Next Article in Journal
Effects of Dietary Ochratoxin A on Growth Performance and Intestinal Apical Junctional Complex of Juvenile Grass Carp (Ctenopharyngodon idella)
Next Article in Special Issue
The Extreme Ends of the Treatment Response Spectrum to Botulinum Toxin in Cervical Dystonia
Previous Article in Journal
Independent and Synergistic Effects of Knocking out Two ABC Transporter Genes on Resistance to Bacillus thuringiensis Toxins Cry1Ac and Cry1Fa in Diamondback Moth
Previous Article in Special Issue
Neurotrophic Properties of C-Terminal Domain of the Heavy Chain of Tetanus Toxin on Motor Neuron Disease
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Detection of Active BoNT/C and D by EndoPep-MS Using MALDI Biotyper Instrument and Comparison with the Mouse Test Bioassay

1
Special Bacteriology Laboratory, SCT2—Istituto Zooprofilattico Sperimentale delle Venezie, Vicolo Mazzini 4, 31020 Fontane di Villorba, Italy
2
National Reference Centre for Botulism, Microbiological Foodborne Hazard Unit., Department of Food Safety, Nutrition and Veterinary Public Health, Istituto Superiore di Sanità, viale Regina Elena 299, 00161 Rome, Italy
3
Centers for Disease Control and Prevention, National Center for Environmental Health, Division of Laboratory Sciences, 4770 Buford Hwy NE, Atlanta, GA 30341, USA
*
Author to whom correspondence should be addressed.
Toxins 2021, 13(1), 10; https://doi.org/10.3390/toxins13010010
Submission received: 30 October 2020 / Revised: 18 December 2020 / Accepted: 21 December 2020 / Published: 24 December 2020
(This article belongs to the Special Issue Clostridium Neurotoxins)

Abstract

:
Botulinum neurotoxins (BoNTs) are among the most poisonous known biological substances, and therefore the availability of reliable, easy-to use tools for BoNT detection are important goals for food safety and human and animal health. The reference method for toxin detection and identification is the mouse bioassay (MBA). An EndoPep-MS method for BoNT differentiation has been developed based on mass spectrometry. We have validated and implemented the EndoPep-MS method on a Bruker MALDI Biotyper for the detection of BoNT/C and D serotypes. The method was extensively validated using experimentally and naturally contaminated samples comparing the results with those obtained with the MBA. Overall, the limit of detection (LoD) for both C and D toxins were less than or equal to two mouse lethal dose 50 (mLD50) per 500 µL for all tested matrices with the exception of feces spiked with BoNT/C which showed signals not-related to specific peptide fragments. Diagnostic sensitivity, specificity and positive predictive value were 100% (95% CI: 87.66–100%), 96.08% (95% CI: 86.54–99.52%), and 93.33% (95% CI: 78.25–98.20%), respectively, and accuracy was 97.47% (95% CI: 91.15–99.69%). In conclusion, the tests carried out showed that the EndoPep-MS method, initially developed using more powerful mass spectrometers, can be applied to the Bruker MALDI Biotyper instrument with excellent results including for detection of the proteolytic activity of BoNT/C, BoNT/D, BoNT/CD, and BoNT/DC toxins.
Key Contribution: EndoPep-MS yields rapid, reliable results that enable the MBA to be avoided and can be easily performed in a clinical microbiology laboratory without personnel specialized in the use of mass spectrometers.

1. Introduction

Botulinum neurotoxins (BoNTs) are proteins produced by Gram-positive, rod-shaped, spore-forming, anaerobic bacteria belonging to Clostridium (Clostrisium botulinum, Clostrisium butyricum, Clostridium baratii, Clostrisium argentinense, and Clostridium sporogenes) [1]. In recent years, BoNT-like encoding genes have also been detected in the genome of non-Clostridium species, such as Weissella oryzae [2], Enterococcus spp. [3], and Chryseobacterium piperi [4]. The specific features of BoNT production by these microbes are unknown, as well as their possible interactions in ecological niches. There are seven distinct serotypes of BoNTs from A (BoNT/A) through G (BoNT/G) based on their antigenic properties, and many serotypes contain subtypes or variants [5,6]. In addition to these seven serotypes, a chimeric BoNT type H, also called FA or HA, and a putative novel type, called X, have been recovered in Clostridium botulinum (C. botulinum) previously classified as type B strain [7,8]. BoNT/A, B, E, and F mainly cause human disease, whereas BoNT/C and D have been shown to affect animals [2,6,9]. The neuroparalytic syndrome resulting from the systemic effects of BoNTs is potentially fatal so it is crucial to detect BoNTs as early as possible in a sample to prevent additional botulism cases and provide, when possible, the target treatment. The test most widely used to confirm the presence of BoNTs and identification them is the mouse bioassay (MBA) [10]. This lethality assay possesses high sensitivity, can measure toxin activity, and can detect toxin serotype by means of specific antitoxins. However, it does pose ethical issues because it requires the sacrifice of many animals, it is time consuming since four days are needed for confirmation of negative samples, and it requires a large volume of sample [11]. Furthermore, other substances in the sample, e.g., other toxins or irritating ingredients such as spices in foods, can occasionally lead to inconclusive results [12,13]. Many efforts have been made in recent years to develop alternative laboratory methods to the mouse lethality test and some are very promising. Most developed tests have proven to be less sensitive than the MBA and/or been unable to give information about toxin activity (e.g., ELISA tests). Recently, an EndoPep-MS method for BoNTs and serotype differentiation based on LC-ESI-MS/MS and MALDI-TOF MS, coupled with antibody purification and enrichment of toxins, was developed and has been successfully applied in various types of samples for detection of BoNT/A, B, C, D, E, F, and G [14,15,16]. The original method was developed using costly, high-resolution mass spectrometers that are rarely present in routine diagnostic laboratories, not only because of their high cost but, also, because they need personnel with high technical skills to use them. In 2017, Perry and coworkers [11] implemented the EndoPep-MS method for the detection of BoNT/A, B, E, and F toxins using the Bruker MALDI Biotyper. This is a lower performance instrument compared with other more costly ones, but is commonly found in microbiology laboratories, in both the human and veterinary fields, being routinely dedicated to bacterial identification. The rapid diffusion of MALDI-TOF MS technology in a growing number of diagnostic laboratories worldwide is due to its versatility, rapidity of analysis, lower of consumable costs, high-throughput, and easy handling [17]. Here we describe the application and validation of the EndoPep-MS method to detect of proteolytic activity of BoNT/C and D and their mosaic forms CD and DC in animal clinical specimens, using the Bruker MALDI Biotyper. We compared the test performance of EndoPep-MS with the MBA test, considered the “gold standard” for botulinum neurotoxin detection.

2. Results

2.1. Limit of Detection (LoD)

In order to determine the LoD of EndoPep-MS, two-fold serial dilutions of BoNT/C and D reference toxins were used to contaminate water, serum, broth culture from feces, and feces diluted to 1:1 in gelatin phosphate buffer (GPB). The contaminated specimens were then analyzed by the EndoPep-MS method and the results are described in Table 1. An example of mass spectra obtained from sera spiked with C and D toxins is reported in Figure 1. For BoNT/C, all the contaminated matrices gave an LoD lower or equal to 2 mLD50/500 µL, except for feces in GPB for which nonspecific peaks were observed, preventing the typical peptide typical peaks from being visualized (Figure 2). For BoNT/D, the LoDs for toxin spiked in water and sera were overall equal to or lower than 1 mLD50 /500 µL, but were equal to 2 mLD50/500 µL or lower for broth culture of feces. Feces showed an LoD of about 2 mLD50/500 µL without interference from fecal inhibitors.

2.2. Specificity

The method was able to detect BoNT activity only in broth culture of clostridia producing type C, C/D, D, and D/C toxins. No cross reactivity was observed with the other enrichment cultures of neurotoxin-producing types A, B, E, and F clostridia (Table 2).

2.3. Comparison of LoD between the EndoPep-MS Method and the MBA

To measure the EndoPep-MS method against the MBA, sera, broth culture, and feces diluted with GPB to 1:1 were spiked with BoNT/C and BoNT/D reference toxins at final concentrations of 4, 2, 1, 0.5, and 0.25 mLD50/500 µL. Spiked and non-spiked samples were tested cat the same time with both methods and the results were compared (Table 3).
The EndoPep-MS method developed to detect BoNT/C in serum was able to identify the target at a 2-fold higher concentration than the MBA (1 mLD50/500 µL vs. 0.5 mLD50/500 µL). Conversely, the LoD of our EndoPep-MS method applied to broth cultures was lower than the MBA. This latter result guests that the MBA was slightly less sensitive than EndoPep-MS (2 mLD50/500 µL vs 4mLD50/500 µL). In the feces spiked with BoNT/C, the presence of nonspecific peaks prevented comparison between the two tests as observed in sensitivity tests. The LoD of the MBA was in this case 4 mLD50/500 µL. The LoD of BoNT/D in serum and feces were 2-fold lower for EndoPep-MS than for the MBA (1 mLD50 /500 µL vs. 2 mLD50/500 µL for serum and 2 mLD50/500 µL vs. 4 mLD50/500 µL for feces, respectively) whereas a higher LoD was observed for EndoPep-MS than for the MBA (2 mLD50 /500 µL vs. 4 mLD50/500 µL) in the case of broth culture.

2.4. Diagnostic Sensitivity and Specificity

Diagnostic sensitivity and specificity were evaluated by testing naturally contaminated samples collected during routine laboratory activities by Istituto Zooprofilattico Sperimentale delle Venezie and the National Reference Centre for Botulism (CNRB) of the Italian Istituto Superiore di Sanità. The “gold standard” used for diagnosis was the MBA and the results for the enrichment cultures were confirmed by multiplex real-time PCR. In total, 79 samples were analyzed and the results are reported in Table 4. The two sera samples 2659/4/10 and 6841/3/13 obtained from subjects of two confirmed animal botulism outbreaks, tested negative with the MBA but proved to be weakly positive with EndoPep-MS in both replicates.
The sensitivity of EndoPep-MS was 100% (95% CI: 87.66–100%) and the specificity 96.08% (95% CI: 86.54–99.52%), with a positive predictive value of 93.33% (95% CI: 78.25–98.20%), a negative predictive value of 100%, and accuracy of 97.47% (95% CI: 91.15–99.69%).

3. Discussion

Mass spectrometry has become an important analytical tool for many applications in microbiology, especially for rapid, precise identification of pathogens in clinical microbiology laboratories. Numerous studies have demonstrated that MALDI-TOF MS surpasses conventional diagnostic methods in terms of cost, speed, and accuracy in the identification of microbial species [19]. These characteristics have led to the rapid spread of lower-performance mass spectrometers than the ones used in chemistry laboratories, which show great potential for use in other activities, as, strain typing, antimicrobial susceptibility testing and bacterial toxin detection, including BoNTs [20].
The current “gold standard” for BoNTs detection is the MBA but the use of laboratory animals poses a non-negligible ethical issues and should be avoided when alternative methods are available. Researchers from CDC developed an EndoPep-MS method for the identification and evaluation of BoNT activity which has proven able to replace the MBA in the diagnosis of botulism since its sensitivity is of the same order of magnitude or even better than the MBA for most known toxin serotypes [15,16,21]. EndoPep-MS was initially developed in costly instruments but Perry and coworkers [11] demonstrated that, for the detection of BoNT/A, B, E, and F in clinical samples, it can be is successfully applied to the Bruker MALDI Biotyper, an instrument that has become quite common in microbiology laboratories for bacteria identification. The majority of veterinary botulism cases are caused by C. botulinum Group III strains which can produce the closely related toxins BoNT/C and D or their mosaic variants BoNT/CD and BoNT/DC [9,22]. BoNT/CD is composed of a C light chain and a D heavy chain whereas BoNT/DC has a D light chain and a C heavy chain. Therefore, the CD toxin exhibits the typical enzymatic activity of BoNT/C and the DC toxin acts as a BoNT/D [23,24]. To our knowledge, no protocols have previously been developed for the detection of BoNTs of animal interest using the Bruker MALDI Biotyper. We validated and implemented the EndoPep-MS method for diagnosing animal botulism using the Bruker MALDI Biotyper by evaluating analytical and diagnostic sensitivity and specificity using clinical samples and artificially contaminated samples. We also compared the performance of EndoPep-MS based on our protocol with the MBA. The validation process, carried out with BoNT/C and D positive samples and their mosaic variants BoNT/CD and BoNT/DC, demonstrated that the method is able to detect all serotypes with high sensitivity and can replace the MBA in diagnostic practice. Our EndoPep-MS method cannot distinguish between pure sub-types C and D and their mosaic forms. However, although these data are important for clarifying the epidemiology of animal botulism and could have relevance for vaccine strategies, they are irrelevant for diagnostic purposes and are comparable to what is obtained with the MBA. In addition, the BoNT subtypes can be distinguished by coupling PCR with BoNT detection in isolated strains or in enrichment cultures. Moreover, the EndoPep-MS showed no cross-reactivity when applied to broth cultures of closely related Clostridia spp. strains and neurotoxins-producing clostridia type A, B, E, and F, indicating a high degree of analytical specificity.
In terms of analytical sensitivity, EndoPep-MS was able to detect BoNT/C and D in aqueous solution with an LoD of less than or equal to 1 mLD50/500 µL for BoNT/D and between 1 and 2 mLD50/500 µL for BoNT/C. Tests conducted with sera, broth cultures of feces and feces diluted to 1:1 with GPB spiked with two-fold dilutions of reference toxins, showed limited or no interference of the matrix in LoD, with the exception of feces spiked with BoNT/C. In the latter case, the presence of nonspecific signals at all tested dilutions prevented detection of specific peaks related to the cleaved substrates. Superimposable results were also obtained when a different peptide, the Pep 39 [21], was used (data not shown). However, this interference in cleaved peptide detection was not observed in the only fecal sample tested, collected from a swan which died from botulism (sample 5641/12, Table 4). It is well known that in complex matrices, such as feces, the high amount of endogenous proteases may digest peptide substrates before reacting with BoNT, leading to false results. It is commonly reported that the sensitivity of EndoPep-MS is lower in stool extracts than in other clinical samples [15]. Nevertheless, EndoPep-MS proved to be appropriate to detect BoNT/A, B, E, and F in clinical samples since their concentration in stools can reach very high levels [15,25]. The amount of BoNT/C in the swan fecal sample was not quantified but the clear positivity found in the specimen suggests that the BoNT concentration was high enough to overcome the effect of endogenous proteases. One further explanation for the difference between the MBA and the EndoPep-MS results for the artificially contaminated samples and fecal sample analyzed could be that the composition of the feces, and therefore the added presence of other types of inhibitors or proteases, varies among animal species and within the same species as well as with type of nutrition and digestive physiology. In our case, the experimental tests were performed using dog feces while the fecal sample was obtained from a swan. Dog feces contain very high levels of proteases, and therefore we decided to test the protocol using a very challenging matrix.
Assaying specimens collected in suspected outbreaks of human and animal botulism by EndoPep-MS showed that the method possesses a sensitivity of 100% and a specificity of 96.08%. This low specificity seems to be due to two false positive results. However, one sample was a serum collected from a bovine that tested positive for C. botulinum type C by MBA and qPCR in rumen. The other was a serum sample obtained from a meat chicken from a flock in which other animal sera had tested positive for BoNT/C on MBA. In both cases, the EndoPep-MS was yielded weak positivity in all replicates suggesting that the method could also be more sensitive than the MBA.

4. Conclusions

The tests carried out showed that the EndoPep-MS method, initially developed for use with more powerful mass spectrometers, can be applied to the Bruker MALDI Biotyper instrument, showing excellent results in the detection of biological activity of C and D toxins and their mosaic forms. We have demonstrated that our EndoPep-MS protocol provides rapid results which are comparable with the MBA, considered the “gold standard” for BoNT detection. For this reason, EndoPep-MS is a valid alternative to the MBA and can be easily performed in a clinical microbiology laboratory without advanced skills in mass spectrometry.

5. Materials and Methods

5.1. Materials and Reagents

BoNT/C and BoNT/D toxin complex were obtained using 1 mg/mL stocks from Metabiologics Inc. (Madison, Wisconsin) at the specific toxicity of 6.5 × 106 for BoNT/C and 3 × 107 mLD50/mg for BoNT/D. Pep-C and Pep-D/F were synthesized and purchased from GenScript Biotech (Piscataway, NJ, USA). Peptide sequences are reported in Table 5. Antibodies 8DC1.2 (serotypes C, CD, and DC) and 4C2 (serotypes C and DC) were kindly provided by Dr James D. Marks (University of California, San Francisco, CA, USA). ZebaTM Spin Desalting Columns and sulfo-NHS-biotin were purchased from Thermo Fisher Scientific (Rockford, IL, USA). All reagent for the MALDI Biotyper analysis were acquired from Bruker Daltonics (Bremen, Germany). Magnetic Dynabeads M-280 streptavidin were obtained from Invitrogen-Life technologies (Life Technologies AS, Oslo, Norway). Reagents for preparing the reaction buffer (RB) and HBS-EP Buffer were purchased from Sigma-Aldrich (St. Louis, MO, USA).

5.2. Coupling of Antibodies with Magnetic Beads

A buffer exchange from Tris Glicina Buffer to PBS was performed on the antibody using ZebaTM Spin Desalting Columns in accordance with the manufacturer’s instructions. The antibodies were then biotinylated by adding 1.0 μL of 0.533 mM sulfo-NHS-biotin to 8.0 μg of antibody. The reaction was carried out over night at room temperature. Subsequently, 2.3 μL of each biotinylated antibody were incubated with 1 mg of Dynabeads® M-280 Streptavidin suspended in 400 µL of HBS-EP buffer and incubated while shaking for one hour at room temperature. Lastly, conjugated magnetic beads were washed twice with 500 μL HBS-EP Buffer (0.01 M HEPES pH 7.4, 0.15 M NaCl, 3 mM EDTA, 0.005% v/v Surfactant P20) and resuspended in HBS-EP Buffer at the same volume in which they had been initially suspended.

5.3. Enrichment Culture for Detection of Neurotoxin-Producing CLOSTRIDIA

Enrichment cultures were performed as described in the procedure CNRB 30.010 (2017) issued by the National Reference Center for Botulism [26]. Briefly, 1 g or 1 mL of sample or 1 mL of spores (specificity assay), were introduced into 10 mL of pre-reduced Fortified Cooked Meat Medium (FCMM) that was subsequently heated to 70 °C for 10 min and incubated at 30 °C for 4 days in anaerobic conditions.

5.4. Sample Preparation for EndoPep-MS Detection

Two grams of stool were mixed at ratio of 1:1 (stool:buffer) with GPB and vigorously vortexed for 5 min. The sample was then centrifuged at 8000× g at 4 °C for 20 min and the supernatant collected for further analysis. Liquid samples (sera, milk, broth culture) were centrifuged and the supernatants collected and processed as described below for the toxin detection.

5.5. Sample Preparation to Determine the LoD of the EndoPep-MS Method

The samples used for the contamination assay with reference toxins were water, sera, broth culture of dog feces, and dog feces at a dilution of 1:1 in GPB that had previously been analyzed for suspected botulism, and had tested negative by the multiplex real-time PCR [18] and MBA [26]. All specimens were centrifuged at 8000× g at 4 °C for 20 min and the supernatants collected and contaminated with 2 µL/500 µL of serial 2-fold dilutions of BoNT/C and BoNT/D reference toxins from 1024 mLD50/µL to 0.0625 mLD50/µL. Biosafety level-2 practices, processes, and facilities were used to ensure safety while working with BoNTs. Additionally, toxin stock material and all samples containing BoNTs were processed in a Class II biosafety cabinet containing HEPA filters to minimize the potential for aerosol exposure.

5.6. Toxin Concentration and Endo-Peptidase Activity Assay

BoNTs were extracted from 500 μL of sample supernatants, using 20 μL of beads coated with specific antibodies. To prevent beads aggregation during the procedure, 50 μL of PBST 10× (0.1 M PBS, 0.5% Tween®20) were added to each sample. Toxin binding was carried out while shaking for 1 h at room temperature in a SB2fixed speed rotator (Stuart TM).
Beads were then captured using a magnetic holder and washed twice with 1 mL of PBST, once with 150 μL of PBST, and lastly with 80 μL of ultra-pure water. The water was then completely removed, the beads were suspended in 18 μL of RB buffer (0.1 M DTT, 0.2 mM ZnCl2, 1.0 mg/mL BSA, 10 mM HEPES buffer pH 7.3) and incubated with 2 µL of a specific peptide solution at a concentration of 15 mM (Table 5). The reaction buffer and bead mixture were then incubated for 6 h at 42 °C for BoNT/D and overnight at 37 °C for BoNT/C. One microliter of each sample was used for MALDI-TOF analysis.

5.7. MALDI-TOF MS Detection

One microliter of each extract was spotted on a MALDI-Biotyper steel target plate, allowed to dry and, subsequently, overlaid with 1 µL of alpha-cyano-4-hydroxycinnamic acid (HCCA) matrix (5 mg/mL HCCA in 50% acetonitrile, 2.5% TFA, 47.5% water) and left to dry completely again. Mass spectra of each spot were obtained using the MALDI- Biotyper Microflex LT instrument (MALDI Biotyper, Bruker Daltonics Inc., Billerica, MA, USA) and the software FlexControl version 3.3 by scanning from 720 to 5000 m/z in MS-positive ion linear mode. The laser frequency was set to 30 Hz and the final spectrum was an average of 1000 laser shots (10 groups of 100 shots collected in a spiral pattern).

5.8. Limit of Detection (LoD) of the EndoPep-MS Method

Samples contaminated with reference toxins BoNT/C and BoNT/D at final concentrations ranging from 2048 to 0.125 mLD50/500 µL were analyzed in triplicate by the EndoPep-MS method (technical replicates) as previously described. The experiment was repeated three times for each matrix (biological replicates). The LoD for each independent experiment was defined as the lowest level of toxin that could be detected in the three technical replicates. Detection of the toxins consisted of the presence of mass spectrometric peaks with S/N greater than 3 times the S/N of the negative control (unspiked sample of the same matrix).

5.9. Specificity of the EndoPep-MS Method

The analytical specificity of the EndoPep-MS method was evaluated by spiking broth cultures of fecal samples that had tested negative for BoNTs by both the MBA and EndoPep-MS, with reference strains of Clostridium spp. related to C. botulinum or commonly found in animal feces and known to cause disease. Clostridia strains producing BoNT/A, B, E, and F were also included (Table 2). After 48 h of incubation in anaerobic conditions at 30 ± 1 °C the supernatant of all cultures were analyzed by EndoPep-MS, multiplex real-time PCR [18], and MBA [26]. To limit the number of mice used for research purposes, only three mice with untreated and heat-treated culture supernatant were inoculated. No samples treated with antitoxins specific for each BoNT were tested.

5.10. Comparison of the LoD of EndoPep-MS and MBA

Broth cultures of feces, sera, and feces previously testing negative for C. botulinum neurotoxins were spiked with 8, 4, 2, 1, and 0.5 mLD50/500 µL of BoNT/C and BoNT/D, respectively. Samples were then diluted in GPB at ratio of 1:1, reaching a final concentration of 4, 2, 1, 0.5, and 0.25 mLD50/500 µL, respectively. Samples were subsequently centrifuged at 8000× g at 4 °C for 20 min, the supernatants were collected, split into two portions, and analyzed by both EndoPep-MS in triplicate and by the MBA, following the CNRB 30.011 rev.1 method with some modifications [26]. Briefly, 500 µL of each supernatant were injected intraperitoneally into two Mus musculus CD-1 mice of 20–30 g which had been observed for at least four days. Death, with the development of signs of botulism intoxication, was recorded. Data were compared with the EndoPep-MS results. To reduce the number of mice required for the comparison study neither neutralized extract nor negative controls were injected, and the experiment was performed one time only for each matrix.

5.11. Evaluation of Diagnostic Sensitivity and Specificity of EndoPep-MS

Seventy-nine samples collected during routine diagnostic laboratory analysis (Table 4) and belonging to suspected cases of botulism were analyzed by the EndoPep-MS method following the aforementioned protocols. Food extracts with GPB, broth culture, sera, milk, and feces were included among the 79 samples. Each sample was analyzed twice and reported to be positive when both replicates were positive on EndoPep-MS. Sensitivity, specificity, positive predictive value, negative predictive value, and accuracy of the EndoPep-MS method were calculated using MedCalc Statistical Software version 19.2.6 (MedCalc Software Ltd., Ostend, Belgium; https://www.medcalc.org; 2020) by means of the Diagnostic test option (2 × 2 table).

5.12. Multiplex Real-Time PCR to Detect BoNT/C and D and Their Mosaic Forms.

Evaluation of the BoNT serotypes was carried out by the multiplex real-time PCR method issued by the National Reference Center for Botulism, CNRB31.010 (2017) [18].

5.13. Ethic Approval

The MBA for the development of the EndoPep-MS method was authorized by the Italian Ministry of Health (authorization No. 239/2015-PR) on 9 April 2015. The laboratory is also officially authorized by the Italian Ministry of Health to use animals for diagnostic purposes (authorization No. n. 243/2020).

Author Contributions

I.D., S.P., and L.B. conceived and designed the experiments, S.P. and E.T. performed the experiments, F.A. contributed to validation process, S.R.K. provided EndoPep-MS training and technical knowledge and guidance; I.D. and L.B. performed the mouse bioassay experiments; I.D. and E.T. analyzed the data; I.D., L.B., F.A., E.T. and S.R.K. wrote—reviewed and edited the manuscript. All authors have read and agreed to the published version of the manuscript.

Funding

This research was funded by the Italian Ministry of Health in the framework of the research project IZSVE RC 05/2012.

Institutional Review Board Statement

The study was conducted according to the guidelines of the Declaration of Helsinki, and approved by the Ethics Committee of the Istituto Zooprofilattico Sperimentale delle Venezie with opinion number CE.IZSVE 01/2015 on 9 February 2015.

Informed Consent Statement

Not applicable.

Data Availability Statement

The raw data generated and analysed during the current study are available from the corresponding author I.D. on reasonable request.

Acknowledgments

We acknowledge e James D. Marks and Jianlong Lou from University of California for providing us the antibodies for EndoPep-MS and Joanne Mary Fleming for the accurate English revision of the manuscript. The findings and conclusions in this report are those of the authors and do not necessarily represent the official position of the Centers for Disease Control and Prevention. Use of trade names and commercial sources is for identification only and does not constitute endorsement by the U.S. Department of Health and Human Services, or the U.S. Centers for Disease Control and Prevention.

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Weigand, M.R.; Pena-Gonzalez, A.; Shirey, T.B.; Broeker, R.G.; Ishaq, M.K.; Konstantinidis, K.T.; Raphael, B.H. Implications of Genome-Based Discrimination between Clostridium Botulinum Group I and Clostridium Sporogenes Strains for Bacterial Taxonomy. Appl. Environ. Microbiol. 2015, 81, 5420–5429. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  2. Mansfield, M.J.; Adams, J.B.; Doxey, A.C. Botulinum Neurotoxin Homologs in Non-Clostridium Species. FEBS Lett. 2015, 589, 342–348. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  3. Zhang, S.; Lebreton, F.; Mansfield, M.J.; Miyashita, S.I.; Zhang, J.; Schwartzman, J.A.; Tao, L.; Masuyer, G.; Martínez-Carranza, M.; Stenmark, P.; et al. Identification of a Botulinum Neurotoxin-Like Toxin in a Commensal Strain of Enterococcus Faecium. Cell Host Microbe 2018, 23, 169–176.e6. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  4. Wentz, T.G.; Muruvanda, T.; Lomonaco, S.; Thirunavukkarasu, N.; Hoffmann, M.; Allard, M.W.; Hodge, D.R.; Pillai, S.P.; Hammack, T.S.; Brown, E.W.; et al. Closed Genome Sequence of Chryseobacterium Piperi Strain CTM(T)/ATCC BAA-1782, a Gram-Negative Bacterium with Clostridial Neurotoxin-Like Coding Sequences. Genome Announc. 2017, 5, e01296-17. [Google Scholar] [CrossRef] [Green Version]
  5. Pirazzini, M.; Rossetto, O.; Eleopra, R.; Montecucco, C. Botulinum Neurotoxins: Biology, Pharmacology, and Toxicology. Pharmacol. Rev. 2017, 69, 200–235. [Google Scholar] [CrossRef]
  6. Peck, M.W.; Smith, T.J.; Anniballi, F.; Austin, J.W.; Bano, L.; Bradshaw, M.; Cuervo, P.; Cheng, L.W.; Derman, Y.; Dorner, B.G.; et al. Historical Perspectives and Guidelines for Botulinum Neurotoxin Subtype Nomenclature. Toxins 2017, 9, 38. [Google Scholar] [CrossRef]
  7. Poulain, B.; Popoff, M.R. Why are Botulinum Neurotoxin-Producing Bacteria so Diverse and Botulinum Neurotoxins so Toxic? Toxins 2019, 11, 34. [Google Scholar] [CrossRef] [Green Version]
  8. Zhang, S.; Masuyer, G.; Zhang, J.; Shen, Y.; Lundin, D.; Henriksson, L.; Miyashita, S.I.; Martínez-Carranza, M.; Dong, M.; Stenmark, P. Identification and Characterization of a Novel Botulinum Neurotoxin. Nat. Commun. 2017, 8, 14130. [Google Scholar] [CrossRef]
  9. Bano, L.; Drigo, I.; Tonon, E.; Pascoletti, S.; Puiatti, C.; Anniballi, F.; Auricchio, B.; Lista, F.; Montecucco, C.; Agnoletti, F. Identification and Characterization of Clostridium Botulinum Group III Field Strains by Matrix-Assisted Laser Desorption-Ionization Time-of-Flight Mass Spectrometry (MALDI-TOF MS). Anaerobe 2017, 48, 126–134. [Google Scholar] [CrossRef]
  10. Lindstrom, M.; Korkeala, H. Laboratory Diagnostics of Botulism. Clin. Microbiol. Rev. 2006, 19, 298–314. [Google Scholar] [CrossRef] [Green Version]
  11. Perry, M.J.; Centurioni, D.A.; Davis, S.W.; Hannett, G.E.; Musser, K.A.; Egan, C.T. Implementing the Bruker MALDI Biotyper in the Public Health Laboratory for C. Botulinum Neurotoxin Detection. Toxins 2017, 9, 94. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  12. Bano, L.; Tonon, E.; Drigo, I.; Pirazzini, M.; Guolo, A.; Farina, G.; Agnoletti, F.; Montecucco, C. Detection of Clostridium Tetani Neurotoxins Inhibited in Vivo by Botulinum Antitoxin B: Potential for Misleading Mouse Test Results in Food Controls. Toxins 2018, 10, 248. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  13. Dezfulian, M.; Bartlett, J.G. Detection of Clostridium Botulinum Type B Toxin in the Presence of a Lethal Substance Interfering with Toxin Neutralization. Diagn. Microbiol. Infect. Dis. 1985, 3, 105–112. [Google Scholar] [CrossRef]
  14. Kalb, S.R.; Krilich, J.C.; Dykes, J.K.; Luquez, C.; Maslanka, S.E.; Barr, J.R. Detection of Botulinum Toxins A, B, E, and F in Foods by Endopep-MS. J. Agric. Food Chem. 2015, 63, 1133–1141. [Google Scholar] [CrossRef] [PubMed]
  15. Kalb, S.R.; Moura, H.; Boyer, A.E.; McWilliams, L.G.; Pirkle, J.L.; Barr, J.R. The use of Endopep-MS for the Detection of Botulinum Toxins A, B, E, and F in Serum and Stool Samples. Anal. Biochem. 2006, 351, 84–92. [Google Scholar] [CrossRef] [PubMed]
  16. Wang, D.; Baudys, J.; Hoyt, K.; Barr, J.R.; Kalb, S.R. Sensitive Detection of Type G Botulinum Neurotoxin through Endopep-MS Peptide Substrate Optimization. Anal. Bioanal Chem. 2019, 411, 5489–5497. [Google Scholar] [CrossRef] [Green Version]
  17. Boyer, A.E.; Gallegos-Candela, M.; Lins, R.C.; Kuklenyik, Z.; Woolfitt, A.; Moura, H.; Kalb, S.; Quinn, C.P.; Barr, J.R. Quantitative Mass Spectrometry for Bacterial Protein toxins—A Sensitive, Specific, High-Throughput Tool for Detection and Diagnosis. Molecules 2011, 16, 2391–2413. [Google Scholar] [CrossRef] [Green Version]
  18. CNRB. Metodo per la Ricerca di Clostridi Produttori di Tossine Botuliniche Mediante Multiplex Real-Time PCR 2017, 1–29. Available online: https://www.iss.it/documents/20126/0/CNRB31.011.pdf/59a7faf1-15f5-dd54-ae13-d066de9dcea2?t=1582362668086 (accessed on 1 September 2020).
  19. Kostrzewa, M.; Nagy, E.; Schröttner, P.; Pranada, A.B. How MALDI-TOF Mass Spectrometry Can Aid the Diagnosis of Hard-to-Identify Pathogenic Bacteria—The Rare and the Unknown. Expert Rev. Mol. Diagn. 2019, 19, 667–682. [Google Scholar] [CrossRef]
  20. Hou, T.Y.; Chiang-Ni, C.; Teng, S.H. Current Status of MALDI-TOF Mass Spectrometry in Clinical Microbiology. J. Food Drug Anal. 2019, 27, 404–414. [Google Scholar] [CrossRef]
  21. Wang, D.; Krilich, J.; Baudys, J.; Barr, J.R.; Kalb, S.R. Enhanced Detection of Type C. Botulinum Neurotoxin by the Endopep-MS Assay through Optimization of Peptide Substrates. Bioorg. Med. Chem. 2015, 23, 3667–3673. [Google Scholar] [CrossRef] [Green Version]
  22. Hansbauer, E.M.; Skiba, M.; Endermann, T.; Weisemann, J.; Stern, D.; Dorner, M.B.; Finkenwirth, F.; Wolf, J.; Luginbühl, W.; Messelhäußer, U.; et al. Detection, Differentiation, and Identification of Botulinum Neurotoxin Serotypes C, CD, D, and DC by Highly Specific Immunoassays and Mass Spectrometry. Analyst 2016, 141, 5281–5297. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  23. Rasetti-Escargueil, C.; Lemichez, E.; Popoff, M.R. Public Health Risk Associated with Botulism as Foodborne Zoonoses. Toxins 2019, 12, 17. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  24. Moriishi, K.; Koura, M.; Abe, N.; Fujii, N.; Fujinaga, Y.; Inoue, K.; Ogumad, K. Mosaic Structures of Neurotoxins Produced from Clostridium Botulinum Types C and D Organisms. Biochim. Biophys. Acta 1996, 1307, 123–126. [Google Scholar] [CrossRef]
  25. Wang, D.; Baudys, J.; Kalb, S.R.; Barr, J.R. Improved Detection of Botulinum Neurotoxin Type A in Stool by Mass Spectrometry. Anal. Biochem. 2011, 412, 67–73. [Google Scholar] [CrossRef]
  26. CNRB. Metodo Per La Ricerca Di Clostridi Produttori Di Tossine Botuliniche e Per La Ricerca Di Tossine Botuliniche (Metodo Colturale e Mouse Test). 2017, pp. 1–29. Available online: https://www.iss.it/documents/20126/0/CNRB30.011.pdf/59a7faf1-15f5-dd54-ae13-d066de9dcea2?t=1582362668086 (accessed on 1 September 2020).
  27. Hedeland, M.; Moura, H.; Baverud, V.; Woolfitt, A.R.; Bondesson, U.; Barr, J.R. Confirmation of Botulism in Birds and Cattle by the Mouse Bioassay and Endopep-MS. J. Med. Microbiol. 2011, 60, 1299–1305. [Google Scholar] [CrossRef]
Figure 1. (A) Sera spiked only with PepC, at m/z 2912.3 the singly charged ion [M + H]+ and at m/z 1457.1 for the doubly charged one [M + 2H]2+ ; (B) Sera spiked only with PepD/F. Only the doubly charged ion at m/z 2605.4 [M + 2H]2+ is detected within the range of analysis; (C) Spectra from the reaction of sera spiked with BoNT/C at a concentration of 16 mLD50/500 µL and Pep C (15 mM). Intact PepC at m/z 2912.3 [M + H] + with the doubly charged ion [M + 2H]2+at m/z 1457.1 and cleavage products at m/z 1870.9 (NT) and m/z 1059.5 (CT). (D) Spectra from the reaction of sera spiked with BoNT/D at a concentration of 16 mLD50/500 µL and Pep D/F (15 mM). Doubly charged PepD/F [M + 2H]2+ at m/z 2605.4 and cleavage products at m/z 4013.5 (NT) and m/z 1217.3 (CT), respectively.
Figure 1. (A) Sera spiked only with PepC, at m/z 2912.3 the singly charged ion [M + H]+ and at m/z 1457.1 for the doubly charged one [M + 2H]2+ ; (B) Sera spiked only with PepD/F. Only the doubly charged ion at m/z 2605.4 [M + 2H]2+ is detected within the range of analysis; (C) Spectra from the reaction of sera spiked with BoNT/C at a concentration of 16 mLD50/500 µL and Pep C (15 mM). Intact PepC at m/z 2912.3 [M + H] + with the doubly charged ion [M + 2H]2+at m/z 1457.1 and cleavage products at m/z 1870.9 (NT) and m/z 1059.5 (CT). (D) Spectra from the reaction of sera spiked with BoNT/D at a concentration of 16 mLD50/500 µL and Pep D/F (15 mM). Doubly charged PepD/F [M + 2H]2+ at m/z 2605.4 and cleavage products at m/z 4013.5 (NT) and m/z 1217.3 (CT), respectively.
Toxins 13 00010 g001
Figure 2. (A) Feces spiked with PepC. Singly charged ion at m/z 2912.3 [M + H]+ and the doubly charged one at m/z 1457.1 [M + 2H]2+ (B) Spectra from the reaction of feces spiked with BoNT/C at a concentration of 16 mLD50/500 µL and PepC (15 mM). Intact PepC at m/z 2912.3 [M + H]+ with the doubly charged ion [M + 2H]2+at m/z 1457.1, cleavage products are not clearly visible.
Figure 2. (A) Feces spiked with PepC. Singly charged ion at m/z 2912.3 [M + H]+ and the doubly charged one at m/z 1457.1 [M + 2H]2+ (B) Spectra from the reaction of feces spiked with BoNT/C at a concentration of 16 mLD50/500 µL and PepC (15 mM). Intact PepC at m/z 2912.3 [M + H]+ with the doubly charged ion [M + 2H]2+at m/z 1457.1, cleavage products are not clearly visible.
Toxins 13 00010 g002
Table 1. Limit of detection LoD of EndoPep-MS in samples spiked with BoNT/C and BoNT/D reference toxins.
Table 1. Limit of detection LoD of EndoPep-MS in samples spiked with BoNT/C and BoNT/D reference toxins.
BoNTMatrixBiological Replicates
123
LoD
(mLD50/500 µL)
LoD
(mLD50/500 µL)
LoD
(mLD50/500 µL)
CWater122
Sera212
Broth culture221
Feces N/AN/AN/A
DWater10.50.5
Sera0.50.50.25
Broth culture212
Feces 212
N/A: not applicable.
Table 2. EndoPep-MS specificity studies. Results of EndoPep-MS assay, MBA and qPCR applied to broth cultures inoculated with different Clostridium spp. and C. botulinum type A, B, E, F, C, CD, DC, and D strains.
Table 2. EndoPep-MS specificity studies. Results of EndoPep-MS assay, MBA and qPCR applied to broth cultures inoculated with different Clostridium spp. and C. botulinum type A, B, E, F, C, CD, DC, and D strains.
Strains Reference N.EndoPep-MSqPCR *MBA **
Peptide CPeptide D
C. botulinum type AATCC 19397--AExpired
C. botulinum type BCCUG 7969--BExpired
C. butyricum type EDSM 10702--EExpired
C. botulinum type FNCTC 10281--FExpired
C. botulinum type C9877/1/12+-CExpired
C. botulinum type C/D6503/1/13+-C/DExpired
C. botulinum type D/C3522/5/13-+D/CExpired
C. botulinum type D4150/24/18-+DExpired
Clostridium sordelliiATCC 9714--NegativeSurvived
Clostridium tetaniATCC 10779--NegativeSurvived
Clostridium sporogenesDSM 795--NegativeSurvived
Clostridium difficileATCC 9689--NegativeSurvived
Clostridium haemolyticumATCC 9650--NegativeSurvived
Clostridium novyiATCC 25758--NegativeSurvived
(+) Detection of peaks related to cleaved peptides; (-) Absence of peaks related to the cleaved peptide. * qPCR: Multiplex real time PCR method [18]; ** Only untreated supernatants and heat-treated ones were tested; Expired: presence of heat-labile neurotoxin, Survived: absence of heat-labile neurotoxin.
Table 3. Comparison of the MBA and EndoPep-MS using spiked samples.
Table 3. Comparison of the MBA and EndoPep-MS using spiked samples.
ConcentrationEndoPep-MSMBA
(mLD50/500 µL)Replicate 1Replicate 2Replicate 3Mouse 1Mouse 2
BoNT/C
Serum4PositivePositivePositiveExpiredExpired
2PositivePositivePositiveExpiredExpired
1PositivePositivePositiveExpiredExpired
0.5NegativeNegativeNegativeExpiredExpired
0.25NegativeNegativeNegativeSurvivedSurvived
NegativeNegativeNegativeNegativeNTNT
Broth culture4PositivePositivePositiveExpiredExpired
2PositivePositivePositiveExpiredSurvived
1NegativeNegativeNegativeSurvivedSurvived
0.5NegativeNegativeNegativeSurvivedSurvived
0.25NegativeNegativeNegativeSurvivedSurvived
NegativeNegativeNegativeNegativeNTNT
Feces (1:1 PGB)4N/AN/AN/AExpiredExpired
2N/AN/AN/ASurvivedSurvived
1N/AN/AN/ASurvivedSurvived
0.5N/AN/AN/ASurvivedSurvived
0.25N/AN/AN/ASurvivedSurvived
NegativeN/AN/AN/ANTNT
BoNT/D
Serum4PositivePositivePositiveExpiredExpired
2PositivePositivePositiveExpiredExpired
1PositivePositivePositiveSurvivedSurvived
0.5PositivePositiveNegativeSurvivedSurvived
0.25NegativeNegativeNegativeSurvivedSurvived
NegativeNegativeNegativeNegativeNTNT
Broth culture4PositivePositivePositiveExpiredExpired
2PositivePositivePositiveExpiredExpired
1NegativeNegativeNegativeExpiredExpired
0.5NegativeNegativeNegativeSurvivedSurvived
0.25NegativeNegativeNegativeSurvivedSurvived
NegativeNegativeNegativeNegativeNTNT
Feces (1:1 PGB)4PositivePositivePositiveExpiredExpired
2PositivePositivePositiveExpiredSurvived
1NegativeNegativeNegativeSurvivedSurvived
0.5NegativeNegativeNegativeSurvivedSurvived
0.25NegativeNegativeNegativeSurvivedSurvived
NegativeNegativeNegativeNegativeNTNT
N/A: not applicable; NT: not tested.
Table 4. Comparison between the MBA, EndoPep-MS method, and qPCR applied in positive and negative diagnostic samples.
Table 4. Comparison between the MBA, EndoPep-MS method, and qPCR applied in positive and negative diagnostic samples.
Sample IDOriginBoNTsEndoPep-MS
MBAqPCRBoNT/CBoNT/D
GPB extracts
8/4/15Vegetables + meatNEG/NEGNEG
8/3/15Vegetables + meatNEG/NEGNEG
8/6/14Vegetables + meatBoNT/E/NEGNEG
8/7/14Vegetables + meatBoNT/A/NEGNEG
8/8/15Vegetables + meatBoNT/A/NEGNEG
8/10/15Vegetables + meatBoNT/A/NEGNEG
8/9/15Vegetables + meatNEG/NEGNEG
8/1/15Vegetables + meatNEG/NEGNEG
3/1/15Vegetables + meatBoNT/B/NEGNEG
8/2/15Vegetables + meatBoNT/A/NEGNEG
Enrichment cultures
45/2/12Mushrooms in oilNEG/NEGNEG
3/1/15Eggplants in oilBoNT/BBNEGNEG
43/1/12Human feces NEG/NEGNEG
19/10/11Rectal swabBoNT/EENEGNEG
1/4/15Mushrooms in oilBoNT/BBNEGNEG
2/2/15Human feces NEG/NEGNEG
8/8/08Human feces BoNT/BBNEGNEG
48/4/12Human feces NEG/NEGNEG
18/5/12OlivesBoNT/BBNEGNEG
18/5/12SausagesNEG/NEGNEG
21/19/12Tuna in oilNEG/NEGNEG
55/6/11Eggplants in oilNEG/NEGNEG
153/113Truffle creamNEG/NEGNEG
20/3/12Chili pepper in oilNEG/NEGNEG
16/3/12Human feces BoNT/BBNEGNEG
166/2/13Human feces NEG/NEGNEG
1556/15TunaBoNT/BBNEGNEG
16/4/12Mushrooms in oilBoNT/BBNEGNEG
22/2/14Human feces BoNT/BBNEGNEG
22/4/14Human feces BoNT/BBNEGNEG
46/3/14Human feces BoNT/BBNEGNEG
152/1/10Truffle creamBoNT/BBNEGNEG
47/2/15Human feces BoNT/BBNEGNEG
11/3/15Mushrooms in oilBoNT/BBNEGNEG
18/2/15Human feces BoNT/BBNEGNEG
42/2/15Human feces BoNT/BBNEGNEG
4871/15Human feces NEG/NEGNEG
49/2/15Human feces BoNT/BBNEGNEG
5271715Chili pepper + tuna in oilNEG/NEGNEG
5509/1/20Wood shavingsBoNT/C + BoNT/DC + DPOSPOS
5509/2/20LitterBoNT/C + BoNT/DC + DPOSPOS
4888/20 QuailBoNT/DD/CNEGPOS
5291/1/20Water (drinking)BoNT/DD/CNEGPOS
5291/2/20Water (tank)BoNT/DD/CNEGPOS
5729/1/20Bovine BoNT/DDNEGPOS
5729/2/20BovineBoNT/DDNEGPOS
6126/2/20WaterBoNT/DDNEGPOS
6126/3/20WaterBoNT/DDNEGPOS
6126/7/20QuailBoNT/DDNEGPOS
6126/8/20QuailBoNT/DDNEGPOS
6126/10/20QuailBoNT/DDNEGPOS
6126/11/20QuailBoNT/DDNEGPOS
Sera
5674/10DuckBoNT/C/POSNEG
8103/2/09BroilerBoNT/C/POSNEG
8103/10/09BroilerNEG/NEGNEG
8103/13/09BroilerBoNT/C/POSNEG
2659/2/10BroilerNEG/NEGNEG
2659/4/10BroilerNEG/POSwNEG
2659/5/10BroilerBoNT/C/POSNEG
4691/11TurkeyBoNT/C/POSNEG
4863/13PheasantBoNT/C/POSNEG
474/14DogBoNT/C/POSNEG
5313/28/14BroilerBoNT/C/POSNEG
5313/29/14BroilerBoNT/C/POSNEG
5313/30/14BroilerBoNT/C/POSNEG
6289/3/14Mallard NEG/NEGNEG
6289/4/14MallardNEG/NEGNEG
5993/15PheasantBoNT/C/POSNEG
6353/15BroilerBoNT/C/POSNEG
6660/1/15BroilerBoNT/C/POSNEG
6660/2/15BroilerBoNT/C/POSNEG
6841/2/15BovineNEG/NEGNEG
6841/3/13BovineNEG/POSwNEG
Feces
5641/12SwanBoNT/C/POSNEG
Milk
9861/51/18BovineNEG/NEGNEG
9861/189/18BovineNEG/NEGNEG
9861/242/18BovineNEG/NEGNEG
9861/251/18BovineNEG/NEGNEG
9861/258/18BovineNEG/NEGNEG
w = weak; POS: positive; NEG: negative.
Table 5. Peptide substrates amino acid sequence used for specific BoNT detection and respective mass of uncleaved and cleaved substrates.
Table 5. Peptide substrates amino acid sequence used for specific BoNT detection and respective mass of uncleaved and cleaved substrates.
Toxin TypePeptidem/zReference
NameSequence
BoNT/CPepCKGSNRTIDEANQRA/ATRMLGGK-biotin[M + H]+2912.3[27]
[M + 2H]2+1457.1
CT1059.5
NT1870.9
BoNT/DPep D/FTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQK/LSELDDRADAL[M + H]+/[14]
[M + 2H]2+2605.4
CT1217.3
NT4013.5
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Share and Cite

MDPI and ACS Style

Drigo, I.; Tonon, E.; Pascoletti, S.; Anniballi, F.; Kalb, S.R.; Bano, L. Detection of Active BoNT/C and D by EndoPep-MS Using MALDI Biotyper Instrument and Comparison with the Mouse Test Bioassay. Toxins 2021, 13, 10. https://doi.org/10.3390/toxins13010010

AMA Style

Drigo I, Tonon E, Pascoletti S, Anniballi F, Kalb SR, Bano L. Detection of Active BoNT/C and D by EndoPep-MS Using MALDI Biotyper Instrument and Comparison with the Mouse Test Bioassay. Toxins. 2021; 13(1):10. https://doi.org/10.3390/toxins13010010

Chicago/Turabian Style

Drigo, Ilenia, Elena Tonon, Simone Pascoletti, Fabrizio Anniballi, Suzanne R. Kalb, and Luca Bano. 2021. "Detection of Active BoNT/C and D by EndoPep-MS Using MALDI Biotyper Instrument and Comparison with the Mouse Test Bioassay" Toxins 13, no. 1: 10. https://doi.org/10.3390/toxins13010010

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop