DPEP Inhibits Cancer Cell Glucose Uptake, Glycolysis and Survival by Upregulating Tumor Suppressor TXNIP
Abstract
:1. Introduction
2. Materials and Methods
2.1. Cell Culture
2.2. Peptides and Reagents
- Dpep: RQIKIWFQNRRMKWKKLVELSAENEKLHQRVEQLTRDLAGLRQFFK;
- Dpep-mut: RQIKIWFQNRRMKWKKLVEGSAENEKGHQRVEQGTRDGAGRQFFK.
2.3. Cell Viability
2.4. Glycolytic Activity
2.5. Glucose Uptake
2.6. siRNA Transfections
2.7. qPCR
- 18S ribosomal RNA Forward primer: 5′-AGTCCCTGCCCTTTGTACACA-3′;
- 18S ribosomal RNA Reverse primer: 5′-GATCCGAGGGCCTCACTAAAC-3′;
- TXNIP Forward primer: 5’-ACAGAAAAGGATTCTGTGAAGGTGAT-3′;
- TXNIP Reverse primer: 5’-GCCATTGGCAAGGTAAGTGTG-3′.
2.8. Western Immunoblotting
2.9. Plate-Seq Analysis
3. Results
3.1. Dpep Promotes Context-Dependent Suppression of Glycolysis in Diverse Cancer Cell Lines
3.2. Dpep Exhibits Context-Dependent Suppression of Glucose Uptake
3.3. Dpep Elevates TXNIP mRNA Levels in Lines with Reduced Glycolysis and Glucose Uptake, But Not in Lines without These Responses
3.4. Dpep Upregulates TXNIP Protein in Lines with Upregulated TXNIP Transcripts
3.5. TXNIP Is Required for the Effects of Dpep on Glucose Uptake and Glycolysis and on Cell Survival
3.6. Dpep Shows Additive to Synergistic Activity with Inhibitors of Oxidative Phosphorylation
4. Discussion
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
References
- Greene, L.A.; Zhou, Q.; Siegelin, M.D.; Angelastro, J.M. Targeting Transcription Factors ATF5, CEBPB and CEBPD with Cell-Penetrating Peptides to Treat Brain and Other Cancers. Cells 2023, 12, 581. [Google Scholar] [CrossRef] [PubMed]
- Paerhati, P.; Liu, J.; Jin, Z.; Jakos, T.; Zhu, S.; Qian, L.; Zhu, J.; Yuan, Y. Advancements in Activating Transcription Factor 5 Function in Regulating Cell Stress and Survival. Int. J. Mol. Sci. 2022, 23, 7129. [Google Scholar] [CrossRef] [PubMed]
- Angelastro, J.M.; Canoll, P.D.; Kuo, J.; Weicker, M.; Costa, A.; Bruce, J.N.; Greene, L.A. Selective destruction of glioblastoma cells by interference with the activity or expression of ATF5. Oncogene 2006, 25, 907–916. [Google Scholar] [CrossRef] [PubMed]
- Sears, T.K.; Angelastro, J.M. The transcription factor ATF5: Role in cellular differentiation, stress responses, and cancer. Oncotarget 2017, 8, 84595–84609. [Google Scholar] [CrossRef] [PubMed]
- Zhang, M.; Wang, X.; Yang, N.; Zhu, X.; Lu, Z.; Cai, Y.; Li, B.; Zhu, Y.; Li, X.; Wei, Y.; et al. Prioritization of risk genes in colorectal cancer by integrative analysis of multi-omics data and gene networks. Sci. China Life Sci. 2023, 67, 132–148. [Google Scholar] [CrossRef] [PubMed]
- Klempnauer, K.H. C/EBPbeta cooperates with MYB to maintain the oncogenic program of AML cells. Oncotarget 2023, 14, 174–177. [Google Scholar] [CrossRef] [PubMed]
- Sun, X.; Jefferson, P.; Zhou, Q.; Angelastro, J.M.; Greene, L.A. Dominant-Negative ATF5 Compromises Cancer Cell Survival by Targeting CEBPB and CEBPD. Mol. Cancer Res. 2020, 18, 216–228. [Google Scholar] [CrossRef] [PubMed]
- Wang, S.; Wu, J.; Zhao, W.; Li, M.; Li, S. CEBPB upregulates P4HA2 to promote the malignant biological behavior in IDH1 wildtype glioma. FASEB J. 2023, 37, e22848. [Google Scholar] [CrossRef]
- Hartl, L.; Duitman, J.; Bijlsma, M.F.; Spek, C.A. The dual role of C/EBPdelta in cancer. Crit. Rev. Oncol. Hematol. 2023, 185, 103983. [Google Scholar] [CrossRef]
- Cates, C.C.; Arias, A.D.; Nakayama Wong, L.S.; Lame, M.W.; Sidorov, M.; Cayanan, G.; Rowland, D.J.; Fung, J.; Karpel-Massler, G.; Siegelin, M.D.; et al. Regression/eradication of gliomas in mice by a systemically-deliverable ATF5 dominant-negative peptide. Oncotarget 2016, 7, 12718–12730. [Google Scholar] [CrossRef]
- Karpel-Massler, G.; Horst, B.A.; Shu, C.; Chau, L.; Tsujiuchi, T.; Bruce, J.N.; Canoll, P.; Greene, L.A.; Angelastro, J.M.; Siegelin, M.D. A Synthetic Cell-Penetrating Dominant-Negative ATF5 Peptide Exerts Anticancer Activity against a Broad Spectrum of Treatment-Resistant Cancers. Clin. Cancer Res. 2016, 22, 4698–4711. [Google Scholar] [CrossRef]
- Zhou, Q.; Sun, X.; Pasquier, N.; Jefferson, P.; Nguyen, T.T.T.; Siegelin, M.D.; Angelastro, J.M.; Greene, L.A. Cell-Penetrating CEBPB and CEBPD Leucine Zipper Decoys as Broadly Acting Anti-Cancer Agents. Cancers 2021, 13, 2504. [Google Scholar] [CrossRef]
- Banerjee, D.; Boboila, S.; Okochi, S.; Angelastro, J.M.; Kadenhe-Chiweshe, A.V.; Lopez, G.; Califano, A.; Connolly, E.P.; Greene, L.A.; Yamashiro, D.J. Activating Transcription Factor 5 Promotes Neuroblastoma Metastasis by Inducing Anoikis Resistance. Cancer Res. Commun. 2023, 3, 2518–2530. [Google Scholar] [CrossRef]
- Monaco, S.E.; Angelastro, J.M.; Szabolcs, M.; Greene, L.A. The transcription factor ATF5 is widely expressed in carcinomas, and interference with its function selectively kills neoplastic, but not nontransformed, breast cell lines. Int. J. Cancer 2007, 120, 1883–1890. [Google Scholar] [CrossRef]
- Sun, X.; Angelastro, J.M.; Merino, D.; Zhou, Q.; Siegelin, M.D.; Greene, L.A. Dominant-negative ATF5 rapidly depletes survivin in tumor cells. Cell Death Dis. 2019, 10, 709. [Google Scholar] [CrossRef]
- Zhou, Q.; Greene, L.A. Dpep Inhibits Cancer Cell Growth and Survival via Shared and Context-Dependent Transcriptome Perturbations. Cancers 2023, 15, 5318. [Google Scholar] [CrossRef]
- Vaupel, P.; Multhoff, G. Revisiting the Warburg effect: Historical dogma versus current understanding. J. Physiol. 2021, 599, 1745–1757. [Google Scholar] [CrossRef]
- Fukushi, A.; Kim, H.D.; Chang, Y.C.; Kim, C.H. Revisited Metabolic Control and Reprogramming Cancers by Means of the Warburg Effect in Tumor Cells. Int. J. Mol. Sci. 2022, 23, 10037. [Google Scholar] [CrossRef]
- Jaworska, M.; Szczudlo, J.; Pietrzyk, A.; Shah, J.; Trojan, S.E.; Ostrowska, B.; Kocemba-Pilarczyk, K.A. The Warburg effect: A score for many instruments in the concert of cancer and cancer niche cells. Pharmacol. Rep. 2023, 75, 876–890. [Google Scholar] [CrossRef]
- Ackermann, T.; Hartleben, G.; Muller, C.; Mastrobuoni, G.; Groth, M.; Sterken, B.A.; Zaini, M.A.; Youssef, S.A.; Zuidhof, H.R.; Krauss, S.R.; et al. C/EBPbeta-LIP induces cancer-type metabolic reprogramming by regulating the let-7/LIN28B circuit in mice. Commun. Biol. 2019, 2, 208. [Google Scholar] [CrossRef]
- Wang, Z.; Pang, J.; Wang, L.; Dong, Q.; Jin, D. CEBPB regulates the bile acid receptor FXR to accelerate colon cancer progression by modulating aerobic glycolysis. J. Clin. Lab. Anal. 2022, 36, e24703. [Google Scholar] [CrossRef]
- Chai, Z.; Yang, Y.; Gu, Z.; Cai, X.; Ye, W.; Kong, L.; Qiu, X.; Ying, L.; Wang, Z.; Wang, L. Recombinant Viral Capsid Protein L2 (rVL2) of HPV 16 Suppresses Cell Proliferation and Glucose Metabolism via ITGB7/C/EBPbeta Signaling Pathway in Cervical Cancer Cell Lines. Onco. Targets Ther. 2019, 12, 10415–10425. [Google Scholar] [CrossRef] [PubMed]
- Chan, T.C.; Shiue, Y.L.; Li, C.F. The biological impacts of CEBPD on urothelial carcinoma development and progression. Front. Oncol. 2023, 13, 1123776. [Google Scholar] [CrossRef] [PubMed]
- Balamurugan, K.; Wang, J.M.; Tsai, H.H.; Sharan, S.; Anver, M.; Leighty, R.; Sterneck, E. The tumour suppressor C/EBPdelta inhibits FBXW7 expression and promotes mammary tumour metastasis. EMBO J. 2010, 29, 4106–4117. [Google Scholar] [CrossRef] [PubMed]
- Zhang, Y.; Li, L.; Chu, F.; Wu, H.; Xiao, X.; Ye, J.; Li, K. Itraconazole inhibits tumor growth via CEBPB-mediated glycolysis in colorectal cancer. Cancer Sci. 2024, 115, 1154–1169. [Google Scholar] [CrossRef] [PubMed]
- Subramanian, A.; Tamayo, P.; Mootha, V.K.; Mukherjee, S.; Ebert, B.L.; Gillette, M.A.; Paulovich, A.; Pomeroy, S.L.; Golub, T.R.; Lander, E.S.; et al. Gene set enrichment analysis: A knowledge-based approach for interpreting genome-wide expression profiles. Proc. Natl. Acad. Sci. USA 2005, 102, 15545–15550. [Google Scholar] [CrossRef] [PubMed]
- Mootha, V.K.; Lindgren, C.M.; Eriksson, K.F.; Subramanian, A.; Sihag, S.; Lehar, J.; Puigserver, P.; Carlsson, E.; Ridderstrale, M.; Laurila, E.; et al. PGC-1alpha-responsive genes involved in oxidative phosphorylation are coordinately downregulated in human diabetes. Nat. Genet. 2003, 34, 267–273. [Google Scholar] [CrossRef] [PubMed]
- Maslowska, M.; Wang, H.W.; Cianflone, K. Novel roles for acylation stimulating protein/C3adesArg: A review of recent in vitro and in vivo evidence. Vitam. Horm. 2005, 70, 309–332. [Google Scholar] [PubMed]
- Mizuno, S.; Seishima, R.; Yamasaki, J.; Hattori, K.; Ogiri, M.; Matsui, S.; Shigeta, K.; Okabayashi, K.; Nagano, O.; Li, L.; et al. Angiopoietin-like 4 promotes glucose metabolism by regulating glucose transporter expression in colorectal cancer. J. Cancer Res. Clin. Oncol. 2022, 148, 1351–1361. [Google Scholar] [CrossRef]
- Bajwa, P.; Kordylewicz, K.; Bilecz, A.; Lastra, R.R.; Wroblewski, K.; Rinkevich, Y.; Lengyel, E.; Kenny, H.A. Cancer-associated mesothelial cell-derived ANGPTL4 and STC1 promote the early steps of ovarian cancer metastasis. JCI Insight 2023, 8, e163019. [Google Scholar] [CrossRef]
- Xiao, S.; Nai-Dong, W.; Jin-Xiang, Y.; Long, T.; Xiu-Rong, L.; Hong, G.; Jie-Cheng, Y.; Fei, Z. ANGPTL4 regulate glutamine metabolism and fatty acid oxidation in nonsmall cell lung cancer cells. J. Cell. Mol. Med. 2022, 26, 1876–1885. [Google Scholar] [CrossRef]
- Zhou, C.; Lyu, L.H.; Miao, H.K.; Bahr, T.; Zhang, Q.Y.; Liang, T.; Zhou, H.B.; Chen, G.R.; Bai, Y. Redox regulation by SOD2 modulates colorectal cancer tumorigenesis through AMPK-mediated energy metabolism. Mol. Carcinog. 2020, 59, 545–556. [Google Scholar] [CrossRef]
- Hart, P.C.; Mao, M.; de Abreu, A.L.; Ansenberger-Fricano, K.; Ekoue, D.N.; Ganini, D.; Kajdacsy-Balla, A.; Diamond, A.M.; Minshall, R.D.; Consolaro, M.E.; et al. MnSOD upregulation sustains the Warburg effect via mitochondrial ROS and AMPK-dependent signalling in cancer. Nat. Commun. 2015, 6, 6053. [Google Scholar] [CrossRef]
- Shimizu, M.; Tanaka, N. IL-8-induced O-GlcNAc modification via GLUT3 and GFAT regulates cancer stem cell-like properties in colon and lung cancer cells. Oncogene 2019, 38, 1520–1533. [Google Scholar] [CrossRef]
- Dagdeviren, S.; Lee, R.T.; Wu, N. Physiological and Pathophysiological Roles of Thioredoxin Interacting Protein: A Perspective on Redox Inflammation and Metabolism. Antioxid. Redox Signal. 2023, 38, 442–460. [Google Scholar] [CrossRef]
- Qayyum, N.; Haseeb, M.; Kim, M.S.; Choi, S. Role of Thioredoxin-Interacting Protein in Diseases and Its Therapeutic Outlook. Int. J. Mol. Sci. 2021, 22, 2754. [Google Scholar] [CrossRef]
- Yoshihara, E. TXNIP/TBP-2: A Master Regulator for Glucose Homeostasis. Antioxidants 2020, 9, 765. [Google Scholar] [CrossRef]
- Alhawiti, N.M.; Al Mahri, S.; Aziz, M.A.; Malik, S.S.; Mohammad, S. TXNIP in Metabolic Regulation: Physiological Role and Therapeutic Outlook. Curr. Drug Targets 2017, 18, 1095–1103. [Google Scholar] [CrossRef]
- Hong, S.Y.; Yu, F.X.; Luo, Y.; Hagen, T. Oncogenic activation of the PI3K/Akt pathway promotes cellular glucose uptake by downregulating the expression of thioredoxin-interacting protein. Cell Signal. 2016, 28, 377–383. [Google Scholar] [CrossRef]
- Shen, L.; O’Shea, J.M.; Kaadige, M.R.; Cunha, S.; Wilde, B.R.; Cohen, A.L.; Welm, A.L.; Ayer, D.E. Metabolic reprogramming in triple-negative breast cancer through Myc suppression of TXNIP. Proc. Natl. Acad. Sci. USA 2015, 112, 5425–5430. [Google Scholar] [CrossRef] [PubMed]
- Feng, L.; Ding, R.; Qu, X.; Li, Y.; Shen, T.; Wang, L.; Li, R.; Zhang, J.; Ru, Y.; Bu, X.; et al. BCR-ABL triggers a glucose-dependent survival program during leukemogenesis through the suppression of TXNIP. Cell Death Dis. 2023, 14, 287. [Google Scholar] [CrossRef] [PubMed]
- Zhang, Y.; Yan, Q.; Gong, L.; Xu, H.; Liu, B.; Fang, X.; Yu, D.; Li, L.; Wei, T.; Wang, Y.; et al. C-terminal truncated HBx initiates hepatocarcinogenesis by downregulating TXNIP and reprogramming glucose metabolism. Oncogene 2021, 40, 1147–1161. [Google Scholar] [CrossRef] [PubMed]
- Liang, Y.; Wang, H.; Chen, B.; Mao, Q.; Xia, W.; Zhang, T.; Song, X.; Zhang, Z.; Xu, L.; Dong, G.; et al. circDCUN1D4 suppresses tumor metastasis and glycolysis in lung adenocarcinoma by stabilizing TXNIP expression. Mol. Ther. Nucleic Acids 2021, 23, 355–368. [Google Scholar] [CrossRef] [PubMed]
- Chen, Y.; Ning, J.; Cao, W.; Wang, S.; Du, T.; Jiang, J.; Feng, X.; Zhang, B. Research Progress of TXNIP as a Tumor Suppressor Gene Participating in the Metabolic Reprogramming and Oxidative Stress of Cancer Cells in Various Cancers. Front. Oncol. 2020, 10, 568574. [Google Scholar] [CrossRef]
- Kalyanaraman, B.; Cheng, G.; Hardy, M.; You, M. OXPHOS-targeting drugs in oncology: New perspectives. Expert Opin. Ther. Targets 2023, 27, 939–952. [Google Scholar] [CrossRef] [PubMed]
- Ashton, T.M.; McKenna, W.G.; Kunz-Schughart, L.A.; Higgins, G.S. Oxidative Phosphorylation as an Emerging Target in Cancer Therapy. Clin. Cancer Res. 2018, 24, 2482–2490. [Google Scholar] [CrossRef] [PubMed]
- Liu, L.; Patnana, P.K.; Xie, X.; Frank, D.; Nimmagadda, S.C.; Rosemann, A.; Liebmann, M.; Klotz, L.; Opalka, B.; Khandanpour, C. High Metabolic Dependence on Oxidative Phosphorylation Drives Sensitivity to Metformin Treatment in MLL/AF9 Acute Myeloid Leukemia. Cancers 2022, 14, 486. [Google Scholar] [CrossRef] [PubMed]
- Chen, N.; Zhou, Y.S.; Wang, L.C.; Huang, J.B. Advances in metformin-based metabolic therapy for non-small cell lung cancer (Review). Oncol. Rep. 2022, 47, 55. [Google Scholar] [CrossRef] [PubMed]
- Wu, Z.; Wang, W.; Wei, L.; Zhu, S. Current status and frontier tracking of clinical trials on Metformin for cancer treatment. J. Cancer Res. Clin. Oncol. 2023, 149, 16931–16946. [Google Scholar] [CrossRef]
- Stevens, A.M.; Schafer, E.S.; Li, M.; Terrell, M.; Rashid, R.; Paek, H.; Bernhardt, M.B.; Weisnicht, A.; Smith, W.T.; Keogh, N.J.; et al. Repurposing Atovaquone as a Therapeutic against Acute Myeloid Leukemia (AML): Combination with Conventional Chemotherapy Is Feasible and Well Tolerated. Cancers 2023, 15, 1344. [Google Scholar] [CrossRef]
- Kapur, A.; Mehta, P.; Simmons, A.D.; Ericksen, S.S.; Mehta, G.; Palecek, S.P.; Felder, M.; Stenerson, Z.; Nayak, A.; Dominguez, J.M.A.; et al. Atovaquone: An Inhibitor of Oxidative Phosphorylation as Studied in Gynecologic Cancers. Cancers 2022, 14, 2297. [Google Scholar] [CrossRef]
- Dykstra, H.; LaRose, C.; Fisk, C.; Waldhart, A.; Meng, X.; Zhao, G.; Wu, N. TXNIP interaction with GLUT1 depends on PI(4,5)P(2). Biochim. Et Biophys. Acta (BBA)-Biomembr. 2021, 1863, 183757. [Google Scholar] [CrossRef]
- Waldhart, A.N.; Dykstra, H.; Peck, A.S.; Boguslawski, E.A.; Madaj, Z.B.; Wen, J.; Veldkamp, K.; Hollowell, M.; Zheng, B.; Cantley, L.C.; et al. Phosphorylation of TXNIP by AKT Mediates Acute Influx of Glucose in Response to Insulin. Cell Rep. 2017, 19, 2005–2013. [Google Scholar] [CrossRef]
- Wu, N.; Zheng, B.; Shaywitz, A.; Dagon, Y.; Tower, C.; Bellinger, G.; Shen, C.H.; Wen, J.; Asara, J.; McGraw, T.E.; et al. AMPK-dependent degradation of TXNIP upon energy stress leads to enhanced glucose uptake via GLUT1. Mol. Cell 2013, 49, 1167–1175. [Google Scholar] [CrossRef]
- Qualls-Histed, S.J.; Nielsen, C.P.; MacGurn, J.A. Lysosomal trafficking of the glucose transporter GLUT1 requires sequential regulation by TXNIP and ubiquitin. iScience 2023, 26, 106150. [Google Scholar] [CrossRef]
- Kim, S.; Ge, J.; Kim, D.; Lee, J.J.; Choi, Y.J.; Chen, W.; Bowman, J.W.; Foo, S.S.; Chang, L.C.; Liang, Q.; et al. TXNIP-mediated crosstalk between oxidative stress and glucose metabolism. PLoS ONE 2024, 19, e0292655. [Google Scholar] [CrossRef]
- Pliszka, M.; Szablewski, L. Glucose Transporters as a Target for Anticancer Therapy. Cancers 2021, 13, 4184. [Google Scholar] [CrossRef]
- Ancey, P.B.; Contat, C.; Meylan, E. Glucose transporters in cancer—From tumor cells to the tumor microenvironment. FEBS J. 2018, 285, 2926–2943. [Google Scholar] [CrossRef]
- Chang, Y.C.; Chan, M.H.; Yang, Y.F.; Li, C.H.; Hsiao, M. Glucose transporter 4: Insulin response mastermind, glycolysis catalyst and treatment direction for cancer progression. Cancer Lett. 2023, 563, 216179. [Google Scholar] [CrossRef] [PubMed]
- Patwari, P.; Chutkow, W.A.; Cummings, K.; Verstraeten, V.L.; Lammerding, J.; Schreiter, E.R.; Lee, R.T. Thioredoxin-independent regulation of metabolism by the alpha-arrestin proteins. J. Biol. Chem. 2009, 284, 24996–25003. [Google Scholar] [CrossRef] [PubMed]
- Deng, J.; Pan, T.; Liu, Z.; McCarthy, C.; Vicencio, J.M.; Cao, L.; Alfano, G.; Suwaidan, A.A.; Yin, M.; Beatson, R.; et al. The role of TXNIP in cancer: A fine balance between redox, metabolic, and immunological tumor control. Br. J. Cancer 2023, 129, 1877–1892. [Google Scholar] [CrossRef]
- Gong, H.; Zhang, P.; Hu, X.; Zhang, B. Integrated multiomic data analysis reveals the clinical significance of TXNIP and contributing to immune microenvironment in triple negative breast cancer. Transl. Oncol. 2023, 39, 101808. [Google Scholar] [CrossRef]
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Zhou, Q.; Nguyen, T.T.T.; Mun, J.-Y.; Siegelin, M.D.; Greene, L.A. DPEP Inhibits Cancer Cell Glucose Uptake, Glycolysis and Survival by Upregulating Tumor Suppressor TXNIP. Cells 2024, 13, 1025. https://doi.org/10.3390/cells13121025
Zhou Q, Nguyen TTT, Mun J-Y, Siegelin MD, Greene LA. DPEP Inhibits Cancer Cell Glucose Uptake, Glycolysis and Survival by Upregulating Tumor Suppressor TXNIP. Cells. 2024; 13(12):1025. https://doi.org/10.3390/cells13121025
Chicago/Turabian StyleZhou, Qing, Trang Thi Thu Nguyen, Jeong-Yeon Mun, Markus D. Siegelin, and Lloyd A. Greene. 2024. "DPEP Inhibits Cancer Cell Glucose Uptake, Glycolysis and Survival by Upregulating Tumor Suppressor TXNIP" Cells 13, no. 12: 1025. https://doi.org/10.3390/cells13121025