Construction and Identification of a Breast Bioreactor for Human-Derived Hypoglycemic Protein Amylin
Abstract
:1. Introduction
2. Materials and Methods
2.1. Construction of Transgene Cassette
2.2. The Expression of Amylin in Bcap37 Cell Model
2.3. Generating and Identification of Transgenic Mice
2.4. Expression Analysis of Amylin
2.5. Biological Activity of Amylin from Mice Milk
2.6. Intestinal Metagenomics Analysis
2.7. Statistical Analyses
3. Results
3.1. Vector Construction and Expression in Bcap37 Cells
3.2. Screen of Transgenic Mice and Expression Analysis of Amylin
3.3. Function Assessment of the Amylin in Transgenic Milk
3.4. Intestinal Microbiome Analysis
4. Discussion
5. Conclusions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
References
- Harris, S.; Abrahamson, M.; Ceriello, A.; Charpentier, G.; Evans, M.; Lehmann, R.; Liebl, A.; Linjawi, S.; Holt, R.; Hosszúfalusi, N.; et al. Clinical Considerations When Initiating and Titrating Insulin Degludec/Liraglutide (IDegLira) in People with Type 2 Diabetes. Drugs 2020, 80, 147–165. [Google Scholar] [CrossRef]
- Zinman, B.; Ahrén, B.; Neubacher, D.; Patel, S.; Woerle, H.; Johansen, O. Efficacy and Cardiovascular Safety of Linagliptin as an Add-On to Insulin in Type 2 Diabetes: A Pooled Comprehensive Post Hoc Analysis. Can. J. Diabetes 2016, 40, 50–57. [Google Scholar] [CrossRef]
- Goldenberg, R.; Steen, O. Semaglutide: Review and Place in Therapy for Adults with Type 2 Diabetes. Can. J. Diabetes 2019, 43, 136–145. [Google Scholar] [CrossRef] [PubMed]
- Baggio, L.; Drucker, D. Glucagon-like peptide-1 receptor co-agonists for treating metabolic disease. Mol. Metab. 2020, 46, 101090. [Google Scholar] [CrossRef] [PubMed]
- Meleleo, D.; Cibelli, G.; Valenzano, A.; Mastrodonato, M.; Mallamaci, R. The Effect of Calcium Ions on hIAPP Channel Activity: Possible Implications in T2DM. Membranes 2023, 13, 878. [Google Scholar] [CrossRef]
- Ghusn, W.; Hurtado, M.D.; Acosta, A. Weight-centric treatment of type 2 diabetes mellitus. Obes Pillars 2022, 4, 100045. [Google Scholar] [CrossRef] [PubMed]
- Cooper, G.; Day, A.; Willis, A.; Roberts, A.; Reid, K.; Leighton, B. Amylin and the amylin gene: Structure, function and relationship to islet amyloid and to diabetes mellitus. Biochim. Biophys. Acta 1989, 1014, 247–258. [Google Scholar] [CrossRef] [PubMed]
- Chaari, A.; Abdellatif, B.; Nabi, F.; Khan, R. Date palm (Phoenix dactylifera L.) fruit’s polyphenols as potential inhibitors for human amylin fibril formation and toxicity in type 2 diabetes. Int. J. Biol. Macromol. 2020, 164, 1794–1808. [Google Scholar] [CrossRef] [PubMed]
- Vergari, E.; Knudsen, J.; Ramracheya, R.; Salehi, A.; Zhang, Q.; Adam, J.; Asterholm, I.; Benrick, A.; Briant, L.; Chibalina, M.; et al. Insulin inhibits glucagon release by SGLT2-induced stimulation of somatostatin secretion. Nat. Commun. 2019, 10, 139. [Google Scholar] [CrossRef]
- Tura, A.; Pacini, G.; Yamada, Y.; Seino, Y.; Ahrén, B. Glucagon and insulin secretion, insulin clearance, and fasting glucose in GIP receptor and GLP-1 receptor knockout mice. Am. J. Physiol. Regul. Integr. Comp. Physiol. 2019, 316, R27–R37. [Google Scholar] [CrossRef]
- Ling, W.; Huang, Y.; Qiao, Y.; Zhang, X.; Zhao, H. Human Amylin: From Pathology to Physiology and Pharmacology. Curr. Protein Pept. Sci. 2019, 20, 944–957. [Google Scholar] [CrossRef]
- Akesson, B.; Panagiotidis, G.; Westermark, P.; Lundquist, I. Islet amyloid polypeptide inhibits glucagon release and exerts a dual action on insulin release from isolated islets. Regul. Pept. 2003, 111, 55–60. [Google Scholar] [CrossRef]
- Reiner, D.; Mietlicki-Baase, E.; Olivos, D.; McGrath, L.; Zimmer, D.; Koch-Laskowski, K.; Krawczyk, J.; Turner, C.; Noble, E.; Hahn, J.; et al. Amylin Acts in the Lateral Dorsal Tegmental Nucleus to Regulate Energy Balance Through Gamma-Aminobutyric Acid Signaling. Biol. Psychiatry 2017, 82, 828–838. [Google Scholar] [CrossRef]
- Mietlicki-Baase, E.; Hayes, M. Amylin activates distributed CNS nuclei to control energy balance. Physiol. Behav. 2014, 136, 39–46. [Google Scholar] [CrossRef]
- Hieronymus, L.; Griffin, S. Role of Amylin in Type 1 and Type 2 Diabetes. Diabetes Educ. 2015, 41, 47S–56S. [Google Scholar] [CrossRef]
- Woods, S.; Lutz, T.; Geary, N.; Langhans, W. Pancreatic signals controlling food intake; insulin, glucagon and amylin. Philos. Trans. R. Soc. Lond. Ser. B Biol. Sci. 2006, 361, 1219–1235. [Google Scholar] [CrossRef] [PubMed]
- Apovian, C.; Okemah, J.; O’Neil, P. Body Weight Considerations in the Management of Type 2 Diabetes. Adv. Ther. 2019, 36, 44–58. [Google Scholar] [CrossRef] [PubMed]
- Schultz, N.; Byman, E.; Fex, M.; Wennström, M. Amylin alters human brain pericyte viability and NG2 expression. J. Cereb. Blood Flow Metab. Off. J. Int. Soc. Cereb. Blood Flow Metab. 2017, 37, 1470–1482. [Google Scholar] [CrossRef] [PubMed]
- Liu, M.; Hoskins, A.; Verma, N.; Bers, D.; Despa, S.; Despa, F. Amylin and diabetic cardiomyopathy—Amylin-induced sarcolemmal Ca leak is independent of diabetic remodeling of myocardium. Biochim. Biophys. Acta. Mol. Basis Dis. 2018, 1864, 1923–1930. [Google Scholar] [CrossRef] [PubMed]
- Ren, B.; Liu, Y.; Zhang, Y.; Cai, Y.; Gong, X.; Chang, Y.; Xu, L.; Zheng, J. Genistein: A Dual Inhibitor of Both Amyloid β and Human Islet Amylin Peptides. ACS Chem. Neurosci. 2018, 9, 1215–1224. [Google Scholar] [CrossRef] [PubMed]
- Singh, S.; Bhowmick, D.; Pany, S.; Joe, M.; Zaghlula, N.; Jeremic, A. Apoptosis signal regulating kinase-1 and NADPH oxidase mediate human amylin evoked redox stress and apoptosis in pancreatic beta-cells. Biochim. Biophys. Acta Biomembr. 2018, 1860, 1721–1733. [Google Scholar] [CrossRef]
- Press, M.; Jung, T.; König, J.; Grune, T.; Höhn, A. Protein aggregates and proteostasis in aging: Amylin and β-cell function. Mech. Ageing Dev. 2019, 177, 46–54. [Google Scholar] [CrossRef]
- Smaoui, M.; Waldispühl, J. Complete characterization of the mutation landscape reveals the effect on amylin stability and amyloidogenicity. Proteins 2015, 83, 1014–1026. [Google Scholar] [CrossRef]
- Paul, A.; Kalita, S.; Kalita, S.; Sukumar, P.; Mandal, B. Disaggregation of Amylin Aggregate by Novel Conformationally Restricted Aminobenzoic Acid containing α/β and α/γ Hybrid Peptidomimetics. Sci. Rep. 2017, 7, 40095. [Google Scholar] [CrossRef]
- da Silva, D.; Fontes, G.; Erthal, L.; Lima, L. Amyloidogenesis of the amylin analogue pramlintide. Biophys. Chem. 2016, 219, 1–8. [Google Scholar] [CrossRef]
- Hayat, S.; Farahani, N.; Golichenari, B.; Sahebkar, A. Recombinant Protein Expression in Escherichia coli (E. coli): What We Need to Know. Curr. Pharm. Des. 2018, 24, 718–725. [Google Scholar] [CrossRef]
- Suzuki, R.; Sakakura, M.; Mori, M.; Fujii, M.; Akashi, S.; Takahashi, H. Methyl-selective isotope labeling using α-ketoisovalerate for the yeast Pichia pastoris recombinant protein expression system. J. Biomol. NMR 2018, 71, 213–223. [Google Scholar] [CrossRef]
- Chang, J.; Lee, S.; Kim, J.; Wang, C.; Nai, Y. Transient Expression of Foreign Genes in Insect Cells (sf9) for Protein Functional Assay. J. Vis. Exp. JoVE 2018, 132, e56693. [Google Scholar] [CrossRef]
- Jazayeri, S.; Amiri-Yekta, A.; Bahrami, S.; Gourabi, H.; Sanati, M.; Khorramizadeh, M. Vector and Cell Line Engineering Technologies Toward Recombinant Protein Expression in Mammalian Cell Lines. Appl. Biochem. Biotechnol. 2018, 185, 986–1003. [Google Scholar] [CrossRef] [PubMed]
- Li, Z.; Cui, K.; Wang, H.; Liu, F.; Huang, K.; Duan, Z.; Wang, F.; Shi, D.; Liu, Q. A milk-based self-assemble rotavirus VP6-ferritin nanoparticle vaccine elicited protection against the viral infection. J. Nanobiotechnol. 2019, 17, 13. [Google Scholar] [CrossRef] [PubMed]
- Mohsin, A.; Sukor, R.; Selamat, J.; Meor Hussin, A.; Ismail, I.; Jambari, N.; Jonet, A. A highly selective two-way purification method using liquid chromatography for isolating α-casein from goat milk of five different breeds. J. Chromatogr. B Anal. Technol. Biomed. Life Sci. 2020, 1160, 122380. [Google Scholar] [CrossRef] [PubMed]
- Wang, X.; Ma, T.; Yu, H.; Chen, Z.; Zhu, B.; Chen, W.; Sun, S.; Li, Z. Purification of sialoglycoproteins from bovine milk using serotonin-functionalized magnetic particles and their application against influenza A virus. Food Funct. 2020, 11, 6911–6920. [Google Scholar] [CrossRef] [PubMed]
- Wang, M.; Sun, Z.; Yu, T.; Ding, F.; Li, L.; Wang, X.; Fu, M.; Wang, H.; Huang, J.; Li, N.; et al. Large-scale production of recombinant human lactoferrin from high-expression, marker-free transgenic cloned cows. Sci. Rep. 2017, 7, 10733. [Google Scholar] [CrossRef] [PubMed]
- Luo, Y.; Wang, Y.; Liu, J.; Lan, H.; Shao, M.; Yu, Y.; Quan, F.; Zhang, Y. Production of transgenic cattle highly expressing human serum albumin in milk by phiC31 integrase-mediated gene delivery. Transgenic Res. 2015, 24, 875–883. [Google Scholar] [CrossRef] [PubMed]
- Li, H.; Liu, Q.; Cui, K.; Liu, J.; Ren, Y.; Shi, D. Expression of biologically active human interferon alpha 2b in the milk of transgenic mice. Transgenic Res. 2013, 22, 169–178. [Google Scholar] [CrossRef] [PubMed]
- Zhang, X.; Qiao, Y.; Li, W.; Zou, X.; Chen, Y.; Shen, J.; Liao, Q.; Zhang, Q.; He, L.; Zhao, H. Human amylin induces CD4+Foxp3+ regulatory T cells in the protection from autoimmune diabetes. Immunol. Res. 2018, 66, 179–186. [Google Scholar] [CrossRef]
- Kayser, B.; Prifti, E.; Lhomme, M.; Belda, E.; Dao, M.; Aron-Wisnewsky, J.; Kontush, A.; Zucker, J.; Rizkalla, S.; Dugail, I.; et al. Elevated serum ceramides are linked with obesity-associated gut dysbiosis and impaired glucose metabolism. Metabolomics Off. J. Metabolomic Soc. 2019, 15, 140. [Google Scholar] [CrossRef]
- Nie, X.; Chen, J.; Ma, X.; Ni, Y.; Shen, Y.; Yu, H.; Panagiotou, G.; Bao, Y. A metagenome-wide association study of gut microbiome and visceral fat accumulation. Comput. Struct. Biotechnol. J. 2020, 18, 2596–2609. [Google Scholar] [CrossRef]
- Bolger, A.; Lohse, M.; Usadel, B. Trimmomatic: A flexible trimmer for Illumina sequence data. Bioinformatics 2014, 30, 2114–2120. [Google Scholar] [CrossRef]
- Segata, N.; Izard, J.; Waldron, L.; Gevers, D.; Miropolsky, L.; Garrett, W.; Huttenhower, C. Metagenomic biomarker discovery and explanation. Genome Biol. 2011, 12, R60. [Google Scholar] [CrossRef]
- Rodriguez Camargo, D.; Tripsianes, K.; Kapp, T.; Mendes, J.; Schubert, J.; Cordes, B.; Reif, B. Cloning, expression and purification of the human Islet Amyloid Polypeptide (hIAPP) from Escherichia coli. Protein Expr. Purif. 2015, 106, 49–56. [Google Scholar] [CrossRef]
- Bhattacharya, S.; Latha, J.; Kumresan, R.; Singh, S. Cloning and expression of human islet amyloid polypeptide in cultured cells. Biochem. Biophys. Res. Commun. 2007, 356, 622–628. [Google Scholar] [CrossRef]
- Chen, W.; Wang, F.; Tian, C.; Wang, Y.; Xu, S.; Wang, R.; Hou, K.; Zhao, P.; Yu, L.; Lu, Z.; et al. Transgenic Silkworm-Based Silk Gland Bioreactor for Large Scale Production of Bioactive Human Platelet-Derived Growth Factor (PDGF-BB) in Silk Cocoons. Int. J. Mol. Sci. 2018, 19, 2533. [Google Scholar] [CrossRef]
- Tao, J.; Yang, M.; Wu, H.; Ma, T.; He, C.; Chai, M.; Zhang, X.; Zhang, J.; Ding, F.; Wang, S.; et al. Effects of AANAT overexpression on the inflammatory responses and autophagy activity in the cellular and transgenic animal levels. Autophagy 2018, 14, 1850–1869. [Google Scholar] [CrossRef] [PubMed]
- Ji, M.R.; Lee, S.I.; Jang, Y.J.; Jeon, M.H.; Kim, J.S.; Kim, K.W.; Park, J.K.; Yoo, J.G.; Jeon, I.S.; Kwon, D.J.; et al. STAT5 plays a critical role in regulating the 5’-flanking region of the porcine whey acidic protein gene in transgenic mice. Mol. Reprod. Dev. 2015, 82, 957–966. [Google Scholar] [CrossRef] [PubMed]
- Bussmann, U.A.; Perez Saez, J.M.; Bussmann, L.E.; Baranao, J.L. Aryl hydrocarbon receptor activation leads to impairment of estrogen-driven chicken vitellogenin promoter activity in LMH cells. Comp. Biochem. Physiol. C Toxicol. Pharmacol. 2013, 157, 111–118. [Google Scholar] [CrossRef] [PubMed]
- Molinero, N.; Ruiz, L.; Milani, C.; Gutiérrez-Díaz, I.; Sánchez, B.; Mangifesta, M.; Segura, J.; Cambero, I.; Campelo, A.; García-Bernardo, C.; et al. The human gallbladder microbiome is related to the physiological state and the biliary metabolic profile. Microbiome 2019, 7, 100. [Google Scholar] [CrossRef] [PubMed]
- Lai, Z.; Tseng, C.; Ho, H.; Cheung, C.; Lin, J.; Chen, Y.; Cheng, F.; Hsu, Y.; Lin, J.; El-Omar, E.; et al. Fecal microbiota transplantation confers beneficial metabolic effects of diet and exercise on diet-induced obese mice. Sci. Rep. 2018, 8, 15625. [Google Scholar] [CrossRef]
- Tun, H.; Bridgman, S.; Chari, R.; Field, C.; Guttman, D.; Becker, A.; Mandhane, P.; Turvey, S.; Subbarao, P.; Sears, M.; et al. Roles of Birth Mode and Infant Gut Microbiota in Intergenerational Transmission of Overweight and Obesity from Mother to Offspring. JAMA Pediatr. 2018, 172, 368–377. [Google Scholar] [CrossRef]
- Sorbara, M.; Littmann, E.; Fontana, E.; Moody, T.; Kohout, C.; Gjonbalaj, M.; Eaton, V.; Seok, R.; Leiner, I.; Pamer, E. Functional and Genomic Variation between Human-Derived Isolates of Lachnospiraceae Reveals Inter- and Intra-Species Diversity. Cell Host Microbe 2020, 28, 134–146.e134. [Google Scholar] [CrossRef]
- Arias, L.; Goig, G.; Cardona, P.; Torres-Puente, M.; Díaz, J.; Rosales, Y.; Garcia, E.; Tapia, G.; Comas, I.; Vilaplana, C.; et al. Influence of Gut Microbiota on Progression to Tuberculosis Generated by High Fat Diet-Induced Obesity in C3HeB/FeJ Mice. Front. Immunol. 2019, 10, 2464. [Google Scholar] [CrossRef] [PubMed]
Amylin Gene | Sequence |
---|---|
Improved sequence | CTCGAGATGAAGTGCAACACCGCCACATGTGCCACGCAGCGCCTGGCCAACTTTCTGGTGCACTCCAGCAACAACTTTGGCGCCATCCTCAGCAGCACCAACGTGGGCTCCAACACATACTAACTCGAG |
Mature peptide | MKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY * |
Primers Name | Sequence |
---|---|
pBC1-Universal | F: 500B4-ATTGACAAGTAATACGCTGTTTCCTC-3′ |
R: 5′-ATCAGAAGTTAAACAGCACAGTTAG-3′ | |
Human-amylin | F: 5′-ATGAAGGTGCTGATCCTGGCC-3′ |
R: 5′-AGTAGGTGTTGCTGCCCACG-3′ | |
Human-amylin-probe-T | 5′FAM-CCTGGTGGCCCTGGCCATCGC-NFQ-MGB 3′ |
Mus-actin | F: 5′-CGATGCCCTGAGGCTCTTT-3′ |
R: 5′-TGGATGCCACAGGATTCCA-3′ | |
Mus-actin-probe-T | 5′HEX-CCAGCCTTCCTTCTT-NFQ-MGB 3′ |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Huang, K.; Yan, X.; Li, Z.; Liu, F.; Cui, K.; Liu, Q. Construction and Identification of a Breast Bioreactor for Human-Derived Hypoglycemic Protein Amylin. Life 2024, 14, 191. https://doi.org/10.3390/life14020191
Huang K, Yan X, Li Z, Liu F, Cui K, Liu Q. Construction and Identification of a Breast Bioreactor for Human-Derived Hypoglycemic Protein Amylin. Life. 2024; 14(2):191. https://doi.org/10.3390/life14020191
Chicago/Turabian StyleHuang, Kongwei, Xiuying Yan, Zhipeng Li, Fuhang Liu, Kuiqing Cui, and Qingyou Liu. 2024. "Construction and Identification of a Breast Bioreactor for Human-Derived Hypoglycemic Protein Amylin" Life 14, no. 2: 191. https://doi.org/10.3390/life14020191