Antibiofilm agents belong to diverse compounds that can inhibit and eradicate biofilm formation. The established anti-biofilm compounds are chiefly extracted from natural sources while various chelating agents and synthetic compounds have been found to exhibit some anti-biofilm activity. A current review by Plakunov et al. recommended the agents to be classified into four categories based on their actions in various stages of biofilm formation (
Table 1) [
28]. This rule of categorization seems suitable to subcategorize a certain class of compounds but rather complicated to classify a wide range of antimicrobial compounds en bloc. In this review, we have categorized each agent based on their mode of action and their type. Here, we review some contemporary antibiofilm agents and the therapeutic approaches that can be used as alternatives to antibiotics for treating biofilms.
4.1. Surface Attachment Inhibitors
The initial phases of attachment are very crucial in the biofilm development process. The control of surface attachment can inhibit the whole process of biofilm development. Biofilm formation can also be inhibited by the inhibition of adhesin and EPS molecules. When the bacteria have short-range interaction with the surface, the hydrophobic interactions, dipole, ionic, and hydrogen bonds begin to dominate over some other interactions, and then bacteria start to attach through the cellular or molecular phase [
29] (
Figure 1). Surfactants are the popular choice of antimicrobial agents for inhibiting bacterial adhesion to the surfaces as they decrease the interfacial tension between two substances. Surfactants are amphiphilic as they comprise of hydrophilic and hydrophobic moiety and at the same time, they can be categorized as non-ionic, anionic, cationic, and amphoteric surfactants [
27]. Triton X-100 and Tween 80 (Polysorbate 80) are the two popular non-ionic, synthetically derived, and regularly used surfactants in laboratories (
Table 2). Tween 80 decreased
S. aureus medical device associated biofilm development at concentrations safe in humans [
30]. Triton X-100 could stimulate autolysis by enhancing bacterial vulnerability to antibiotics and altering the architecture and physiological features of biofilms by reducing the protein and carbohydrate constitution in the EPS [
31,
32]. Biosurfactants are the surface-active compounds created by microorganisms that comprise structurally diverse biomolecules [
33]. Cationic surfactants such as quaternary ammonium compounds (QACs) are used as disinfectants within the food industry and used in several medical conditions. QACs bind to negatively charged areas in microbes that cause stress to the cell wall, lysis, and cell death. QACs could also cause protein denaturation that affects cell wall permeability and reduces the uptake of nutrients. Non-ionic-based surfactants incorporating poloxamer 188, are regarded as non-cytotoxic and therefore represent a useful combination in wound care. Numerous studies using antimicrobials together with poloxamers showed enhanced antimicrobial efficacy [
34]. Similar to regular surfactants, numerous biosurfactants have antimicrobial activities while some even seem to prevent surface colonization by pathogens [
27]. One of them is rhamnolipid, which is the chief glycolipid formed by several bacterial species, chiefly by
P. aeruginosa [
35], and stimulates biofilm dispersal in
P. aeruginosa,
S. aureus,
Salmonella enteritidis, and
Listeria monocytogenes [
36]. Furthermore, rhamnolipids from
P. aeruginosa W10 were also known to disperse biofilms of various industrial bacterial strains on the pipelines [
37]. Since biosurfactants are usually associated together with isomers and cogeners and rarely in pure form, the purification process could be exhaustive and expensive [
38]. At the same time, they could be very cytotoxic and hemolytic due to their activity with cellular membrane [
39]. Therefore, their use for controlling biofilms could be limited to coating medical devices and anti-adhesive agents.
4.2. Compound Inducing Cell Lysis
To inhibit the biofilm formation process, it is best to kill the bacteria in the earlier phases of biofilm development. It can be achieved through targeting the cellular components and mechanisms. The breakdown of peptidoglycan that makes the cell wall of bacteria could inhibit biofilm formation as it changes the constitution of teichoic acids and proteins on the cell wall and likewise releases the signals that regulate genes related to biofilm [
54]. Enzymes such as transglycosylase and peptidoglycan hydrolases (endolysins) break the cell wall and often result in bacterial cell death [
55,
56].
Cell division is critical for bacterial existence in the biofilms and for spreading further to new surfaces [
54]. Chelating agents such as Ethylenediaminetetraacetic acid (EDTA) can damage the cell wall, subsequently disrupting the biofilms via sequestering zinc, magnesium, iron, and calcium [
40]. EDTA is generally safe for use in prescription medicine and in small amounts in food preservatives. Similarly, Chitosan is a natural polymer used in numerous applications in the biomedical field because of its biodegradability, bioadhesive property, and bioactivity [
56]. It is known to disrupt negatively charged cell membranes due to its cationic nature (
Table 2) [
41]. Therefore, by using such agents we can tackle the bacteria in the early phase of biofilm development.
4.3. Antiquorum Sensing Molecules
QS is a cell–cell interaction mechanism in the microbial groups to harvest a coordinated effort on regulating the genes related to virulence, biofilm formation, antibiotic tolerance, and survival. The QS mechanism is brought by a set of two proteins in Gram-negative bacteria. One of these is an autoinducer (AI) which leads to signaling molecule production, while the other one acts in response to the AI [
57]. In contrast to Gram-positive bacteria that use secreted autoinducing peptides (AIPs) such as AIs for QS, Gram-negative bacteria employ homoserine lactones (HSL). In addition, unlike Gram-negative bacteria that use a regulator-type protein as an autoinducer sensor, Gram-positive bacteria employ two-component adaptive response proteins for sensing AIs. This mechanism of signaling is stimulated by a phosphorylation/dephosphorylation cascade [
58]. Cyclic di-GMP (c-di-GMP) is also known as a secondary messenger since it is responsible for controlling several functions such as motility, cell cycle, differentiation, developmental transitions, adhesion, aggregation, biofilm production, and virulence in various pathogens. In several Gram-negative bacteria such as
Escherichia coli,
Gluconacetobacter xylinus,
P. aeruginosa, and
Salmonella enterica, c-di-GMP plays a significant role in the shift in between motile to sessile lifestyle, construction of three-dimensional (3D) biofilms, and during biofilm dispersal [
59,
60,
61].
Many natural and synthetic compounds act as anti-QS molecules that target various QS signaling molecules (
Table 3). A natural compound such as garlic was able to reduce the virulence factors progression and decrease the QS signal production in
P. aeruginosa in a mouse urinary tract infection (UTI) model [
62]. In another study by Persson et al., it was reported that garlic extracts inhibit biofilm production in six clinical isolates of bacteria [
57]. Besides, through the rigorous design and screening, all the biological compounds from a potent QS inhibitor interrupted QS signaling by negatively regulating the transcriptional regulators LasR and LuxR [
63]. Ichangin and isolimonic acid are the strong regulators of cell–cell signaling in bacteria, while they are the effective repressors of biofilm and the type III secretion system. Moreover, isolimonic acid also seems to affect AI-3/epinephrine generated cell–cell signaling pathways in QseA and QseBC dependent manner [
64,
65]. It also interfered in AI-2 based QS by reducing the LuxR DNA-binding potential in several
Vibrio spp. [
65]. Another natural compound cinnamaldehyde was known to reduce
E. coli swimming motility and alter biofilm structure and formation [
66]. It was also found that hordenine, a potent phenylethylamine alkaloid obtained from barley, exhibits a dose-dependent decline in the production of the signaling molecule and affects biofilm production in
P. aeruginosa [
67]. Furthermore, hordenine also effectively reduces QS-associated gene expression and virulence factors of
P. aeruginosa PAO1 [
67,
68]. This suggested that hordenine appears to be a novel anti-QS agent that could protect from pathogens [
67]. Plant polyphenols known as quercetin are reported to significantly reduce biofilm production and other virulence factors at a lower concentration than formerly known substances and plant extracts [
69,
70,
71,
72]. Furthermore, a study on QS-associated transcriptional changes revealed that LasI/R, RhlI/R expression levels involved in QS were significantly decreased [
73]. Autoinducing peptide type I (AIP-I) stimulated MRSA biofilms dispersal on titanium disks, causing detached MRSA more vulnerable to treatment with rifampin and levofloxacin [
74]. RNAIII-inhibiting peptide (RIP) resulted in a 7-log reduction in MRSA in a mouse wound model [
75]. While the increased effectiveness of antibiotic treatment with QSI in vivo is promising, reduced bacterial loads often depend on the strain and biofilm model [
4].
Naturally, nitric oxide (NO) is recognized as the universal signaling molecule that can circulate easily in biological systems. However, some studies highlight the role of NO in biofilm dispersal by targeting the QS system of bacteria [
27]. The NO producing agents including sodium nitroprusside (SNP) induced lifestyle transition in bacteria, from the sessile biofilm state to a mobile planktonic state by reducing the amount of intracellular c-di-GMP, thereby causing dispersal of
P. aeruginosa biofilms [
76]. A similar effect of biofilm-dispersal by NO donors has been verified in
Bacillus subtilis as well [
77]. These studies underscore that NO generating agents could be potential antibiofilm agents.
4.4. Synthetic Small Organic Molecules
The design of synthetic small organic molecules has paved a new route to overcome antibiotic tolerance and interfere with biofilms [
78]. It has drawn remarkable attention in the past few decades. Numerous research shows that small organic molecules inhibit biofilms by different modes of action (
Table 4).
Some imidazole and benzimidazole compounds are able not only to inhibit biofilms but also to disperse them. The molecular mechanism behind the antibiofilm effect for the 5-phenyl-2-aminoimidazole was interpreted in
Salmonella typhimurium [
79]. The study emphasizes the potential of 5-phenyl-2-aminoimidazole to decrease the expression of CsgD, and adrA and csgB genes regulated by it, thus preventing the biofilm EPS formation [
79]. Sambanthamoorthy et al. synthesized a 5-methoxy-2-[(4-methyl-benzyl) sulfanyl]-1H-benzimidazole, commonly known as ABC-1 (antibiofilm compound-1) which showed an antibiofilm effect against the Gram-negative bacteria
Vibrio cholera and
P. aeruginosa [
80]. ABC-1 was also able to inhibit biofilms in Gram-positive pathogens including
S. aureus at lower concentrations by targeting eDNA, polysaccharide intercellular adhesion (PIA), and Protein A (SpA) expression [
1]. Likewise, Frei et al. confirmed the strong effect of the 5, 6- dimethoxy-2-aminobenzimidazole not only inhibited
P. aeruginosa biofilms but also dispersed them by targeting two QS receptors, LasR and RhlR [
81].
Pyrazole is an exceptional aromatic heterocyclic compound with five-membered rings, is also known to be a biofilm modulator. Suresh et al. tested three Pyrazolo-pyrimido [4,5-d] pyrimidines (compounds 19 a–c) and found that it was able to inhibit Gram-positive bacteria including
S. aureus,
B. subtitlis, and
Microococcus luteus [
82]. Remarkably, biofilm treatment with compound 19b displayed a substantial surge in intracellular ROS levels in
M. luteus at the dose of 0.5 μg/mL, which caused the cells to undergo oxidative stress that caused membrane damage leading to cell lysis and death [
83,
84].
Indole derivatives are known to repress motility, chemotaxis, and adhesion in
E. coli. In a screening of six plant and animal derivatives of indole, indole-3-carboxaldehyde and 3-indolylacetonitrile were found to be potential biofilm inhibitors against
P. aeruginosa and
E. coli O157: H7. These compounds decrease biofilms by reducing curli production without affecting microbial growth [
85,
86].
2-Phenylhydrazineylidene derivatives can prevent bacterial adhesion by Sortase A (SrtA) inhibition [
87], a transpeptidase enzyme that aids in biofilm production by incorporating cell-surface proteins into the Gram-positive bacteria cell wall. Inhibition of SrtA is also associated with loss of virulence factors in
S. aureus, including attenuation in the binding potential to fibrinogen, and fibronectin, lgG, along with a decrease in biofilm formation [
1,
88,
89]. Pyrrole derivatives are also found to inhibit biofilms in Gram-positive pathogens. For example, Dihydro-pyrrol2-ones (DPO) derivatives such as diethyl1-(3-chlorophenyl)-4-((3-chlorophenyl) amino)-5-oxo-2,5-dihydro-1H-pyrrole-2,3-dicarboxylate exhibited inhibition in
P. aeruginosa growth and biofilm formation by inhibiting mannitol dehydrogenase (MDH) and eDNA. MDH is involved in the synthesis of alginate which is one of the EPS components of
P. aeruginosa [
90].
Brominated furanone derivatives are known to inhibit biofilms in different bacterial species. The synthetic (Z)-5-bromomethylene-2(5H)-furanone repressed microbial communication mediated by AI-2 in several Streptococci such as
Streptococcus angionus,
Streptococci intermedius, and
Streptococcus mutans. Similarly, bicyclic brominated furanones inhibited AI-2 mediated QS in
Tannerella forsythia,
Porphyoromonas gingivalis, and
Fusobacterium nucleatum [
91].
Halogenated phenazines showed powerful activity against Methicillin-resistant
S. epidermidis (MRSE), Methicillin-resistant
S. aureus (MRSA), and Vancomycin-resistant
Enterococci (VRE) by binding with iron (II) and copper (II) that exhibited antibiofilm activity [
92]. In the past, several bacterial infections were treated with quinolones. However, using an in silico virtual screening method, it has been lately identified that quinolone compound Ia could reduce
P. aeruginosa biofilms by inhibiting PqsR (regulatory proteins). It also showed a synergistic effect with other antibiotics such as tobramycin [
93]. Sommer et al. showed the 3,4-dimethoxycinnamide derivative showed biofilm inhibition in
P. aeruginosa by inhibiting LecB [
94].
Although several small molecules have proved to be efficient biofilm inhibitors, none of these agents have reached clinical use due to a lack of experiments in animal models. Therefore, new in vivo studies using small molecules are urgently needed to assess their therapeutic potential [
78].
Table 4.
Small organic molecules with the known biofilm inhibition or eradication mechanism.
Table 4.
Small organic molecules with the known biofilm inhibition or eradication mechanism.
| Small Organic Molecules | Biological Role | Effective Against | Type of Compound | Reference |
---|
1 | 5-phenyl-2-aminoimidazole | Reduction in transription of CsgD, csgB and adrA | S. typhimurium | Imidazole derivative | [79] |
2 | ABC-1 | Reduction in SpA and PIA production and decrease eDNA release | S. aureus, Gram-positive and Gram-negative pathogens | Imidazole derivative | [1,80] |
3 | 5,6-dimethoxy-2-aminobenzimidazole | Reduction in QS receptors (LasR and RhlR) | P. aeruginosa | Imidazole derivative | [81] |
4 | Pyrazolo-pyrimido [4,5-d] pyrimidines | ROS accumulation, loss of membrane integrity | M. luteus, S. aureus, B. subtilis, E. coli, K. planticola | pyrazole compound | [82,83,84] |
5 | Indole-3-carboxaldehyde and 3-indolylacetonitrile | Reduction of curli production | E. coli, P. aeruginosa | indole and carbazole derivative | [85,86] |
6 | Phenylhydrazine analogues | SrtA inhibition | S. aureus | 2-Phenylhydrazineylidene derivatives | [87] |
7 | Diethyl 1-(2-chlorophenyl)-4-((3-chlorophenyl)amino)-5-oxo-2,5-dihydr-1H-pyrrole-2,3-dicarboxylate | MDH and eDNA inhibition | P. aeruginosa | Pyrrole derivatives | [90] |
8 | (Z)-5-bromomethylene-2(5H)-furanone | AI-2-mediated QS inhibition | S. anginosus, S.intermedius and S. mutans | Furanone and oxazolidinone derivatives | [91] |
9 | Bicyclic brominated furanones | AI-2-mediated QS inhibition | F. nucleatum, P. gingivalis and T. forsythia | Furanone and oxazolidinone derivatives | [91] |
10 | Halogenated phenazine | Bind with copper (II ) and iron (II) | MRSA, MRSE, and VRE | Phenazine and quinolone derivative | [92] |
11 | Quinolone compound Ia | PqsR inhibition | P. aeruginosa | Quinolone derivative | [93] |
12 | 3,4-dimethoxycinnamide derivative | LecB inhibition | P. aeruginosa | Cinnamide derivative of d-mannose | [94] |
4.5. Secondary Metabolites
Secondary metabolites (SM) do not directly contribute to the basal metabolism of its producing organism instead act as essential factors to either attract, repel, or kill other organisms and thereby increase the chance of self-survival [
42,
95]. Unique secondary plant metabolites such as
Citrus limonoids presented their potential to affect biofilm formation and cell–cell signaling in
Vibrio harveyi by modulating the expression LuxO, but not the promoter activity of LuxR (
Table 2) [
42].
Since marine organisms are a rich source of novel bioactive metabolites, studies on marine fungal and bacterial secondary metabolites have been gradually growing for the development of novel therapeutic agents [
96]. For example, a secondary metabolite identified as cyclo(l-Tyr-l-Leu) produced from a marine ascomycete
Penicillium spp isolated from the sponge
Axinella corrugata which inhibited biofilm formation by
S. epidermidis [
43]. Similarly, Park et al. described the discovery of three novel secondary peptidic metabolites known as cahuitamycins from
Streptomyces gandocaensis that were the inhibitors of
Acinetobacter baumannii biofilms [
44]. Thus, secondary metabolites could be abundantly found where the microorganisms coexist together. This highlights that nature could be an unlimited source for drug discovery.
Seaweed secondary metabolites such as phlorotannin possess antibacterial properties. Several in vivo studies and clinical trials exist on the health benefits of Phlorotanin. However, these studies were not based on the antibiofilm properties of phlorotannin [
45,
97]. The current studies in vitro show antibiofilm properties of secondary metabolites, but more in vivo studies on the antibiofilm properties seem to be required.
4.6. Antibiofilm Peptides
Antimicrobial peptides (AMPs) are a type of innate defense mechanism in different eukaryotes which was first discovered by Kiss and Michl in the 1960s. AMPs are cationic and hydrophobic residues containing molecules that can interact with various microorganisms such as bacteria, fungus, protozoa, and some enveloped viruses [
98,
99,
100]. Since AMPs have low antigenicity and rapid killing effect in comparison to conventional antibiotics, it has been showing momentous potential in recent years [
101]. Studies show sub-minimal inhibitory concentration (MIC) of some AMPs is also able to inhibit biofilm in various pathogens, thus these peptides are termed antibiofilm peptides (ABPs) [
102]. Antimicrobial peptides display a wide range of antibiofilm effects by (1) cleavage of peptidoglycan, (2) change of membrane permeabilization or membrane potential, (3) neutralization or disassembly of lipopolysaccharides, (4) inhibition of cell division and cell survival, (5) modulate the synthesis of adhesion molecule synthesis and function, and (6) repression of the stringent response of the bacteria [
54,
103]. Some ABPs and their mechanisms for biofilm inhibition or dispersal are given in
Table 5.
AMPs such as nisin and bovicin HC5 reduced the
S. aureus adhesion to the polystyrene surfaces and altered the cell as well as polystyrene surface hydrophobicity. These AMPs also changed the biofilm-related gene expressions in planktonic cells [
104]. On the other hand, a popular human cathelicidin AMP, LL-37, and indolicidin were known to inhibit
P. aeruginosa biofilm formation. It was likely achieved by inhibiting the transcription of Las and Rhl QS systems [
105,
106]. LL-37 also inhibits biofilm formation of
P. aeruginosa by upregulating the expression of genes needed for type IV pili biosynthesis and function [
105]. Likewise, peptide 1037 efficiently inhibits biofilm production by the Gram-positive
L. monocytogenes and Gram-negative pathogens
Burkholderia cenocepacia and
P. aeruginosa. Peptide 1037 directly reduced biofilm production by decreasing swarming and swimming motilities, inducing twitching motility, and downregulation of several genes related to biofilm production [
106].
Fuente Nunez et al. found an effective anti-biofilm peptide 1018 which could bind and degrade (p)ppGpp, a crucial signal required for the formation of biofilm [
102]. Peptide 1018 treatment completely prevented biofilm production at much lower concentrations, which did not alter planktonic growth and also caused degradation of mature biofilms in
E. coli,
A. baumannii,
P. aeruginosa,
Klebsiella pneumoniae, MRSA,
S. Typhimurium, and Burkholderia cenocepacia [
102]. D-enantiomeric protease-resistant peptides DJK-5 and DJK-6 could reduce (p)ppGpp in biofilms of
P. aeruginosa to a greater amount than 1018 [
107].
Apidaecin, pyrrhocoricin, and drosocin are 18–20 amino acid, proline-rich residues that were initially obtained from insects. These AMPs attack a target microbial protein in a stereospecific manner. They interact with the bacterial heat-shock protein DnaK by inhibiting chaperone-assisted protein folding and limiting the DnaK ATPase activity [
108,
109,
110]. The peptide antibiotic microcin B17 (MccB17) is the first peptide known to repress a type II DNA topoisomerase activity. MccB17 blocks
E. coli DNA gyrase by trapping an enzyme-DNA cleavable complex [
111]. PR-39, an AMP which was obtained from the upper portion of a pig’s small intestine, could kill growing bacteria faster than non-growing cells. It is suggested that PR-39 kills bacteria by stopping protein and DNA synthesis [
112].
Table 5.
Antibiofilm peptides with known modes of actions.
Table 5.
Antibiofilm peptides with known modes of actions.
Biofilms | AMP | Amino Acid Sequence | MW (g/moL) | No. of Residues | Mode of Action | References |
---|
P. aeruginosa | LL-37 | [LL-37, 37 aa] | 4493.33 | 37 | Reduces swimming and swarming motilities, promotes twitching motility, downregulates the genes required for biofilm formation and influences QS system | [105,106] |
1037 | KRFRIRVRV | 1229.54 | 9 | [106] |
1018 | VRLIVAVRIWRR | 1536.93 | 12 | binds and degrades (p)ppGpp | [102] |
Esculentin-1a (1–21) | GIFSKLAGKKIKNLLISGLKG | 2185.73 | 21 | Disrupts cell membrane | [113] |
RN3(5-17P22-36) | RPFTRAQWFAIQHISPRTIAMRAINNYRWR | 3758.38 | 30 | Depolarizes and permeabilize cell membrane | [114] |
S4 (1–16) | ALWKTLLKKVLKAAAK | 1782.29 | 16 | disintegrates and release membrane lipids | [115] |
DJK-5 | VQWRAIRVRVIR | 1551.91 | 12 | degrade (p)ppGpp | [107] |
S. aureus | Nisin A | MSTKDFNLDLVSVSKKDSGASPR | 3354.1 | 23 | Depolarizes cell membrane | [116] |
lacticin Q | MAGFLKVVQLLAKYGSKAVQMAWANKGKILDWLNAGQAIDKVVSKIKQILGIK | 5785.05 | 53 |
Nukacin ISK-1 | KK-KSGVIPTVSHGCHMNSFQFVFTCC | 2886.44 | 26 |
HC5 | VGXRYASXPGXSWKYVXF | 1616.84 | 14 | alter surface hydrophobicity | [104] |
S. epidermidis | Hepcidin 20 | ICIFCCGCCHRSHCGMCCKT | 2208.8 | 20 | Acts on Polysaccharide Intercellular Adhesin | [117] |
Human β defensin 3 (HBD-3) | GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK | 5161.24 | 45 | targets icaA, icaD, and icaR genes | [118] |
S. mutans | P1 | PARKARAATAATAATAATAATAAT | 2158 | 24 | interferes and degrades EPS | [119] |
E. coli | Pyrrhocoricin | VDKGSYLPRPTPPRPIYNRN | 2340.67 | 20 | bind with DNaK | [108,109,110] |
Apdidaecin | GNNRPVYIPQPRPPHPRI | 2108.44 | 18 |
Drosocin | GKPRPYSPRPTSHPRPIRV | 2198.56 | 19 |
Microcin B17 | VGIGGGGGGGGGGSCGGQGGGCGGCSNGCSGGNGGSGGSGSHI | 3255.35 | 43 | Inhibition of DNA replication by inhibiting type II DNA topoisomerase | [111] |
PR-39 | RRRPRPPYLPRPRPPPFFPPRLPPRIPPGFPPRFPPRFP | 4720.7 | 39 | stop the synthesis of DNA and protein | [112] |
Some antimicrobial peptides polarize and permeabilize the cell membrane and finally cause membrane disruptions. Esculentin (Esc (1–21) is the AMP derived from the frog skin. It could breach the cytoplasmic membrane of Gram-negative bacteria for example
P. aeruginosa PAO1 inside the biofilms and lead to a discharge of β-galactosidase. However, this impact on biofilm cells was slower when compared to the planktonic cells [
113]. Similarly, another synthesized peptide, RN3(5-17P22-36) was acquired from the cationic proteins of eosinophil granules. It was also capable of causing cell lysis by membrane disruption in biofilms. There was a 2–3-fold reduction in membrane depolarization in the biofilm cells as compared with the planktonic cells at the same dose of AMP [
114]. Another peptide, known as S4 (1–16) M4Ka, which is a derivative of dermaseptin S4 also causes the flux of membrane lipids, bacterial dispersal, thus leading to a reduction in
P. aeruginosa biofilm [
115]. Bacteriocins such as nukacin ISK-1, lacticin Q, and nisin A also destroyed the membrane potential of
S. aureus biofilm cells and caused the ATP flux from the cells [
116].
Several AMPs also target biofilm EPS components. AMPs such as P1 could destroy biofilm EPS formed by
Streptococcus mutans that resulted in decreased biofilm formation on polystyrene and saliva-coated hydroxyapatite [
119]. Another AMP, hepcidin 20, was able to decrease EPS load and affect the biofilm structure of
S. epidermidis by inhibiting PIA [
117]. Similarly, Human β -defensin 3 (HBD-3) induced downregulation of ica operon genes, such as
icaA and
icaD, and at the same time upregulated
icaR genes of
S. epidermidis thus decreasing PIA production resulting in biofilm inhibition [
118]. As all of these results suggest antibiofilm peptides can control biofilms using several different kinds of mechanisms, these peptides can be further classified into several sub-groups as suggested by Plakunov et al. [
28].
A few antibiofilm peptides have even been used in treating biofilms in animals and agriculture. Since antibiofilm peptides have a complex mechanism of action, improving our understanding of these mechanisms in biologically relevant situations appears to be important for determining structure–function associations and finally optimizing synthetic antibiofilm peptides for improved antibiofilm potential [
120].
4.7. Compounds Targeting Metabolism
Studies into bacterial metabolism show that certain metabolites are necessary for biofilm formation and stability [
121]. Recent reports showed small-molecule metabolites and correlated metabolism were essential for biofilm development and dispersal. Pisithkul et al. found that in the early phases of biofilm development, tricarboxylic acid (TCA) cycle activity was increased, iron metabolism and the transport was reorganized, a metabolic shift had occurred from fatty acid biosynthesis to fatty acid degradation, and a switch from acetate to acetoin fermentation took place in
B. subtilis [
122]. In another study by Lu et al., they first evaluated the difference in metabolism between the biofilm and planktonic populations of UTI89 (uropathogenic
E. coli, UPEC strain) by using mass spectrometry-based targeted and untargeted metabolomic methods, together with cytological imaging, that enabled in identifying the targeted metabolites and related metabolic pathways involved in biofilm development [
123]. Interestingly, they could also find distinct changes in both metabolism and phenotypic morphology in two patterns. Moreover, they recognized and categorized 38 differential metabolites and three of the associated metabolic pathways, namely carbohydrate metabolism, amino acid metabolism, and glycerolipid metabolism, were changed typically during biofilm production [
123]. In a different study, tea tree oil showed antimicrobial and antibiofilm activity against
S. aureus (
Table 2) and also changed its metabolism by dramatically affecting the expression of genes associated with the pyrimidine metabolism pathway, purine metabolism pathway, glycine, serine, and threonine metabolism pathway, and amino acid biosynthesis pathway [
52]. Some research also showed that treatment with exogenous amino acids for example L-arginine was able to control the biofilm formation by repressing the genes that are essential in the formation of
S. mutans biofilm EPS [
124]. Hence, from the recent knowledge about biofilm metabolism, key biofilm metabolites and the chief metabolic pathways could be sorted out. Metabolic engineering into these pathways could be the next essential approach in tackling biofilms.
4.8. EPS Degrading Enzymes for Biofilm Dispersal
Degradation of the EPS by EPS-degrading enzymes such as α-amylase, Dispersin B (DspB), and DNase I is a popular antibiofilm strategy (
Table 2). The damage to the basic biofilm component permits more infiltration of antibiotics, thus improving the efficiency of the antibiotic. α-amylase, DspB, and DNase I degrade exopolysaccharides, biofilm EPS, and eDNA, respectively [
51,
125], which decreases biofilm production as well as degrades mature bacterial biofilms such as
Vibrio cholerae,
S. aureus, and
P. aeruginosa [
46]. Polyamine norspermidine and D-amino acids are some of the naturally produced small molecules by bacterial communities that induce the mature biofilm dispersal and also prevent biofilm production in
E. coli and
S. aureus [
47,
48,
126]. A different study reported that N-acetylcysteine/NAC and Tween 80 discretely or together with other antibiotics could effectively disperse non-pigmented rapidly growing mycobacteria (RGM) biofilms [
49]. Similarly, the researchers in Japan reported that Esp, a serine protease produced by
S. epidermidis can prevent as well as disperse the
S. aureus biofilms in vitro. It could likewise repress
S. aureus nasal colonization in vivo [
50]. A similar study by Park et al. also showed that the proteases from
P. aeruginosa were able to prevent biofilm production and induce dispersal in
S. aureus [
53]. Thus, EPS-degrading enzymes have the potential to be used in biofilm dispersal strategy as an antimicrobial agent.