcl-2. J. Pept. Sci. Off. Publ. Eur. Pept. Soc. 2015, 21, 661–668. [Google Scholar] [CrossRef]
- Ke, M.; Dong, J.; Wang, Y.; Zhang, J.; Zhang, M.; Wu, Z.; Lv, Y.; Wu, R. MEL-pep, an analog of melittin, disrupts cell membranes and reverses 5-fluorouracil resistance in human hepatocellular carcinoma cells. Int. J. Biochem. Cell Biol. 2018, 101, 39–48. [Google Scholar] [CrossRef]
- Ma, Z.; Yang, J.; Han, J.; Gao, L.; Liu, H.; Lu, Z.; Zhao, H.; Bie, X. Insights into the Antimicrobial Activity and Cytotoxicity of Engineered α-Helical Peptide Amphiphiles. J. Med. Chem. 2016, 59, 10946–10962. [Google Scholar] [CrossRef] [PubMed]
- Judge, C.J.; Reyes-Aviles, E.; Conry, S.J.; Sieg, S.S.; Feng, Z.; Weinberg, A.; Anthony, D.D. HBD-3 induces NK cell activation, IFN-γ secretion and mDC dependent cytolytic function. Cell. Immunol. 2015, 297, 61–68. [Google Scholar] [CrossRef] [PubMed]
- Khan, A.; Fan, K.; Sun, N.; Yin, W.; Sun, Y.; Sun, P.; Jahejo, A.R.; Li, H. Recombinant porcine NK-lysin inhibits the invasion of hepatocellular carcinoma cells in vitro. Int. J. Biol. Macromol. 2019, 140, 1249–1259. [Google Scholar] [CrossRef]
- Balcik-Ercin, P.; Sever, B. An investigation of bacteriocin nisin anti-cancer effects and FZD7 protein interactions in liver cancer cells. Chem. Biol. Interact. 2022, 366, 110152. [Google Scholar] [CrossRef] [PubMed]
- Kim, I.W.; Kim, S.J.; Kwon, Y.N.; Yun, E.Y.; Ahn, M.Y.; Kang, D.C.; Hwang, J.S. Effects of the synthetic coprisin analog peptide, CopA3 in pathogenic microorganisms and mammalian cancer cells. J. Microbiol. Biotechnol. 2012, 22, 156–158. [Google Scholar] [CrossRef] [PubMed]
- Jin-Yao, L.I.; Fu-Chun, Z.; Zheng-Hai, M.A. Prokaryotic expression of cecropin gene isolated from the silkworm Bombyx mori Xinjiang race and antibacterial activity of fusion cecropin. Acta Entomol. Sin. 2004, 47, 407–411. [Google Scholar]
- Farinha, P.; Pinho, J.O.; Matias, M.; Gaspar, M.M. Nanomedicines in the treatment of colon cancer: A focus on metallodrugs. Drug Deliv. Transl. Res. 2022, 12, 49–66. [Google Scholar] [CrossRef] [PubMed]
- Haraldsdottir, S.; Einarsdottir, H.M.; Smaradottir, A.; Gunnlaugsson, A.; Halfdanarson, T.R. Colorectal cancer-review. Laeknabladid 2014, 100, 75–82. [Google Scholar] [CrossRef]
- Anju, A.; Smitha, C.K.; Preetha, K.; Boobal, R.; Rosamma, P. Molecular characterization, recombinant expression and bioactivity profile of an antimicrobial peptide, Ss-arasin from the Indian mud crab, Scylla serrata. Fish Shellfish Immunol. 2019, 88, 352–358. [Google Scholar] [CrossRef]
- De Giani, A.; Bovio, F.; Forcella, M.; Fusi, P.; Sello, G.; Di Gennaro, P. Identification of a bacteriocin-like compound from Lactobacillus plantarum with antimicrobial activity and effects on normal and cancerogenic human intestinal cells. AMB Express 2019, 9, 88. [Google Scholar] [CrossRef]
- Kang, S.J.; Ji, H.Y.; Lee, B.J. Anticancer activity of undecapeptide analogues derived from antimicrobial peptide, brevinin-1EMa. Arch. Pharmacal Res. 2012, 35, 791–799. [Google Scholar] [CrossRef] [PubMed]
- Cirillo, S.; Tomeh, M.A.; Wilkinson, R.N.; Hill, C.; Brown, S.; Zhao, X. Designed Antitumor Peptide for Targeted siRNA Delivery into Cancer Spheroids. ACS Appl. Mater. Interfaces 2021, 13, 49713–49728. [Google Scholar] [CrossRef] [PubMed]
- Ren, S.X.; Shen, J.; Cheng, A.S.; Lu, L.; Chan, R.L.; Li, Z.J.; Wang, X.J.; Wong, C.C.; Zhang, L.; Ng, S.S.; et al. FK-16 derived from the anticancer peptide LL-37 induces caspase-independent apoptosis and autophagic cell death in colon cancer cells. PLoS ONE 2013, 8, e63641. [Google Scholar] [CrossRef] [PubMed]
- Cho, E.; Lee, J.K.; Park, E.; Seo, C.H.; Luchian, T.; Park, Y. Antitumor activity of HPA3P through RIPK3-dependent regulated necrotic cell death in colon cancer. Oncotarget 2018, 9, 7902–7917. [Google Scholar] [CrossRef] [PubMed]
- Lee, J.K.; Park, S.C.; Hahm, K.S.; Park, Y. A helix-PXXP-helix peptide with antibacterial activity without cytotoxicity against MDRPA-infected mice. Biomaterials 2014, 35, 1025–1039. [Google Scholar] [CrossRef] [PubMed]
- Ankaiah, D.; Esakkiraj, P.; Perumal, V.; Ayyanna, R.; Venkatesan, A. Probiotic characterization of Enterococcus faecium por1: Cloning, over expression of Enterocin-A and evaluation of antibacterial, anti-cancer properties. J. Funct. Foods 2018, 38, 280–292. [Google Scholar] [CrossRef]
- Avaiyarasi, N.D.; Ravindran, A.D.; Venkatesh, P.; Arul, V. Invitro selection, characterization and cytotoxic effect of bacteriocin of Lactobacillus sakei GM3 isolated from goat milk. Food Control 2016, 69, 124–133. [Google Scholar] [CrossRef]
- Norouzi, Z.; Salimi, A.; Halabian, R.; Fahimi, H. Nisin, a potent bacteriocin and anti-bacterial peptide, attenuates expression of metastatic genes in colorectal cancer cell lines. Microb. Pathog. 2018, 123, 183–189. [Google Scholar] [CrossRef]
- Chen, Y.C.; Tsai, T.L.; Ye, X.H.; Lin, T.H. Anti-proliferative effect on a colon adenocarcinoma cell line exerted by a membrane disrupting antimicrobial peptide KL15. Cancer Biol. Ther. 2015, 16, 1172–1183. [Google Scholar] [CrossRef]
- Maraming, P.; Klaynongsruang, S.; Boonsiri, P.; Peng, S.F.; Daduang, S.; Leelayuwat, C.; Pientong, C.; Chung, J.G.; Daduang, J. The cationic cell-penetrating KT2 peptide promotes cell membrane defects and apoptosis with autophagy inhibition in human HCT 116 colon cancer cells. J. Cell. Physiol. 2019, 234, 22116–22129. [Google Scholar] [CrossRef]
- Nam, B.H.; Moon, J.Y.; Park, E.H.; Kong, H.J.; Kim, Y.O.; Kim, D.G.; Kim, W.J.; An, C.M.; Seo, J.K. Antimicrobial and Antitumor Activities of Novel Peptides Derived from the Lipopolysaccharide- and β-1,3-Glucan Binding Protein of the Pacific Abalone Haliotis discus hannai. Mar. Drugs 2016, 14, 227. [Google Scholar] [CrossRef] [PubMed]
- Panjeta, A.; Preet, S. Anticancer potential of human intestinal defensin 5 against 1, 2-dimethylhydrazine dihydrochloride induced colon cancer: A therapeutic approach. Peptides 2020, 126, 170263. [Google Scholar] [CrossRef] [PubMed]
- Ren, S.X.; Cheng, A.S.; To, K.F.; Tong, J.H.; Li, M.S.; Shen, J.; Wong, C.C.; Zhang, L.; Chan, R.L.; Wang, X.J.; et al. Host immune defense peptide LL-37 activates caspase-independent apoptosis and suppresses colon cancer. Cancer Res. 2012, 72, 6512–6523. [Google Scholar] [CrossRef] [PubMed]
- Maijaroen, S.; Klaynongsruang, S.; Roytrakul, S.; Konkchaiyaphum, M.; Taemaitree, L.; Jangpromma, N. An Integrated Proteomics and Bioinformatics Analysis of the Anticancer Properties of RT2 Antimicrobial Peptide on Human Colon Cancer (Caco-2) Cells. Molecules 2022, 27, 1426. [Google Scholar] [CrossRef] [PubMed]
- Saleh, R.O.; Essia, I.N.A.; Jasim, S.A. The Anticancer Effect of a Conjugated Antimicrobial Peptide Against Colorectal Cancer (CRC) Cells. J. Gastrointest. Cancer 2022, 54, 165–170. [Google Scholar] [CrossRef] [PubMed]
- Dey, D.K.; Kang, S.C. CopA3 peptide induces permanent cell-cycle arrest in colorectal cancer cells. Mech. Ageing Dev. 2021, 196, 111497. [Google Scholar] [CrossRef] [PubMed]
- Jia, F.; Yu, Q.; Wang, R.; Zhao, L.; Yuan, F.; Guo, H.; Shen, Y.; He, F. Optimized Antimicrobial Peptide Jelleine-I Derivative Br-J-I Inhibits Fusobacterium Nucleatum to Suppress Colorectal Cancer Progression. Int. J. Mol. Sci. 2023, 24, 1469. [Google Scholar] [CrossRef]
- Tsai, T.L.; Li, A.C.; Chen, Y.C.; Liao, Y.S.; Lin, T.H. Antimicrobial peptide m2163 or m2386 identified from Lactobacillus casei ATCC 334 can trigger apoptosis in the human colorectal cancer cell line SW480. Tumour Biol. J. Int. Soc. Oncodevelopmental Biol. Med. 2015, 36, 3775–3789. [Google Scholar] [CrossRef]
- Wei, P.L.; Lin, J.C.; Hung, C.S.; Makondi, P.T.; Batzorig, U.; Chang, T.C.; Huang, C.Y.; Chang, Y.J. Human α-defensin 6 (HD6) suppresses CRC proliferation and metastasis through abolished EGF/EGFR signaling pathway. Int. J. Med. Sci. 2022, 19, 34–46. [Google Scholar] [CrossRef]
- Kuroda, K.; Fukuda, T.; Okumura, K.; Yoneyama, H.; Isogai, H.; Savage, P.B.; Isogai, E. Ceragenin CSA-13 induces cell cycle arrest and antiproliferative effects in wild-type and p53 null mutant HCT116 colon cancer cells. Anti Cancer Drugs 2013, 24, 826–834. [Google Scholar] [CrossRef]
- Kuroda, K.; Fukuda, T.; Yoneyama, H.; Katayama, M.; Isogai, H.; Okumura, K.; Isogai, E. Anti-proliferative effect of an analogue of the LL-37 peptide in the colon cancer derived cell line HCT116 p53+/+ and p53. Oncol. Rep. 2012, 28, 829–834. [Google Scholar] [CrossRef]
- Gu, Q.Q.; He, S.W.; Liu, L.H.; Wang, G.H.; Hao, D.F.; Liu, H.M.; Wang, C.B.; Li, C.; Zhang, M.; Li, N.Q. A teleost bactericidal permeability-increasing protein-derived peptide that possesses a broad antibacterial spectrum and inhibits bacterial infection as well as human colon cancer cells growth. Dev. Comp. Immunol. 2021, 118, 103995. [Google Scholar] [CrossRef] [PubMed]
- Ahmadi, S.; Ghollasi, M.; Hosseini, H.M. The apoptotic impact of nisin as a potent bacteriocin on the colon cancer cells. Microb. Pathog. 2017, 111, 193–197. [Google Scholar] [CrossRef] [PubMed]
- Freiburghaus, C.; Janicke, B.; Lindmark-Månsson, H.; Oredsson, S.M.; Paulsson, M.A. Lactoferricin treatment decreases the rate of cell proliferation of a human colon cancer cell line. J. Dairy Sci. 2009, 92, 2477–2484. [Google Scholar] [CrossRef] [PubMed]
- Li, Z.; Liu, X.; Li, Y.; Lan, X.; Leung, P.H.; Li, J.; Li, G.; Xie, M.; Han, Y.; Lin, X. Composite Membranes of Recombinant Silkworm Antimicrobial Peptide and Poly (L-lactic Acid) (PLLA) for biomedical application. Sci. Rep. 2016, 6, 31149. [Google Scholar] [CrossRef] [PubMed]
- Jiang, R.; Lönnerdal, B. Bovine lactoferrin and lactoferricin exert antitumor activities on human colorectal cancer cells (HT-29) by activating various signaling pathways. Biochem. Cell Biol. 2017, 95, 99–109. [Google Scholar] [CrossRef] [PubMed]
- Varas, M.A.; Muñoz-Montecinos, C.; Kallens, V.; Simon, V.; Allende, M.L.; Marcoleta, A.E.; Lagos, R. Exploiting Zebrafish Xenografts for Testing the in vivo Antitumorigenic Activity of Microcin E492 Against Human Colorectal Cancer Cells. Front. Microbiol. 2020, 11, 405. [Google Scholar] [CrossRef]
- Okasha, H.; Samir, S.; Nasr, S.M. Purified recombinant human Chromogranin A N46 peptide with remarkable anticancer effect on human colon cancer cells. Bioorg. Chem. 2021, 115, 105266. [Google Scholar] [CrossRef]
- Raileanu, M.; Popescu, A.; Bacalum, M. Antimicrobial Peptides as New Combination Agents in Cancer Therapeutics: A Promising Protocol against HT-29 Tumoral Spheroids. Int. J. Mol. Sci. 2020, 21, 6964. [Google Scholar] [CrossRef]
- Kuroda, K.; Fukuda, T.; Isogai, H.; Okumura, K.; Krstic-Demonacos, M.; Isogai, E. Antimicrobial peptide FF/CAP18 induces apoptotic cell death in HCT116 colon cancer cells via changes in the metabolic profile. Int. J. Oncol. 2015, 46, 1516–1526. [Google Scholar] [CrossRef]
- Mima, K.; Nishihara, R.; Qian, Z.R.; Cao, Y.; Sukawa, Y.; Nowak, J.A.; Yang, J.; Dou, R.; Masugi, Y.; Song, M.; et al. Fusobacterium nucleatum in colorectal carcinoma tissue and patient prognosis. Gut 2016, 65, 1973–1980. [Google Scholar] [CrossRef] [PubMed]
- Cochrane, K.; Robinson, A.V.; Holt, R.A.; Allen-Vercoe, E. A survey of Fusobacterium nucleatum genes modulated by host cell infection. Microb. Genom. 2020, 6, e000300. [Google Scholar] [CrossRef] [PubMed]
- Haruki, K.; Kosumi, K.; Hamada, T.; Twombly, T.S.; Väyrynen, J.P.; Kim, S.A.; Masugi, Y.; Qian, Z.R.; Mima, K.; Baba, Y.; et al. Association of autophagy status with amount of Fusobacterium nucleatum in colorectal cancer. J. Pathol. 2020, 250, 397–408. [Google Scholar] [CrossRef] [PubMed]
- Chen, Y.; Chen, Y.; Zhang, J.; Cao, P.; Su, W.; Deng, Y.; Zhan, N.; Fu, X.; Huang, Y.; Dong, W. Fusobacterium nucleatum Promotes Metastasis in Colorectal Cancer by Activating Autophagy Signaling via the Upregulation of CARD3 Expression. Theranostics 2020, 10, 323–339. [Google Scholar] [CrossRef] [PubMed]
- Epand, R.M.; Vogel, H.J. Diversity of antimicrobial peptides and their mechanisms of action. Biochim. Biophys. Acta 1999, 1462, 11–28. [Google Scholar] [CrossRef] [PubMed]
- Kumar, P.; Kizhakkedathu, J.N.; Straus, S.K. Antimicrobial Peptides: Diversity, Mechanism of Action and Strategies to Improve the Activity and Biocompatibility In Vivo. Biomolecules 2018, 8, 4. [Google Scholar] [CrossRef] [PubMed]
- Goldstein, J.C.; Waterhouse, N.J.; Juin, P.; Evan, G.I.; Green, D.R. The coordinate release of cytochrome c during apoptosis is rapid, complete and kinetically invariant. Nat. Cell Biol. 2000, 2, 156–162. [Google Scholar] [CrossRef] [PubMed]
- Gross, A.; McDonnell, J.M.; Korsmeyer, S.J. BCL-2 family members and the mitochondria in apoptosis. Genes Dev. 1999, 13, 1899–1911. [Google Scholar] [CrossRef]
- De Kroon, A.I.; Dolis, D.; Mayer, A.; Lill, R.; de Kruijff, B. Phospholipid composition of highly purified mitochondrial outer membranes of rat liver and Neurospora crassa. Is cardiolipin present in the mitochondrial outer membrane? Biochim. Biophys. Acta 1997, 1325, 108–116. [Google Scholar] [CrossRef]
- Yang, Y.; Yu, Y.; Wang, J.; Li, Y.; Li, Y.; Wei, J.; Zheng, T.; Jin, M.; Sun, Z. Silica nanoparticles induced intrinsic apoptosis in neuroblastoma SH-SY5Y cells via CytC/Apaf-1 pathway. Environ. Toxicol. Pharmacol. 2017, 52, 161–169. [Google Scholar] [CrossRef]
- Feng, Y.; He, D.; Yao, Z.; Klionsky, D.J. The machinery of macroautophagy. Cell Res. 2014, 24, 24–41. [Google Scholar] [CrossRef] [PubMed]
- Kraya, A.A.; Piao, S.; Xu, X.; Zhang, G.; Herlyn, M.; Gimotty, P.; Levine, B.; Amaravadi, R.K.; Speicher, D.W. Identification of secreted proteins that reflect autophagy dynamics within tumor cells. Autophagy 2015, 11, 60–74. [Google Scholar] [CrossRef] [PubMed]
- Tanida, I.; Ueno, T.; Kominami, E. LC3 and Autophagy. Methods Mol. Biol. 2008, 445, 77–88. [Google Scholar] [CrossRef] [PubMed]
- Fass, E.; Shvets, E.; Degani, I.; Hirschberg, K.; Elazar, Z. Microtubules support production of starvation-induced autophagosomes but not their targeting and fusion with lysosomes. J. Biol. Chem. 2006, 281, 36303–36316. [Google Scholar] [CrossRef] [PubMed]
- Wang, Z.; Miao, G.; Xue, X.; Guo, X.; Yuan, C.; Wang, Z.; Zhang, G.; Chen, Y.; Feng, D.; Hu, J.; et al. The Vici Syndrome Protein EPG5 Is a Rab7 Effector that Determines the Fusion Specificity of Autophagosomes with Late Endosomes/Lysosomes. Mol. Cell 2016, 63, 781–795. [Google Scholar] [CrossRef]
- Chu, C.; Geng, Y.; Zhou, Y.; Sicinski, P. Cyclin E in normal physiology and disease states. Trends Cell Biol. 2021, 31, 732–746. [Google Scholar] [CrossRef] [PubMed]
- Basu, S.; Greenwood, J.; Jones, A.W.; Nurse, P. Core control principles of the eukaryotic cell cycle. Nature 2022, 607, 381–386. [Google Scholar] [CrossRef]
- Engeland, K. Cell cycle arrest through indirect transcriptional repression by p53: I have a DREAM. Cell Death Differ. 2018, 25, 114–132. [Google Scholar] [CrossRef]
- Mulder, K.C.; Lima, L.A.; Miranda, V.J.; Dias, S.C.; Franco, O.L. Current scenario of peptide-based drugs: The key roles of cationic antitumor and antiviral peptides. Front. Microbiol. 2013, 4, 321. [Google Scholar] [CrossRef]
- Silvestro, L.; Gupta, K.; Weiser, J.N.; Axelsen, P.H. The concentration-dependent membrane activity of cecropin A. Biochemistry 1999, 38, 3850. [Google Scholar] [CrossRef]
- Chaudhary, J.; Munshi, M. Scanning electron microscopic analysis of breast aspirates. Cytopathology 1995, 6, 162–167. [Google Scholar] [CrossRef]
- Barlow, M.; Edelman, M.; Glick, R.D.; Steinberg, B.M.; Soffer, S.Z. Celecoxib inhibits invasion and metastasis via a cyclooxygenase 2-independent mechanism in an in vitro model of Ewing sarcoma. J. Pediatr. Surg. 2012, 47, 1223–1227. [Google Scholar] [CrossRef] [PubMed]
- Leeming, D.J.; Bay-Jensen, A.C.; Vassiliadis, E.; Larsen, M.R.; Henriksen, K.; Karsdal, M.A. Post-translational modifications of the extracellular matrix are key events in cancer progression: Opportunities for biochemical marker development. Biomarkers 2011, 16, 193–205. [Google Scholar] [CrossRef] [PubMed]
- Liu, H.; Zeng, Z.; Wang, S.; Li, T.; Mastriani, E.; Li, Q.-H.; Bao, H.-X.; Zhou, Y.-J.; Wang, X.; Liu, Y.; et al. Main components of pomegranate, ellagic acid and luteolin, inhibit metastasis of ovarian cancer by down-regulating MMP2 and MMP9. Cancer Biol. Ther. 2017, 18, 990–999. [Google Scholar] [CrossRef] [PubMed]
- Mali, A.V.; Wagh, U.V.; Hegde, M.V.; Chandorkar, S.S.; Surve, S.V.; Patole, M.V. In vitro anti-metastatic activity of enterolactone, a mammalian lignan derived from flax lignan, and down-regulation of matrix metalloproteinases in MCF-7 and MDA MB 231 cell lines. Indian J. Cancer 2012, 49, 181–187. [Google Scholar] [CrossRef] [PubMed]
- Hamatsu, T.; Rikimaru, T.; Yamashita, Y.; Aishima, S.; Tanaka, S.; Shirabe, K.; Shimada, M.; Toh, Y.; Sugimachi, K. The role of MTA1 gene expression in human hepatocellular carcinoma. Oncol. Rep. 2003, 10, 599–604. [Google Scholar] [PubMed]
- Toh, Y.; Oki, E.; Oda, S.; Tokunaga, E.; Ohno, S.; Maehara, Y.; Nicolson, G.L.; Sugimachi, K. Overexpression of the MTA1 gene in gastrointestinal carcinomas: Correlation with invasion and metastasis. Int. J. Cancer 1997, 74, 459–463. [Google Scholar] [CrossRef]
- Uraki, S.; Sugimoto, K.; Shiraki, K.; Tameda, M.; Inagaki, Y.; Ogura, S.; Kasai, C.; Nojiri, K.; Yoneda, M.; Yamamoto, N.; et al. Human β-defensin-3 inhibits migration of colon cancer cells via downregulation of metastasis-associated 1 family, member 2 expression. Int. J. Oncol. 2014, 45, 1059–1064. [Google Scholar] [CrossRef]
- Kessenbrock, K.; Plaks, V.; Werb, Z. Matrix metalloproteinases: Regulators of the tumor microenvironment. Cell 2010, 141, 52–67. [Google Scholar] [CrossRef]
- Jin, X.B.; Wang, Y.J.; Liang, L.L.; Pu, Q.H.; Shen, J.; Lu, X.M.; Chu, F.J.; Zhu, J.Y. Cecropin suppresses human hepatocellular carcinoma BEL- 7402 cell growth and survival in vivo without side-toxicity. Asian Pac. J. Cancer Prev. APJCP 2014, 15, 5433–5436. [Google Scholar] [CrossRef]
- Chan, S.C.; Hui, L.; Chen, H.M. Enhancement of the cytolytic effect of anti-bacterial cecropin by the microvilli of cancer cells. Anticancer Res. 1998, 18, 4467–4474. [Google Scholar] [PubMed]
- Suttmann, H.; Retz, M.; Paulsen, F.; Harder, J.; Zwergel, U.; Kamradt, J.; Wullich, B.; Unteregger, G.; Stöckle, M.; Lehmann, J. Antimicrobial peptides of the Cecropin-family show potent antitumor activity against bladder cancer cells. BMC Urol. 2008, 8, 5. [Google Scholar] [CrossRef] [PubMed]
- Yoon, W.H.; Park, H.D.; Lim, K.; Hwang, B.D. Effect of O-glycosylated mucin on invasion and metastasis of HM7 human colon cancer cells. Biochem. Biophys. Res. Commun. 1996, 222, 694–699. [Google Scholar] [CrossRef] [PubMed]
- Wang, C.; Chen, Y.W.; Zhang, L.; Gong, X.G.; Zhou, Y.; Shang, D.J. Melanoma cell surface-expressed phosphatidylserine as a therapeutic target for cationic anticancer peptide, temporin-1CEa. J. Drug Target. 2016, 24, 548–556. [Google Scholar] [CrossRef] [PubMed]
- Fadnes, B.; Rekdal, O.; Uhlin-Hansen, L. The anticancer activity of lytic peptides is inhibited by heparan sulfate on the surface of the tumor cells. BMC Cancer 2009, 9, 183. [Google Scholar] [CrossRef] [PubMed]
- Lee, J.H.; Kim, I.W.; Kim, S.H.; Yun, E.Y.; Nam, S.H.; Ahn, M.Y.; Kang, D.C.; Hwang, J.S. Anticancer activity of CopA3 dimer peptide in human gastric cancer cells. BMB Rep. 2015, 48, 324–329. [Google Scholar] [CrossRef] [PubMed]
- Dathe, M.; Wieprecht, T. Structural features of helical antimicrobial peptides: Their potential to modulate activity on model membranes and biological cells. Biochim. Biophys. Acta 1999, 1462, 71–87. [Google Scholar] [CrossRef]
- Kolata, G.B. Microvilli: A major difference between normal and cancer cells? Science 1975, 188, 819–820. [Google Scholar] [CrossRef]
- Deslouches, B.; Steckbeck, J.D.; Craigo, J.K.; Doi, Y.; Burns, J.L.; Montelaro, R.C. Engineered cationic antimicrobial peptides to overcome multidrug resistance by ESKAPE pathogens. Antimicrob. Agents Chemother. 2015, 59, 1329–1333. [Google Scholar] [CrossRef]
- Qin, Y.; Qin, Z.D.; Chen, J.; Cai, C.G.; Li, L.; Feng, L.Y.; Wang, Z.; Duns, G.J.; He, N.Y.; Chen, Z.S.; et al. From Antimicrobial to Anticancer Peptides: The Transformation of Peptides. Recent Pat. Anti-Cancer Drug Discov. 2019, 14, 70–84. [Google Scholar] [CrossRef]
- Aaghaz, S.; Gohel, V.; Kamal, A. Peptides as Potential Anticancer Agents. Curr. Top. Med. Chem. 2019, 19, 1491–1511. [Google Scholar] [CrossRef] [PubMed]
- Wang, K.R.; Yan, J.X.; Zhang, B.Z.; Song, J.J.; Jia, P.F.; Wang, R. Novel mode of action of polybia-MPI, a novel antimicrobial peptide, in multi-drug resistant leukemic cells. Cancer Lett. 2009, 278, 65–72. [Google Scholar] [CrossRef] [PubMed]
- Giannelli, G.; Koudelkova, P.; Dituri, F.; Mikulits, W. Role of epithelial to mesenchymal transition in hepatocellular carcinoma. J. Hepatol. 2016, 65, 798–808. [Google Scholar] [CrossRef] [PubMed]
- Zou, H.; Feng, X.; Cao, J.G. Twist in hepatocellular carcinoma: Pathophysiology and therapeutics. Hepatol. Int. 2015, 9, 399–405. [Google Scholar] [CrossRef]
- Merle, P.; de la Monte, S.; Kim, M.; Herrmann, M.; Tanaka, S.; Von Dem Bussche, A.; Kew, M.C.; Trepo, C.; Wands, J.R. Functional consequences of frizzled-7 receptor overexpression in human hepatocellular carcinoma. Gastroenterology 2004, 127, 1110–1122. [Google Scholar] [CrossRef]
- González, M.L.; Vera, D.M.A.; Laiolo, J.; Joray, M.B.; Maccioni, M.; Palacios, S.M.; Molina, G.; Lanza, P.A.; Gancedo, S.; Rumjanek, V.; et al. Mechanism Underlying the Reversal of Drug Resistance in P-Glycoprotein-Expressing Leukemia Cells by Pinoresinol and the Study of a Derivative. Front. Pharmacol. 2017, 8, 205. [Google Scholar] [CrossRef]
- Smyth, M.J.; Krasovskis, E.; Sutton, V.R.; Johnstone, R.W. The drug efflux protein, P-glycoprotein, additionally protects drug-resistant tumor cells from multiple forms of caspase-dependent apoptosis. Proc. Natl. Acad. Sci. USA 1998, 95, 7024–7029. [Google Scholar] [CrossRef]
AMP | Sequence | Source | Cell Line | Cytotoxicity (IC50) | Mechanism of Action | Reference |
---|---|---|---|---|---|---|
Pardaxin | H-GFFALIPKIIS SPLFKTLLSAVGSALSSSGGQE-OH | Pardachirus marmoratus | SCC-4 | Pardaxin (5, 10, 15, 20, and 25 μg/mL) inhibits the growth rate at 24 and 48 h after treatment | Caspase-3 activation-induced apoptosis and G2/M phase-induced cell arrest | [42] |
LfcinB(20–25)4 | (RRWQWR)4-K2-(Ahx)2-C2 | The tetrameric peptide of bovine lactoferrin | CAL27, SCC15 | IC50 for CAL27 = 9.016 ± 1.38 Μm, IC50 for SCC15 = 9.048 ± 1.07 μM | Apoptosis occurs at low concentrations and cell membrane necrosis occurs at high concentrations | [43] |
CDEL/CAMP | / | / | HSC-3 | After 24 h, 48 h, and 72 h of treatment, cell proliferation is inhibited | Activation of the P53-Bcl-2/BAX signaling pathway induces caspase-3-mediated apoptosis | [44] |
KI-21-3 | KIGKFFKRIVRIKKFIRKFV-NH 2 | LL-37 | SCC-4 | In vivo, the tumor weight is reduced by 30% compared with the control group, and the volume changes a little | Apoptosis induced by antiproliferation and caspase-3 | [45] |
hCAP18 (109–135) | FRKSKEKIGKEFKRIVQRIKDFLRNLV | C-terminal domain of hCAP18 | SAS-H1 | The cytotoxicity is 14 ± 3.2% at 48 h and 80 ± 5.3% at 96 h, respectively | Induces apoptotic cell death and oligosomal DNA fragmentation through caspase-independent pathways | [46] |
HNP-1 | / | Human polymorphonuclear leukocytes (neutrophils) | UT-SCC-43A, UT-SCC-43B | After 48 h of treatment, HNP1 (1–10 μg/mL) has no obvious cytotoxicity | / | [47] |
HNP-1 + lactoferrin | / | / | Two oral squamous cell carcinoma (OSCC) lines | The cytotoxicity of lactoferrin (12.5–100 μg/mL) increases at 72 h after treatment. HNP-1 (100 μg/mL) has significant cytotoxicity at 24, 48, and 72 h after treatment | Lactoferrin (50 μg/mL) and HNP-1 (10 μg/mL) show selective oncolytic effects | [48] |
HBD-1 | / | Epithelial tissue | BHY-OSCC, HSC-3, UM1, SCC-9, SCC25 | After 24 h of treatment, HBD-1 (50 nM) reduces the proliferation of BHY-OSCC cells by 25%. HBD-1 (50 mg/mL) does not significantly inhibit the proliferation of HSC-3/UM1/SCC-9/SCC25 cells | HBD-1 may be a tumor suppressor gene in oral squamous cell carcinoma. Exogenous expression of HBD-1 significantly inhibits migration and invasion | [49,50] |
NRC-03 | GRRKRKWLRRIGKGVKIIGGAALDHL-NH2 | Skin mucous secretions of winter flounder | CAL-27, SCC-9 | The cytotoxicity of NRC-03 (15–75 μg/mL) is significantly increased at 4 h after treatment | The cypD-mPTP axis mediates mitochondrial oxidative stress-induced apoptosis | [51] |
AMP | Sequence | Source | Cell Line | Cytotoxicity (IC50) | Mechanism of Action | Reference |
---|---|---|---|---|---|---|
LvHemB1 | DVNFLLHKIYGNIRY | N-terminal domain of L. vannamei hemocyanin | EC190 | After 24 h of treatment, the viability of LvHemB1 (50 µg/mL) cells decreased by 49.1% | Antiproliferative effects and targeting of the voltage-dependent anion channel 1 (VDAC1) lead to mitochondrial dysfunction in cancer cells, as well as the induction of apoptosis by increasing ROS levels, and the expression of proapoptotic proteins | [58] |
BmCecA and BmCecD | BmCecA: RWKLFKKIEKVGRNVRD GLIKAGPAIAVIGQAKSLGK BmCecD: GNFFKDLEKMGQRVRDAVISAAPAVDTLAKAKALGQ | Bombyx mori | Eca109, TE13 | After 12 h of treatment, the inhibition rates of BmCecA (100 µg/mL) EC190 cells and TE13 cells are 36.68 ± 2.31% and 17.71 ± 2.81%, respectively. BmCecD (100 µg/mL) decreases the viability of EC190 cells by 30.72 ± 1.62%, and the inhibition rate of TE13 cells is 21.92 ± 3.7% | BmCecA induces apoptosis of Eca109 cells by activating the mitochondria-mediated caspase pathway, upregulating Bcl-2-associated X protein, and downregulating Bcl-2 | [54] |
Cecropin A | RWKLFKKIEKVGRNVRDGL IKAGPAIAVIGQAKSLGK | Bombyx mori | By binding to the mitochondrial membrane and entering the cytoplasm, damage to the mitochondrial membrane triggers apoptosis | [55] | ||
CecropinXJ | MNFAKILSFVFALVLALSMTSAAPEPRWKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK | Bombyx mori | Eca109 | Cytotoxicity is triggered by inducing cytoskeletal disruption and regulating the expression of cytoskeletal proteins | [57] | |
Cecropin D | GNFFKDLEKMGQRVRDAV ISAAPAVDTLAKAKALGQ | Bombyx mori | By penetrating deeply into the mitochondrial membrane bilayer containing cardiolipin, it leads to a significant destabilization of lipid packaging, which may account for its proapoptotic activity | [56] |
AMP | Sequence | Source | Cell Line | Cytotoxicity (IC50) | Mechanism of Action | Reference |
---|---|---|---|---|---|---|
Enterocin A–Colicin E1 | / | E. coli | AGS | Treatment for 24 h IC50 = 60.41 μM Treatment for 48 h IC50 = 48.71 μM | The Bax/bcl-2 ratio at the mRNA level is increased to induce apoptosis | [63] |
Bovine lactoferricin B | FKCRRWQWRMK KLGAPSITCVRRAF | Fragments of bLF pepsin hydrolysis | AGS, 3T3 | IC50 for AGS = 64 μM IC50 for 3T3 ≥ 500 μM | Increasing mRNA levels inhibits the final stage of autophagy and enhances the bax/bcl-2 ratio of caspase-dependent apoptosis to induce apoptosis | [64] |
Melittin | / | Bee venom | AGS | Melittin (0.2–0.5 μM) reduces the number of viable cells by 24–79% at 24 h after treatment | Downregulating the expression of vimentin, N-cadherin, and MMP-2 and upregulating the expression of E-cadherin, MMP-9, and MMP-13 inhibits metastasis through Wnt/β-catenin, BMP/Smad, and EMT signaling pathways | [65] |
Enterocin-B and enterocin-A + B | / | E. faecium por1 | AGS | After 24 h of treatment, the inhibition rate of enterocin-B (25 μg/mL) is 22.84 ± 2.68%. After 24 h of treatment, the inhibition rate of enterocin-A+B (25 μg/mL) is 51.76 ± 1.12% | / | [66] |
GW-H1 | GYNYAKKLAN LAKKFANALW | AGS, 3T3 | IC50 for AGS = 17 μM IC50 for 3T3 = 243 μM | Apoptosis and autophagy are induced in the AGS cell line at the early stage, and caspase-dependent apoptosis is further enhanced by inhibition of autophagy at the late stage | [67] | |
CopA3 | / | An analog derived from coprisin | SNU-484, 601, 638, 668 | IC50 for SNU = 18–29 μM IC50 for human keratinocytes ≥ 500 μM | Induction of caspase-dependent pathway apoptosis and necrosis in gastric cancer in vitro and in vivo increases selective toxicity through specific interactions with cancer cell membrane phosphatidylserine and phosphatidylcholine | [68] |
Dimerized melittin | GIGAVLKVLTTGLPALISWIKRKRQQ-Dab-NH2 | Bee venom | NUGC-3, MKN-7, MKN-74 | Dimerized melittin (1–5 μM) is highly cytotoxic in gastric cancer cells after 24 h of treatment | Both melittin monomers and dimers penetrated the cytoplasm | [69] |
Melittin | / | Bee venom | AGS | The survival rate of melittin (5–20 μg/mL) is significantly decreased at 4 h after treatment | A high dose of melittin has a membrane effect on gastric cancer cells over a time course of 15 min, with cellular changes occurring within seconds in the form of cell swelling, membrane blebbing, and fragmentation | [70] |
DEFA5 | / | SGC7901, HEK293T, BGC823 | After 24 h of treatment, overexpression of human DEFA5 effectively reduces cell proliferation and colony formation ability | It inhibited cell proliferation by directly binding to BMI1, reducing its binding to CDKN2a, and upregulating the expression of two cyclin-dependent kinase inhibitors, p16 and p19 | [71] | |
LL-37 | / | Human | AGS, TMK1 | The inhibition rate of LL-37 (25 mg/mL) at 24 h of treatment is 60% for TMK1 and 10% for AGS | Activation of the BMP signaling pathway inhibits cell proliferation through a proteasome-dependent mechanism | [72] |
Melittin | / | Bee venom | SGC-7901 | / | It induces the release of ROS and the opening of the mitochondrial permeability transition pore, releases Cyt C, Smac/Diablo, AIF, and EndoG proteins, activates caspase-3, leads to the formation of apoptotic bodies, and ultimately produces apoptosis | [61] |
CecropinXJ | WKIFKKIEKMGRNIRDGIVKAGPAIEVLGSAKAIGK | Bombyx mori | BGC823 | The proliferation of BGC 823 cells is inhibited in a dose- and time-dependent manner | It inhibits cell growth in vitro and in vivo by promoting ROS production, reducing mitochondrial membrane potential, inducing apoptosis in the caspase pathway, and preventing tumor angiogenesis | [73] |
Melittin | / | Iranian honeybee venom | AGS | The proliferation of AGS cells is inhibited in a dose- and time-dependent manner | Melittin has an anticancer effect on gastric cancer AGS cells and stimulates necrotic cell death in these cells | [74] |
TMTP1-DKK | KLAKLAKK LAKLAK | MKN-45 | / | Apoptosis is triggered in a series of highly metastatic cancer cells via the mitochondrial pathway and the death receptor pathway | [75] |
AMP | Sequence | Source | Cell Line | Cytotoxicity (IC50) | Mechanism of Action | Reference |
---|---|---|---|---|---|---|
DEFB1 | / | Epithelial tissues | HepG, Huh7, HCCLM3 | Overexpression of DEFB1 decreased cell proliferation in a time-dependent manner | Activation of the JNK pathway induced by ER stress exerts an inhibitory effect on cell proliferation during tumor growth | [80] |
MzDef | MSSSNCANVCQTENFPGGECKAEGATRKCFCKNC | Maize | HePG2 | IC50 = 14.85~29.85 μg/mL | [81] | |
Cecropin | MNFNKLFVFVALVLAVCIGQSEAGWLKKIGKKIERVGQHTRdATIQTIGVAQQAANVAATLKG | Musca domestica | BEL-7402 | / | By disrupting the microvilli of tumor cells and altering the expression of MMP2, TIMP2, and E-cadherin, cell adhesion and migration are inhibited | [82] |
Cecropin | MNFNKLFVFVALVLAVCIGQSEAGW- LKKIGKKIERVGQHTRDATIQTIGVAQQAANVAATLKG | Musca domestica | BEL-7402 | Cecropin (12.5–100 mM) inhibits the proliferation of BEL-7402 cells in a dose- and time-dependent manner | It may induce cell apoptosis by upregulating the expression of Fas, Fas-L, caspase-8, and caspase-3 and triggering the extrinsic apoptotic pathway | [83] |
SK84 | Drosophila | HePG2 | IC50 = 92 μg/mL | [84] | ||
CecropinXJ | / | Bombyx mori | Huh7 | The inhibition rate of cecropinXJ (50 µmol/L) is 36.6 ± 0.1%, which inhibits cell proliferation in a dose- and time-dependent manner | Inhibition of cell proliferation and induction of apoptosis in vitro via mitochondrial apoptotic pathways including loss of Δψm, the release of mitochondrial cytochrome c, and activation of caspase-3 and PARP | [85] |
rCec-B | / | Drosophila melanogaster | HePG2 | IC50 for HePG2 =25 μg/mL | [86] | |
GW-H1 | / | Synthesis | J5, Hep3B, Huh7 | IC50 for J5 = 20.3 μg/mL IC50 for Hep3B = 67.2 μg/mL IC50 for Huh7 = 87.2 μg/mL IC50 for 3T3 = 234.3 μg/mL | Caspase-dependent apoptosis is induced | [87] |
Smp43 | / | Egyptian scorpion Scorpio maurus palmatus | HepG2, Huh7 | IC50 for HepG2 = 4.69 μg/mL IC50 for Huh7 = 5.14 μg/mL | Internalization into cells through endocytosis and pore formation leads to mitochondrial dysfunction and cell membrane disruption, inducing apoptosis, autophagy, necrosis, and cell cycle arrest | [88] |
B11 | RIRDAIAHGYIVDKV | Copper-containing domain of L. vannamei hemocyanin | HePG2 | After 24 h of treatment, the viability of B11 (50 µg/mL) cells decreased by 23.0% | It has an antiproliferative effect on cancer cells, can cause mitochondrial dysfunction, and induces apoptosis | [89] |
Brevinin-1BYa | FLPILASLAAKFGPKLFCLVTKKC | Frog Rana boylii | HePG2 | LC50 =6 μg/mL | [90] | |
GW13 | GLRPKYS(RWL)2-NH2 | Chicken epithelial tissue | HePG2 | The survival rate of MRC-5 cells treated with GW13 (128 μM) for 24 h is 81%, while that of HepG2 cells is 3% | Cell death is induced by pore formation and selective membrane disruption, as well as apoptosis | [91] |
Bombinin-BO1 and Bombinin H-BO1 | GIGSAILSAGKSIIKGLAKGLAEHF-NH2 and IIGPVLGLVGKALGGLL-NH2 | Bombina orientalis | HepG2, SKHEP-1, Huh7 | Bombinin-BO1: IC50 for SKHEP-1 = 0.76 μg/mL IC50 for Hep G2 = 3.75 μg/mL IC50 for Huh7 = 3.91 μg/mL Bombinin H-BO1: IC50 for SKHEP-1 = 3.61 μg/mL IC50 for Hep G2 = 8.08 μg/mL IC50 for Huh7 = 8.42 μg/mL | / | [92] |
LL-37 | LLGDFFRKSKEKIGKEFKRIVQRIKDFL RNLVPRTES | Human | HepG2, Huh7 | LL-37 (10–20 μM) significantly reduced the viability of Huh7 and HepG2 cells after 48 h of treatment | By inhibiting the CyclinD1-CDK4-p21 checkpoint signaling pathway, it delays the G1-S transition in cells and participates in apoptosis and proinflammatory cytokine production | [93] |
Trichokonin VI | Trichoderma pseudokoningii SMF2 | HCC | / | Promotes Ca2+ influx, activates calpain, then cleaves Atg5 and Bax, combines with Bcl-xL to destroy mitochondria, accelerates the destruction of mitochondrial integrity and cytochrome c release, further activates caspease3, and eventually leads to apoptosis. Ca2+ influx activates BaK and promotes ROS accumulation, and ROS-susceptible cells undergo autophagy through the mitophagy pathway | [94] | |
M1-8 | GWLKKIGK | Musca domestica cecropin | HepG2 | After 24 h of treatment, M1-8 (25 μg/mL) inhibited the proliferation of HepG2 cells | Upon exposure to M1-8, human hepatocellular carcinoma HepG2 cells rapidly colocalize with lysosomes, destroying lysosomal integrity and blocking autophagy–lysosome fusion, leading to leakage of lysosomal protease cathepsin D, activation of caspases, and changes in mitochondrial membrane potential, and promoting apoptosis. | [95] |
Nisin | Streptococcus spp and Lactococcus spp | HePG2 | IC50 = 40 μg/mL | It plays a role in apoptosis by increasing the cellular mitochondrial pathway | [96] | |
Smp24 | Scorpio Maurus palmatus | HepG2 | IC50 for HepG2 = 5.52 μg/mL IC50 for LO2 = 16.68 μg/mL | Entry into cells through pore formation and endocytosis leads to mitochondrial dysfunction and membrane defects, which lead to cell necrosis, cycle arrest, apoptosis, and autophagy | [97] | |
PR-39 | Pig small intestines | Huh1, Huh2, HL E, HLF | Induction of Syndecan-1, inhibition of invasion and motility activity, and changes in actin structure | [98] | ||
Cecropin-P17 | FKKKVGRNIRNGIIK | Cecropin B | HepG2 | The survival rate of cecropin-P17 (40 μg/mL) cells is 45.3% at 48 h after treatment | By increasing the concentration of ROS in cells, it activates caspase-3 and caspase-9, increases the expression of Bcl-2 protein, decreases the expression of Bax protein, promotes cell apoptosis, and inhibits cell proliferation in vitro and in vivo | [99] |
Melittin (MEL) and MEL-pep | MEL-pep: GIGAVLKKLTTGLKALISWIKRKRQQMEL: GIGAVLKVLTTGLPALISWIKRKRQQ | Bee venom | BEL-7402/5-FU | MEL-pep: IC50 for BEL-7402/5-FU = 4.44 μg/mL MEL: IC50 for BEL-7402/5-FU = 11.09 μg/mL | MEL-pep could significantly inhibit the proliferation of BEL-7402/5-FU cells by selectively binding to and destroying the cell membrane. MEL-pep could also reverse the drug resistance of BEL-7402/5-FU cells and restore the sensitivity to 5-FU | [100] |
WRL3 | WLRAFRRLVRRLARGLRR-NH2 | Leuconostoc gelidum UAL 187 | HepG2 | IC50 for HepG2 = 32 μg/mL IC50 for LO2 = 16.68 μg/mL | The killing of microorganisms and tumor cells by disrupting the cell membrane leads to cytoplasmic efflux | [101] |
HBD-3 | / | Epithelial cells | Huh7.5 | / | Activated PBMC secretes IFN-γ and kills K562 and HUH liver cancer target cells in an NK-dependent manner, and both TLR1/2 and CCR2 are involved | [102] |
rpNK-lysin | / | Porcine intestinal tissue | HepG2, SMMC-7721, MHCC 97-H | MNTC for LO2 = 90.8 μg/mL MNTC for SMMC-7721 = 54.16 μg/mL MNTC for MHCC 97-H = 51.76 μg/mL MNTC for HepG = 47.38 μg/mL MNTC = maximum nontoxic concentration | Fascin1 inhibits the invasion and metastasis of HCC cells by downregulating Fascin1. Fascin1 further regulates the Wnt/β-catenin signaling pathway, induces β-catenin degradation, and inhibits the expression of MMP-2 and MMP9 | [103] |
Nisin | Lactococcus and streptococcus species | SNU182, Huh7 | At 24 and 48 h after treatment, Nisin (48–160 μg/mL) begins to inhibit proliferation | It has a potent antitumor effect on HCC by reducing cell proliferation and activating apoptosis in HCC disease model cell lines | [104] | |
CopA3 | LLCIALRKK-NH2 | Copris tripartitus | Hep3B, Hep2G, SK-Hep1, SNU-182, SNU-354 | IC50 = 67.8 µM | / | [105] |
AMP | Sequence | Source | Cell Line | Cytotoxicity (IC50) | Mechanism of Action | Reference |
---|---|---|---|---|---|---|
rSs-arasin | MERRTLLIVLLVCSFLLLAVTAEA | Scylla serrata | HT-29 | IC50 = 2.90 μM | / | [109] |
Plantaricin P1053 | / | L.plantarum PBS067 strain | E705 | Phytomycin P1053 (1 μg/mL) inhibited cell proliferation by about 30% at 48 h after treatment | / | [110] |
GA-W3 and GA-W4 and GA-K3 and GA-K4 | FLGWLFKWAWK-NH2 and FLWWLFKWAWK-NH2 and FLGWLFKWAKK-NH2 and FLKWLFWAKK-NH2 | Brevinin-1EMa | HCT-116 | GA-W3: IC50 = 24.63 μM GA-W4: IC50 = 14.80 μM GA-K3: IC50 = 27.00 μM GA-K4: IC50 = 14.80 μM | / | [111] |
G3 | G(IIKK)3I-NH2 | HCT-116 | The cytotoxicity of G3 (100 μM) is 80%, 85%, and 95% at 24 h, 48 h, and 72 h after treatment, respectively | High concentrations of peptides disrupt tumor cell membranes | [112] | |
FK-16 | FKRIVQRIKDFLRNLV | LL-37 | LoVo, HCT-116 | The cytotoxicity of FK-16 (40 μM) LoVo cells is about 50%, and that of HCT116 cells is about 60% | Activation of p53 induces caspase-independent apoptosis and autophagic cell death in colon cancer cells by upregulating Bax and downregulating bcl-2 | [113] |
HPA3P | AKKVFKRLPKLFSKIWNWK-NH2 | Analogs of Helicobacter pylori ribosomal protein L1 | LoVo, HT-29, SW-480, HCT-116 p53+/HCT-116 p53-/ | After 6 h of treatment, HPA3P (60 μM) has about 80% cytotoxicity in all types of cells | Ripk3-dependent necroptosis is induced | [114,115] |
Enterocin-A | MKHLKILSIKETQLIYGGTTHSGKYYGNGVYCTKNKCTVDWAKATTCIAGMSIGGFLGGAIPGKC | Escherichia faecalis Por1 | HT-29 | The cytotoxicity of enterocin-A (120 μg/mL) at 24 h and 48 h is 56.16 ± 0.41% and 83.74 ± 0.47%, respectively | Sub-G and G1 phase cell cycle arrest as well as induction of apoptosis and cell death | [116] |
GM3 | / | Goat milk | HT-29 | The cytotoxicity of GM3 (2240 AU/mL) is 45.6 ± 0.6% at 24 h after treatment | / | [117] |
Nisin | / | Lactococcus lactis subsp | LS-180, SW-48, HT-29, CaCO-2 | After 24 h of treatment, Nisin (80–400 IU/mL) has about 50% cytotoxicity on LS-180 cells. Nisin (350–800 IU/mL) is approximately 50% cytotoxic to SW-48, HT-29, and Caco-2 cells | Reducing the expression of CEA, CEAM6, MMP2F, and MMP9F genes inhibits the metastasis of colon cancer cells | [118] |
KL15 | KRKLYKWFAHLIKGL | Bacteriocin m2163 and m2386 sequences | SW-480, Caco-2 | IC 50 = 26.3 μM | Disruption of the cell membrane enhances membrane permeability to induce cell necrosis pathways | [119] |
KT2 | NGVQPKYKWWKWWKKWW-NH2 | Crocodile white blood cells | HCT-116 | IC50 = 50 μM | It promotes cell membrane defects and caspase-dependent pathways to mediate apoptosis and inhibit autophagy | [120] |
HDH-LGBP-A1 and HDH-LGBP-A2 | WLWKAIWKLLT-NH2/WLWKAIWKLLK-NH2 | Haliotis discus hannai | HCT-116 | The cytotoxicity of HDH-LGBP-A1 (25 μg/mL) and HDH-LGBP-A2 (25 μg/mL) is 93.96% and 93.6%, respectively | Cell detachment, swelling, and damage are induced, and disruption of the cell membrane leads to cell death | [121] |
HD-5 | ATCYCRTGRCATRESLSGVCEISGRLYRLCCR | Human intestinal tract | / | / | Disruption of cell membrane integrity and induction of apoptosis | [122] |
LL-37 | / | Epithelial tissue | p53 wild-type (HCT-116, LoVo) mutant (SW-1116, SW-620, SW-480) | LL37 (60 μmol/L) showed certain cytotoxicity on all cells | Nuclear translocation of AIF and EndoG through upregulation of Bax and Bak and downregulation of Bcl-2 induces caspase-independent apoptosis in colon cancer | [123] |
RT2 | NGVQPKYRWWRWWRWWW-NH2 | Crocodile white blood cells | Caco-2 | RT2 (120 μM) has 91.45% cytotoxicity | Inhibition of colon cancer cell proliferation by enhancing STARD13, TLE3, and OGDHL expression | [124] |
MELITININ + BMAP27 | / | / | HT-29, SW-742, HCT-116, WiDr | The IC50 is 30, 20, and 10 μg/mL at 24, 48, and 72 h of treatment, respectively | Apoptosis and autophagy mechanisms induce cancer cell death | [125] |
CopA3 | / | Coprisin | HCT-116, KM12C, ROK | After 96 h of treatment, CopA3 (5 μM) significantly reduced the number of cancer cells | Inhibits the growth and proliferation of colorectal cancer cells by inducing cell cycle arrest through an ROS-mediated pathway | [126] |
Br-J-I | PFaKLSLHL-NH2 | Royal jelly of honeybees | HCT-116, Lovo, HT-29, MC-38 | Br-J-I (80 μM) treatment does not cause significant cytotoxicity at 72 h of treatment | It is not cytotoxic to cancer cells, but it can indirectly and effectively inhibit Fn-induced colorectal cancer and inflammatory protumor effects by killing Fn | [127] |
m2163 and m2386 | KRKCPKTPFDNTPGAWFAHLILGC and DSIRDVSPTFNKIRRWFDGLFK | LAB L. casei ATCC 334 | SW-480, Caco-2 | M2163: IC50 = 40 μg/mL M2386: IC50 = 40 μg/mL | The ratio of proapoptotic Bax/antiapoptotic protein Bcl-2 was altered to induce exogenous and endogenous apoptosis | [128] |
HD6 | / | Paneth cells in the small intestine | CaCO-2, HT-29, HCT-116, DLD-1 | HD6 inhibited CRC proliferation | Inhibition of CRC proliferation and metastasis by eliminating EGF/EGFR signaling pathway | [129] |
MzDef | MSSSNCANVCQTENFPGGECKAEGATRKCFCKNC | Zea Mays L. | HCT-116 | Treatment for 24 h, IC50 = 14.85–29.85 μg/mL | / | [81] |
CSA-13 | / | LL-37 | HCT-116 | The cytotoxicity of CSA-13 (10 mg/mL) wild-type HCT 116 cells was 40–70%, and that of p53 null mutant was 60–70% | Induced cell cycle arrest and antiproliferation in wild-type and p53 deletion mutant HCT116 colon cancer cells | [130] |
FF/CAP18 | FRKSKEKIGKFFKRIVQRIFDFLRNLV | LL-37 | HCT-116 | FF/CAP18 (10 μg/mL) could inhibit the growth of HCT-116 cells | Induction of partial mitochondrial membrane depolarization, an early stage of apoptosis, has an antiproliferative effect on human colon cancer cell line HCT116 | [131] |
BO18 | RGNWKVKYLRIIKNRGSF | Oplegnathus fasciatus | HT-29 | After 24 h of treatment, the viability of HT-29 decreased, and with the increase in BO18 concentration, the inhibition ratio of HT-29 increased significantly | / | [132] |
Nisin | / | Lactococcus lactis | SW-48 | The cytotoxicity of Nisin (4000, 3000, 2500, 2000, and 1000 μg/mL) is 15%, 42.94%, 41.77%, 41.55%, and 79.22%, respectively, at 24 h after treatment | Cell intrinsic pathway apoptosis is induced by increasing the bax/bcl-2 ratio at both mRNA and protein levels | [133] |
Lactoferrin | / | Cow’s milk | CaCo-2 | Lactoferrin (0.02 μM, 0.2 μM or 2.0 μM) decreased cell proliferation at 24, 48, and 72 h of treatment | It prolongs the S phase of the cell cycle, resulting in a decrease in the cell proliferation rate | [134] |
Bmattacin2 | / | Bombyx mori | HCT-116 | At 24 h of treatment, Bmattacin2 (12 μM) selectively killed HCT-116 | / | [135] |
BLf and LfcinB | LfcinB: FKCRRWQWRMKKLGAPSITCVRRAF | Pepsin proteolytic production | HT-29 | Cytotoxicity is demonstrated at 50, 100, 200, 400, or 800 μg/mL at 4, 12, 24, or 48 h of treatment, respectively | It exerts antitumor activity on human colorectal cancer cells by activating various signaling pathways (p53, apoptosis, and angiogenin signaling) | [136] |
MccE492 | / | A bacteriocin produced by Klebsiella pneumonia | HT-29 | The viability of MccE492 (30 μg/mL or 60 μg/mL) cells decreased to 66.4% or 50% at 24 h after treatment, respectively | / | [137] |
rhCGA-N46 | / | Human chromogranin A | HCT-116 | IC 50= 1.997 μg/mL | Apoptosis of HCT-116 cells is induced via upregulation of BID and CAS-8 apoptotic genes via downregulation of oncogene BCL2 and upregulation of qPCR | [138] |
Gramicidin A (GA) | VGALAVVV WLWLWLW | Aneurinibacillus migulanus | HT-29 | IC50 = 9.78 μM | / | [139] |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2023 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Liu, Q.; Wang, L.; He, D.; Wu, Y.; Liu, X.; Yang, Y.; Chen, Z.; Dong, Z.; Luo, Y.; Song, Y. Application Value of Antimicrobial Peptides in Gastrointestinal Tumors. Int. J. Mol. Sci. 2023, 24, 16718. https://doi.org/10.3390/ijms242316718
Liu Q, Wang L, He D, Wu Y, Liu X, Yang Y, Chen Z, Dong Z, Luo Y, Song Y. Application Value of Antimicrobial Peptides in Gastrointestinal Tumors. International Journal of Molecular Sciences. 2023; 24(23):16718. https://doi.org/10.3390/ijms242316718
Chicago/Turabian StyleLiu, Qi, Lei Wang, Dongxia He, Yuewei Wu, Xian Liu, Yahan Yang, Zhizhi Chen, Zhan Dong, Ying Luo, and Yuzhu Song. 2023. "Application Value of Antimicrobial Peptides in Gastrointestinal Tumors" International Journal of Molecular Sciences 24, no. 23: 16718. https://doi.org/10.3390/ijms242316718