Next Article in Journal
The Modulatory Effect of Selol (Se IV) on Pro-Inflammatory Pathways in RAW 264.7 Macrophages
Next Article in Special Issue
Drosophila melanogaster: A Model Organism in Muscular Dystrophy Studies
Previous Article in Journal
Comparative Pharmacokinetic Analysis of Aflibercept and Brolucizumab in Human Aqueous Humor Using Nano-Surface and Molecular-Orientation Limited Proteolysis
Previous Article in Special Issue
Macrophage-like Blood Cells Are Involved in Inter-Tissue Communication to Activate JAK/STAT Signaling, Inducing Antitumor Turandot Proteins in Drosophila Fat Body via the TNF-JNK Pathway
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Cross-Species Epitope Sequence Analysis for Discovery of Existing Antibodies Useful for Phospho-Specific Protein Detection in Model Species

1
Department of Genetics, Blavatnik Institute, Harvard Medical School, 77 Avenue Louis Pasteur, Boston, MA 02115, USA
2
Cell Signaling Technology, 3 Trask Lane, Danvers, MA 01923, USA
3
Howard Hughes Medical Institute, 77 Avenue Louis Pasteur, Boston, MA 02115, USA
*
Authors to whom correspondence should be addressed.
Int. J. Mol. Sci. 2025, 26(2), 558; https://doi.org/10.3390/ijms26020558
Submission received: 19 December 2024 / Revised: 3 January 2025 / Accepted: 4 January 2025 / Published: 10 January 2025
(This article belongs to the Special Issue Drosophila: A Model System for Human Disease Research)

Abstract

:
Signaling pathways play key roles in many important biological processes, such as cell division, differentiation, and migration. Phosphorylation site-specific antibodies specifically target proteins phosphorylated on a given tyrosine, threonine, or serine residue. The use of phospho-specific antibodies facilitates the analysis of signaling pathway regulation and activity. Given the usefulness of phospho-specific antibodies, a number of collections of these antibodies have been generated, typically for the detection of phosphorylated mammalian proteins. Anecdotal evidence shows that some of these are also useful for the detection of phosphorylated forms of orthologous proteins in model organisms. We propose that anti-phospho-mammalian protein antibody collections comprise an untapped resource for research in other species. To systematically analyze the potential utility of anti-phospho-mammalian protein antibodies in other species, we developed the Cross-species Epitope Sequence Analysis software tool (CESA). CESA identifies and aligns orthologous proteins in model species and then analyzes the conservation of antibody target sites. We used CESA to predict what phospho-specific antibodies in a collection from Cell Signaling Technology (CST) might be useful for studies in Drosophila melanogaster and other species. CESA predicts that more than 232 sites on 116 Drosophila proteins can potentially be targeted by the antibodies initially developed at CST to detect human, mouse, or rat phosphoproteins.

1. Introduction

Post-translational modification is essential for the regulation of many cellular processes. For example, phosphorylation can serve as a molecular switch for signal transduction by making the conformational change adjusting protein–protein binding surfaces or the localization of the target protein [1,2]. The availability of phospho-specific antibodies has revolutionized the study of the signal transduction process by making it possible to track not only the expression level but also the activity of the key players of signaling pathways. Phospho-specific antibodies are generated using peptides containing one or more phosphorylated amino acids, and this process is more difficult than traditional antibody production, which can be achieved by utilizing purified antigens or peptide immunogens. Therefore, compared to the available antibodies, the phosphoantibody resources are more limited. For example, based on the antibodypedia [3], more than 7000 human genes can be targeted by antibodies, while less than 500 human genes can be targeted by phospho-specific antibodies based on the PhosphoPlus database [4,5], the largest phosphoantibody resource. The number dramatically drops for model organisms such as Drosophila melanogaster, Danio rerio, and Caenorhabditis elegans, for which only a handful of phosphoantibodies are available commercially. To facilitate the identification of anti-phosphosite antibodies that might be useful in species other than the original target species, we developed the Cross-species Epitope Sequence Analysis (CESA) software tool to evaluate the conservation of phosphorylated sites between the original species in which it was defined—e.g., human, and another species, such as a model organism species.

2. Results

2.1. Defining Rules for Predicting Cross-Reactivity of Phospho-Specific Antibodies with Orthologous Proteins in Non-Target Species

We reasoned that for an antibody to be useful in detecting a corresponding phosphosite on an orthologous protein in another species, the amino acid sequence of the phosphosite and the surrounding region must be conserved. However, examples in the literature [6] and as reported in commercial antibody catalogs (e.g., selected examples in Table 1) suggest that the region of conservation surrounding the phosphosite can be as small as six amino acids.
To more precisely infer what amino acid identity and similarity is sufficient to predict cross-reaction of an anti-phosphosite antibody directed against ‘protein A’ with some orthologous ‘protein B’ in another species, we first analyzed attributes of anti-phosphosite antibodies already reported to cross-react with another species. As a source for information, we turned to the PhosphoSitePlus web-based bioinformatics resource (https://www.phosphosite.org) [4,5], which is made available by Cell Signaling Technologies (CST), one of the commercial sources for anti-phosphosite antibodies. The March 2024 PhosphoSitePlus release file lists 378,971 phosphosites annotated in 27 organisms, 2357 of which are reported to be recognized by CST antibodies. Among the antibodies targeting these 2357 sites, 12 antibodies are reported in PhosphoSite Plus to cross-react with phosphosites on eight Drosophila proteins (Table 1). There are a few other commercial sources with a limited number of anti-phosphosite antibodies that can cross-react with Drosophila as well. However, the information regarding the target site is quite limited; for example, the protein accession and the peptide sequence information are not publicly available. Therefore, we only focused on the antibodies from CST. After we aligned the original target sites with seven amino acids on each side with the protein of Drosophila ortholog, we evaluated the conservation for these 12 validated sites of cross-reactivity. As expected, the aligned sites are conserved between human and Drosophila orthologs, with identical sequences over 6–15 amino acid regions spanning the phosphosite region.

2.2. Development of the Cross-Species Epitope Sequence Analysis (CESA) Software Tool

We developed the Cross-species Epitope Sequence Analysis (CESA) software tool to evaluate the conservation of phosphorylated sites between the original species in which it was defined, e.g., human, and another species, such as a model organism species, with the ultimate goal of identifying anti-phosphosite antibodies that might be useful in species other than the original target species. There are five major steps in the pipeline (Figure 1A). First, CESA maps the epitope sequence to a current protein release, such that the full protein sequence can be identified for alignment and the amino acid position of the target site relative to the reference protein sequence is noted. This step of validating the information about the target site on the source protein against which the antibody was originally generated is critical for the downstream analysis. However, we observed that some of the protein accession numbers in the CST catalog are outdated and, therefore, failed to retrieve the full protein sequence from current protein resources. To overcome this issue, we added an additional process for records that failed the first step to identify the current protein records from the RefSeq database using the gene symbol provided in the catalog as well as the gene2refseq mapping file from NCBI (https://ftp.ncbi.nlm.nih.gov/gene/DATA/). Then, these protein sequences retrieved based on gene symbol are compared with the phosphopeptide sequence from the catalog to annotate the location of the phosphosite (Figure 1B). Second, CESA maps gene symbols and/or protein accession numbers to NCBI Entrez Gene identifiers using the gene identifier mapping tools developed in-house. This allowed us to assign Entrez Gene IDs, which are needed to query orthologous genes using DIOPT, an ortholog mapping database that integrates ortholog mapping from more than twenty algorithms [7]. Third, CESA maps input genes from humans or mice to orthologs in the second species, such as Drosophila, based on ortholog predictions from DIOPT, with the filter selecting only the mapping of high or moderate confidence [7]. Next, CESA performs pairwise protein alignment of each input protein sequence with all isoforms of the model species ortholog using a global alignment algorithm. In the last step, a parser was developed to identify the target sequence of the input protein and the aligned Drosophila sequence, then analyze the conservation of all peptides six to eleven amino acids long spanning each amino acid that can be phosphorylated to identify the sites that are identical between the two species. We allow only one conserved amino acid replacement at the location not right next to the target amino acid (S/T/Y). The amino acid conservation in the area immediately surrounding and including the aligned phosphorylation site with different peptide length cutoff is summarized in the output file.

2.3. Application of CESA to Predict Drosophila Targets of Phosphosite Antibodies

As a test case, we applied the CESA pipeline to identify anti-phosphosite antibodies at CST that might cross-react with an orthologous protein in Drosophila. As an input set, we selected the subset of 2301 phosphorylated sites in PhosphoSitePlus that were originally annotated for humans, mice, or rats and can be targeted by antibodies in the CST collection. Using CESA, 998 of 1170 genes from humans, mice, and rats were mapped to 659 Drosophila genes, among which 232 phosphorylation sites on 116 Drosophila genes that can be potentially targeted by the CST antibodies originally developed for other species using six amino acids as cut-off (Table 2, Table 3 and Table S1). Among the 116 Drosophila genes that can be potentially targeted by CST antibodies, there are only three unannotated genes with CG number as the gene symbol, and 87 (75%) of them have more than 20 associated publications (Table S1). Gene set enrichment analysis was conducted using PANGEA (PAthway, Network and Gene-set Enrichment Analysis) [8] to identify the gene groups that are over-represented among them, and the top gene groups are kinases (47 genes, P adj = 2.80 × 10−24) and core components of major signaling pathways (29 genes, P adj = 1.21 × 10−20) (Figure 2, Table S2). For example, the Drosophila insulin receptor (InR, FBgn0283499) is one of the core components of the insulin signaling pathway. The region spanning the three C-terminal tyrosines (Y1545/1549/1550 on the RB isoform) of this gene not only shares 100% identity with humans but also the phosphorylation at these sites has been observed in Drosophila based on the phospho-proteomics data in iProteinDB [9] (Figure S1). The Abcam antibody ab62321 has been tested in humans for the first site, while the CST antibody CST3024 has been tested in humans, mice, and rats for the second and third sites. Based on the literature, Abcam antibody ab62321 has been tested, and its reactivity in Drosophila S2R+ cells was shown upon insulin treatment, which activates the insulin signaling pathway [6]. Therefore, it is very likely the CST antibody CST3024 can also target the phosphorylated Drosophila protein. Indeed, using the same protocol for S2R+ cell handling, we tested antibody CST3024, and the result showed reactivity as well (Figure S1). It is reasonable to suspect that the antibodies identified by CESA will be important reagents for Drosophila research (Table S1).
In addition, we ran CESA for zebrafish (D. rerio), frogs (X. tropicalis), mosquitoes (A. gambiae), and worms (C. elegans) and identified between 584 and 75 genes that can be potentially be targeted by the current CST collection (Table 2 and Table 3). We observed that a larger portion of phospho-antibodies work across species between genetically closer species, such as 57% of human phosphosites conserved with zebrafish, compared to only 17% of human phosphosites conserved with Drosophila (Table 2 and Table 3). Nevertheless, CESA systematically identifies the potential reagents from the existing collection, which is significantly more than the reagents currently available commercially. Altogether, our analysis should advance research in relevant communities, particularly for species with very limited antibody resources.

3. Methods

3.1. Tool Development

The tool was developed in Python, and DIOPT (Drosophila RNAi Screening Center Integrative Ortholog Prediction Tool) release 9 was used to map human, mouse, and rat genes to Drosophila genes using a filter to select only orthologous relationships with high and moderate ranks [7]. The tool communicates to the database using the SQLAlchemy package. The pandas package was used to process the query results. Protein global alignment was conducted using the pairwise2 package. The results were then filtered by selecting the longest isoform of each Drosophila ortholog gene (Table S1). We also implemented a standalone version of the program that enables local analysis without the need to connect to any database. This program allows the user to compute the result based on the choice of the model organism as well as the choice of window size of the phosphosite specified by the user. This program is publicly available and can be run using a customized catalog file.

3.2. Information Retrieval

The March 2024 release of the CST catalog file (Phosphorylation_site_dataset.gz) was obtained from https://www.phosphosite.org/staticDownloads.action; accessed on 22 April 2024). Ortholog mapping information along with NCBI Entrez Gene and RefSeq protein sequences were obtained from DIOPT release 9; accessed on 20 June 2024). Uniprot2geneid mapping was obtained from the UniProt knowledgebase (https://ftp.uniprot.org/pub/databases/uniprot/knowledgebase/idmapping/by_organism/; accessed on 22 April 2024). Human, mouse, and rat protein sequences for UniProt records were obtained from UniProtKB (https://www.uniprot.org/uniprotkb; accessed on 22 April 2024).

3.3. Antibody Testing

5 × 106 S2R+ cells per well were plated into a 6-well plate in Schneider’s media supplemented with 10% FBS (fetal bovine serum) overnight. Media was aspirated and replaced with Schneider’s media containing 5 µg/mL insulin for 10 min. Cell pellets were lysed using a lysis buffer containing protease and phosphatase inhibitors on ice for 10 min. Protein concentrations were measured by a BCA protein assay (Thermo Fisher Scientific, Waltham, MA, USA). 2-mercaptoethanol (final, 5%) and 4× Laemmli Sample Buffer were added to protein solutions, and the mixtures were boiled for 10 min. The protein sample was loaded into each lane, and the separation of proteins was performed in a 4–20% gradient Mini-PROTEAN TGX Stain-Free Precast Gel (Bio-Rad, Hercules, CA, USA) using Novex™ Tris-Glycine SDS Running Buffer (Thermo Fisher Scientific). Proteins were transferred from the gel to Immobilon® -FL PVDF Membrane (Millipore) with Pierce™ 10X Western Blot Transfer Buffer (Thermo Fisher Scientific) using a Trans-Blot® Turbo™ Transfer System (Bio-Rad) at 0.4 A, 25 V for 16 min. The membrane was blocked with 5% BSA in TBST for 1 h at room temperature. The membrane was subsequently incubated overnight at 4 °C with Phospho-IGF-I Receptor β (Tyr1135/1136)/Insulin Receptor β (Tyr1150/1151) (19H7) Rabbit mAb #3024 (Cell Signaling Technologies, Danvers, MA, USA) diluted 1:1000 in 5% BSA in TBST. The membrane was washed three times for 3 min with TBST before incubation with Goat anti-Rabbit IgG (H+L) Highly Cross Adsorbed Secondary Antibody, Alexa Fluor™ Plus 800 (Thermo Fisher Scientific) at a 1:2000 dilution and anti-Actin-Rhodamine at a dilution of 1:2500. The western blot was visualized using ChemiDoc MP Imaging System (Bio-Rad).

3.4. Code Availability

The standalone version of the CESA program is available on GitHub (https://github.com/chenxi-gao/antibody_discovery; accessed on 19 August 2024).

4. Discussion

Antibodies targeting the phosphorylated peptide of endogenous protein are crucial to studying the signaling pathways for processes like cell division and migration, but developing such reagents is both labor- and time-consuming—such resources are quite limited for the majority of model organisms. While current commercial collections were originally designed for mammalian proteins, they may also be useful for detecting phosphorylated proteins in other organisms. To explore this potential, we developed the CESA tool to help researchers identify such reagents. Although we mainly used Drosophila as an example in this study, the CESA approach can be applied to any other model and non-model organisms. It is worth noting that since CESA considers all isoforms in the second species, it can predict multiple bands on western blots if conserved sites are identified in more than one protein isoform of different lengths. It is also possible to configure CESA to predict cross-gene activity based on paralog relationships. In addition, CESA can be adapted for other applications, such as analyzing the epitope sequences of regular (non-phospho-specific) antibodies. In summary, we systematically evaluated current CST phospho-antibody to predict the cross-species activity in Drosophila and a few other organisms and identified a significant number of new potential useful reagents for species with very limited antibody resources. The result will likely advance research in relevant communities.

Supplementary Materials

The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/ijms26020558/s1.

Author Contributions

Conceptualization, N.P. and M.A.; methodology, Y.H.; software, C.G.; validation, W.M. and B.X.; formal analysis, Y.H.; resources, M.A.; writing—original draft preparation, Y.H.; writing—review and editing, S.E.M.; visualization, Y.H.; supervision, N.P.; funding acquisition, N.P. All authors have read and agreed to the published version of the manuscript.

Funding

This work was supported in part by a grant from the U.S. National Institutes of Health (NIH) National Institute of General Medical Sciences (P41 GM132087) that established our group as the Drosophila Research and Screening Center-Biomedical Technology Research Resource (DRSC-BTRR), as well as by grants from the NIH Office for Research Infrastructure Projects (R24 OD026435, R24 OD030002, R24 OD019847, R24 OD031952) to support resource development. In addition, N.P. is an investigator at Howard Hughes Medical Institute.

Data Availability Statement

The standalone version of the CESA program is available on GitHub (https://github.com/chenxi-gao/antibody_discovery) (19 August 2024).

Acknowledgments

We appreciate members of the Perrimon lab for their valuable feedback. We extend our gratitude to the Harvard Medical School Research Computing and IT-Client Services teams for their consultation, web hosting, and support. The CST antibodies were generously provided by Roberto Polakiewicz and Sean Beausoleil. This article is governed by HHMI’s Open Access to Publications policy. HHMI lab heads have previously granted a nonexclusive CC BY 4.0 license to the public and a sublicensable license to HHMI for their research articles. Accordingly, the author-accepted manuscript of this article will be made freely available under a CC BY 4.0 license immediately upon publication.

Conflicts of Interest

The authors declare no conflicts of interest.

References

  1. Milburn, M.V.; Tong, L.; Devos, A.M.; Brünger, A.; Yamaizumi, Z.; Nishimura, S.; Kim, S.-H. Molecular switch for signal transduction: Structural differences between active and inactive forms of protooncogenic ras proteins. Science 1990, 247, 939–945. [Google Scholar] [CrossRef] [PubMed]
  2. Ghusinga, K.R.; Jones, R.D.; Jones, A.M.; Elston, T.C. Molecular switch architecture determines response properties of signaling pathways. Proc. Natl. Acad. Sci. USA 2021, 118, e2013401118. [Google Scholar] [CrossRef] [PubMed]
  3. Bjorling, E.; Uhlen, M. Antibodypedia, a portal for sharing antibody and antigen validation data. Mol. Cell. Proteom. 2008, 7, 2028–2037. [Google Scholar] [CrossRef] [PubMed]
  4. Hornbeck, P.V.; Chabra, I.; Kornhauser, J.M.; Skrzypek, E.; Zhang, B. PhosphoSite: A bioinformatics resource dedicated to physiological protein phosphorylation. Proteomics 2004, 4, 1551–1561. [Google Scholar] [CrossRef]
  5. Hornbeck, P.V.; Kornhauser, J.M.; Latham, V.; Murray, B.; Nandhikonda, V.; Nord, A.; Skrzypek, E.; Wheeler, T.; Zhang, B.; Gnad, F. 15 years of PhosphoSitePlus(R): Integrating post-translationally modified sites, disease variants and isoforms. Nucleic Acids Res. 2019, 47, D433–D441. [Google Scholar] [CrossRef] [PubMed]
  6. Xia, B.; Viswanatha, R.; Hu, Y.; Mohr, S.E.; Perrimon, N. Pooled genome-wide CRISPR activation screening for rapamycin resistance genes in Drosophila cells. Elife 2023, 12, e85542. [Google Scholar] [CrossRef]
  7. Hu, Y.; Flockhart, I.; Vinayagam, A.; Bergwitz, C.; Berger, B.; Perrimon, N.; Mohr, E.S. An integrative approach to ortholog prediction for disease-focused and other functional studies. BMC Bioinform. 2011, 12, 357. [Google Scholar] [CrossRef]
  8. Hu, Y.; Comjean, A.; Attrill, H.; Antonazzo, G.; Thurmond, J.; Chen, W.; Li, F.; Chao, T.; Mohr, E.S.; Brown, N.H.; et al. PANGEA: A new gene set enrichment tool for Drosophila and common research organisms. Nucleic Acids Res. 2023, 51, W419–W426. [Google Scholar] [CrossRef] [PubMed]
  9. Hu, Y.; Sopko, R.; Chung, V.; Foos, M.; Studer, A.R.; Landry, S.D.; Liu, D.; Rabinow, L.; Gnad, F.; Beltrao, P.; et al. iProteinDB: An Integrative Database of Drosophila Post-translational Modifications. G3 2019, 9, 1–11. [Google Scholar] [CrossRef] [PubMed]
Figure 1. Design of the Cross-species Epitope Sequence Analysis (CESA) software tool. (A) Overall workflow. Protein A, original target. Protein B, putative orthologous target identified in another species. An abbreviated presentation of steps needed to ready ‘protein A’ for analysis is shown within the dotted line box. Dark blue represents input and output lists, while light blue represents major steps. (B) A detailed presentation of the processing steps needed to ready ‘protein A’ for analysis.
Figure 1. Design of the Cross-species Epitope Sequence Analysis (CESA) software tool. (A) Overall workflow. Protein A, original target. Protein B, putative orthologous target identified in another species. An abbreviated presentation of steps needed to ready ‘protein A’ for analysis is shown within the dotted line box. Dark blue represents input and output lists, while light blue represents major steps. (B) A detailed presentation of the processing steps needed to ready ‘protein A’ for analysis.
Ijms 26 00558 g001
Figure 2. The gene set enrichment analysis (GSEA) of the Drosophila genes that can be potentially targeted by CST phospho-antibodies indicates the over-representation of core components of major signaling pathways. GSEA was conducted using PANGEA. The gene sets annotated by GLAD and PathOn (signaling pathway core components) were selected. The enrichment result was filtered using a p-value of 0.05 as a cutoff. On the bar graphs from PANGEA, the height reflects fold enrichment while the darkness reflects the negative log10 p-value of enrichment.
Figure 2. The gene set enrichment analysis (GSEA) of the Drosophila genes that can be potentially targeted by CST phospho-antibodies indicates the over-representation of core components of major signaling pathways. GSEA was conducted using PANGEA. The gene sets annotated by GLAD and PathOn (signaling pathway core components) were selected. The enrichment result was filtered using a p-value of 0.05 as a cutoff. On the bar graphs from PANGEA, the height reflects fold enrichment while the darkness reflects the negative log10 p-value of enrichment.
Ijms 26 00558 g002
Table 1. Commercial antibodies against mammalian proteins with validated reactivity in Drosophila.
Table 1. Commercial antibodies against mammalian proteins with validated reactivity in Drosophila.
Human GeneFly GeneHuman Site +/−7 AAFly Site +/−7 AAConserved Region (Continues AA)
AKT1Akt1RPHFPQFSYSASGTAEPLFPQFSYQGDMAS6
PRKAA1AMPKalphaSDGEFLRTSCGSPNYLDGEFLRTSCGSPNY14
MAPK10bskAGTSFMMTPYVVTRYAGTTFMMTPYVVTRY11
MAPK10bskTSFMMTPYVVTRYYRTTFMMTPYVVTRYYR13
EIF2S1eIF2alphaMILLSELSRRRIRSIMILLSELSRRRIRSI15
MAPK12p38aRQADSEMTGYVVTRWRPTENEMTGYVATRW6
MAPK12p38aADSEMTGYVVTRWYRTENEMTGYVATRWYR6
MAPK1rlHDHTGFLTEYVATRWHDHTGFLTEYVATRW15
MAPK1rlHTGFLTEYVATRWYRHTGFLTEYVATRWYR15
RPS6KB1S6kNQVFLGFTYVAPSVLNLIFQGFTYVAPSIL8
EIF4EBP1ThorPPGDYSTTPGGTLFSMPEVYSSTPGGTLYS6
EIF4EBP1ThorGGTLFSTTPGGTRIIGGTLYSTTPGGTKLI7
Note: red font indicates the target site. Yellow shade highlights different amino acids, while blue shade highlights the same amino acids.
Table 2. Summary of phosphosites reported in PhosphoSitePlus, availability of corresponding CST antibodies, and their conservation with Drosophila, zebrafish, frogs, mosquitoes, and C. elegans.
Table 2. Summary of phosphosites reported in PhosphoSitePlus, availability of corresponding CST antibodies, and their conservation with Drosophila, zebrafish, frogs, mosquitoes, and C. elegans.
SpeciesSitesGenesSites with AntibodyGenes with AntibodySites Conserved
in Fly
Sites Conserved
in Frog
Sites Conserved
in Fish
Sites Conserved
in Mosquito
Sites Conserved
in Worm
human240,11817,4671019485187658599181114
mouse105,22313,475774407171514485160107
rat31,721726150827811632831111172
other18936765633NANANANANA
Table 3. Known or predicted phosphosites in Drosophila, zebrafish, frogs, mosquitoes, and C. elegans that can potentially be targeted using CST antibodies developed to target phosphosites in mammals.
Table 3. Known or predicted phosphosites in Drosophila, zebrafish, frogs, mosquitoes, and C. elegans that can potentially be targeted using CST antibodies developed to target phosphosites in mammals.
Cut-Off of Conserved Region (aa)Fly
D. melanogaster
Frog
X. tropicalis
Zebrafish
D. rerio
Mosquito
A. gambiae
Worm
C. elegans
61154725999776
71114585789173
81054465648770
9974315448368
10924185187767
11883994957367
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Hu, Y.; Gao, C.; McKenna, W.; Xia, B.; Ariss, M.; Mohr, S.E.; Perrimon, N. Cross-Species Epitope Sequence Analysis for Discovery of Existing Antibodies Useful for Phospho-Specific Protein Detection in Model Species. Int. J. Mol. Sci. 2025, 26, 558. https://doi.org/10.3390/ijms26020558

AMA Style

Hu Y, Gao C, McKenna W, Xia B, Ariss M, Mohr SE, Perrimon N. Cross-Species Epitope Sequence Analysis for Discovery of Existing Antibodies Useful for Phospho-Specific Protein Detection in Model Species. International Journal of Molecular Sciences. 2025; 26(2):558. https://doi.org/10.3390/ijms26020558

Chicago/Turabian Style

Hu, Yanhui, Chenxi Gao, William McKenna, Baolong Xia, Majd Ariss, Stephanie E. Mohr, and Norbert Perrimon. 2025. "Cross-Species Epitope Sequence Analysis for Discovery of Existing Antibodies Useful for Phospho-Specific Protein Detection in Model Species" International Journal of Molecular Sciences 26, no. 2: 558. https://doi.org/10.3390/ijms26020558

APA Style

Hu, Y., Gao, C., McKenna, W., Xia, B., Ariss, M., Mohr, S. E., & Perrimon, N. (2025). Cross-Species Epitope Sequence Analysis for Discovery of Existing Antibodies Useful for Phospho-Specific Protein Detection in Model Species. International Journal of Molecular Sciences, 26(2), 558. https://doi.org/10.3390/ijms26020558

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop