Microparticle RSV Vaccines Presenting the G Protein CX3C Chemokine Motif in the Context of TLR Signaling Induce Protective Th1 Immune Responses and Prevent Pulmonary Eosinophilia Post-Challenge
Abstract
:1. Introduction
2. Materials and Methods
3. Results
4. Discussion
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
References
- Zhou, H.; Thompson, W.W.; Viboud, C.G.; Ringholz, C.M.; Cheng, P.Y.; Steiner, C.; Abedi, G.R.; Anderson, L.J.; Brammer, L.; Shay, D.K. Hospitalizations associated with influenza and respiratory syncytial virus in the United States, 1993–2008. Clin. Infect. Dis. 2012, 54, 1427–1436. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Martinez, I.; Dopazo, J.; Melero, J.A. Antigenic structure of the human respiratory syncytial virus G glycoprotein and relevance of hypermutation events for the generation of antigenic variants. J. Gen. Virol. 1997, 78 Pt 10, 2419–2429. [Google Scholar] [CrossRef] [PubMed]
- Hall, C.B.; Walsh, E.E.; Long, C.E.; Schnabel, K.C. Immunity to and frequency of reinfection with respiratory syncytial virus. J. Infect. Dis. 1991, 163, 693–698. [Google Scholar] [CrossRef] [PubMed]
- Escribano-Romero, E.; Rawling, J.; Garcia-Barreno, B.; Melero, J.A. The soluble form of human respiratory syncytial virus attachment protein differs from the membrane-bound form in its oligomeric state but is still capable of binding to cell surface proteoglycans. J. Virol. 2004, 78, 3524–3532. [Google Scholar] [CrossRef] [Green Version]
- Meissner, H.C.; Kimberlin, D.W. RSV immunoprophylaxis: Does the benefit justify the cost? Pediatrics 2013, 132, 915–918. [Google Scholar] [CrossRef] [Green Version]
- Chida-Nagai, A.; Sato, H.; Sato, I.; Shiraishi, M.; Sasaki, D.; Izumi, G.; Yamazawa, H.; Cho, K.; Manabe, A.; Takeda, A. Risk factors for hospitalisation due to respiratory syncytial virus infection in children receiving prophylactic palivizumab. Eur. J. Pediatr. 2022, 181, 539–547. [Google Scholar] [CrossRef]
- Griffin, M.P.; Yuan, Y.; Takas, T.; Domachowske, J.B.; Madhi, S.A.; Manzoni, P.; Simoes, E.A.F.; Esser, M.T.; Khan, A.A.; Dubovsky, F.; et al. Single-Dose Nirsevimab for Prevention of RSV in Preterm Infants. N. Engl. J. Med. 2020, 383, 415–425. [Google Scholar] [CrossRef]
- Chin, J.; Magoffin, R.L.; Shearer, L.A.; Schieble, J.H.; Lennette, E.H. Field evaluation of a respiratory syncytial virus vaccine and a trivalent parainfluenza virus vaccine in a pediatric population. Am. J. Epidemiol. 1969, 89, 449–463. [Google Scholar] [CrossRef]
- Fulginiti, V.A.; Eller, J.J.; Sieber, O.F.; Joyner, J.W.; Minamitani, M.; Meiklejohn, G. Respiratory virus immunization. I. A field trial of two inactivated respiratory virus vaccines; an aqueous trivalent parainfluenza virus vaccine and an alum-precipitated respiratory syncytial virus vaccine. Am. J. Epidemiol. 1969, 89, 435–448. [Google Scholar] [CrossRef]
- Kapikian, A.Z.; Mitchell, R.H.; Chanock, R.M.; Shvedoff, R.A.; Stewart, C.E. An epidemiologic study of altered clinical reactivity to respiratory syncytial (RS) virus infection in children previously vaccinated with an inactivated RS virus vaccine. Am. J. Epidemiol. 1969, 89, 405–421. [Google Scholar] [CrossRef]
- Kim, H.W.; Canchola, J.G.; Brandt, C.D.; Pyles, G.; Chanock, R.M.; Jensen, K.; Parrott, R.H. Respiratory syncytial virus disease in infants despite prior administration of antigenic inactivated vaccine. Am. J. Epidemiol. 1969, 89, 422–434. [Google Scholar] [CrossRef] [PubMed]
- Murphy, B.R.; Walsh, E.E. Formalin-inactivated respiratory syncytial virus vaccine induces antibodies to the fusion glycoprotein that are deficient in fusion-inhibiting activity. J. Clin. Microbiol. 1988, 26, 1595–1597. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Delgado, M.F.; Coviello, S.; Monsalvo, A.C.; Melendi, G.A.; Hernandez, J.Z.; Batalle, J.P.; Diaz, L.; Trento, A.; Chang, H.Y.; Mitzner, W.; et al. Lack of antibody affinity maturation due to poor Toll-like receptor stimulation leads to enhanced respiratory syncytial virus disease. Nat. Med. 2009, 15, 34–41. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Castilow, E.M.; Olson, M.R.; Varga, S.M. Understanding respiratory syncytial virus (RSV) vaccine-enhanced disease. Immunol. Res. 2007, 39, 225–239. [Google Scholar] [CrossRef] [PubMed]
- Connors, M.; Giese, N.A.; Kulkarni, A.B.; Firestone, C.Y.; Morse, H.C., 3rd; Murphy, B.R. Enhanced pulmonary histopathology induced by respiratory syncytial virus (RSV) challenge of formalin-inactivated RSV-immunized BALB/c mice is abrogated by depletion of interleukin-4 (IL-4) and IL-10. J. Virol. 1994, 68, 5321–5325. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Ubol, S.; Halstead, S.B. How innate immune mechanisms contribute to antibody-enhanced viral infections. Clin. Vaccine Immunol. 2010, 17, 1829–1835. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Kurt-Jones, E.A.; Popova, L.; Kwinn, L.; Haynes, L.M.; Jones, L.P.; Tripp, R.A.; Walsh, E.E.; Freeman, M.W.; Golenbock, D.T.; Anderson, L.J.; et al. Pattern recognition receptors TLR4 and CD14 mediate response to respiratory syncytial virus. Nat. Immunol. 2000, 1, 398–401. [Google Scholar] [CrossRef]
- McLellan, J.S.; Chen, M.; Leung, S.; Graepel, K.W.; Du, X.; Yang, Y.; Zhou, T.; Baxa, U.; Yasuda, E.; Beaumont, T.; et al. Structure of RSV fusion glycoprotein trimer bound to a prefusion-specific neutralizing antibody. Science 2013, 340, 1113–1117. [Google Scholar] [CrossRef] [Green Version]
- Arbiza, J.; Taylor, G.; Lopez, J.A.; Furze, J.; Wyld, S.; Whyte, P.; Stott, E.J.; Wertz, G.; Sullender, W.; Trudel, M.; et al. Characterization of two antigenic sites recognized by neutralizing monoclonal antibodies directed against the fusion glycoprotein of human respiratory syncytial virus. J. Gen. Virol 1992, 73 Pt 9, 2225–2234. [Google Scholar] [CrossRef]
- Glenn, G.M.; Smith, G.; Fries, L.; Raghunandan, R.; Lu, H.; Zhou, B.; Thomas, D.N.; Hickman, S.P.; Kpamegan, E.; Boddapati, S.; et al. Safety and immunogenicity of a Sf9 insect cell-derived respiratory syncytial virus fusion protein nanoparticle vaccine. Vaccine 2013, 31, 524–532. [Google Scholar] [CrossRef]
- Simoes, E.A.F.; Center, K.J.; Tita, A.T.N.; Swanson, K.A.; Radley, D.; Houghton, J.; McGrory, S.B.; Gomme, E.; Anderson, M.; Roberts, J.P.; et al. Prefusion F Protein-Based Respiratory Syncytial Virus Immunization in Pregnancy. N. Engl. J. Med. 2022, 386, 1615–1626. [Google Scholar] [CrossRef] [PubMed]
- Wilmschen, S.; Schneider, S.; Peters, F.; Bayer, L.; Issmail, L.; Banki, Z.; Grunwald, T.; von Laer, D.; Kimpel, J. RSV Vaccine Based on Rhabdoviral Vector Protects after Single Immunization. Vaccines 2019, 7, 59. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Aliprantis, A.O.; Shaw, C.A.; Griffin, P.; Farinola, N.; Railkar, R.A.; Cao, X.; Liu, W.; Sachs, J.R.; Swenson, C.J.; Lee, H.; et al. A phase 1, randomized, placebo-controlled study to evaluate the safety and immunogenicity of an mRNA-based RSV prefusion F protein vaccine in healthy younger and older adults. Hum. Vaccin Immunother. 2021, 17, 1248–1261. [Google Scholar] [CrossRef] [PubMed]
- Tripp, R.A.; Jones, L.P.; Haynes, L.M.; Zheng, H.; Murphy, P.M.; Anderson, L.J. CX3C chemokine mimicry by respiratory syncytial virus G glycoprotein. Nat. Immunol. 2001, 2, 732–738. [Google Scholar] [CrossRef] [PubMed]
- Harcourt, J.; Alvarez, R.; Jones, L.P.; Henderson, C.; Anderson, L.J.; Tripp, R.A. Respiratory syncytial virus G protein and G protein CX3C motif adversely affect CX3CR1+ T cell responses. J. Immunol. 2006, 176, 1600–1608. [Google Scholar] [CrossRef] [Green Version]
- Haynes, L.M.; Jones, L.P.; Barskey, A.; Anderson, L.J.; Tripp, R.A. Enhanced disease and pulmonary eosinophilia associated with formalin-inactivated respiratory syncytial virus vaccination are linked to G glycoprotein CX3C-CX3CR1 interaction and expression of substance P. J. Virol. 2003, 77, 9831–9844. [Google Scholar] [CrossRef] [Green Version]
- Haynes, L.M.; Caidi, H.; Radu, G.U.; Miao, C.; Harcourt, J.L.; Tripp, R.A.; Anderson, L.J. Therapeutic monoclonal antibody treatment targeting respiratory syncytial virus (RSV) G protein mediates viral clearance and reduces the pathogenesis of RSV infection in BALB/c mice. J. Infect. Dis. 2009, 200, 439–447. [Google Scholar] [CrossRef]
- Miao, C.; Radu, G.U.; Caidi, H.; Tripp, R.A.; Anderson, L.J.; Haynes, L.M. Treatment with respiratory syncytial virus G glycoprotein monoclonal antibody or F(ab′)2 components mediates reduced pulmonary inflammation in mice. J. Gen. Virol. 2009, 90, 1119–1123. [Google Scholar] [CrossRef]
- Nguyen, T.N.; Power, U.F.; Robert, A.; Haeuw, J.F.; Helffer, K.; Perez, A.; Asin, M.A.; Corvaia, N.; Libon, C. The respiratory syncytial virus G protein conserved domain induces a persistent and protective antibody response in rodents. PLoS ONE 2012, 7, e34331. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Lee, H.J.; Lee, J.Y.; Park, M.H.; Kim, J.Y.; Chang, J. Monoclonal Antibody against G Glycoprotein Increases Respiratory Syncytial Virus Clearance In Vivo and Prevents Vaccine-Enhanced Diseases. PLoS ONE 2017, 12, e0169139. [Google Scholar] [CrossRef]
- Jorquera, P.A.; Choi, Y.; Oakley, K.E.; Powell, T.J.; Boyd, J.G.; Palath, N.; Haynes, L.M.; Anderson, L.J.; Tripp, R.A. Nanoparticle Vaccines Encompassing the Respiratory Syncytial Virus (RSV) G Protein CX3C Chemokine Motif Induce Robust Immunity Protecting from Challenge and Disease. PLoS ONE 2013, 8, e74905. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Jorquera, P.A.; Oakley, K.E.; Powell, T.J.; Palath, N.; Boyd, J.G.; Tripp, R.A. Layer-By-Layer Nanoparticle Vaccines Carrying the G Protein CX3C Motif Protect against RSV Infection and Disease. Vaccines 2015, 3, 829–849. [Google Scholar] [CrossRef] [Green Version]
- Murawski, M.R.; Bowen, G.N.; Cerny, A.M.; Anderson, L.J.; Haynes, L.M.; Tripp, R.A.; Kurt-Jones, E.A.; Finberg, R.W. Respiratory syncytial virus activates innate immunity through Toll-like receptor 2. J. Virol. 2009, 83, 1492–1500. [Google Scholar] [CrossRef] [Green Version]
- Alshaghdali, K.; Saeed, M.; Kamal, M.A.; Saeed, A. Interaction of Ectodomain of Respiratory Syncytial Virus G Protein with TLR2/TLR6 Heterodimer: An In vitro and In silico Approach to Decipher the Role of RSV G Protein in Pro-inflammatory Response against the Virus. Curr. Pharm. Des. 2021, 27, 4464–4476. [Google Scholar] [CrossRef] [PubMed]
- Castilow, E.M.; Meyerholz, D.K.; Varga, S.M. IL-13 is required for eosinophil entry into the lung during respiratory syncytial virus vaccine-enhanced disease. J. Immunol. 2008, 180, 2376–2384. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Acosta, P.L.; Caballero, M.T.; Polack, F.P. Brief History and Characterization of Enhanced Respiratory Syncytial Virus Disease. Clin. Vaccine Immunol. 2015, 23, 189–195. [Google Scholar] [CrossRef] [Green Version]
- Graham, B.S.; Henderson, G.S.; Tang, Y.W.; Lu, X.; Neuzil, K.M.; Colley, D.G. Priming immunization determines T helper cytokine mRNA expression patterns in lungs of mice challenged with respiratory syncytial virus. J. Immunol. 1993, 151, 2032–2040. [Google Scholar]
- Hancock, G.E.; Heers, K.M.; Pryharski, K.S.; Smith, J.D.; Tiberio, L. Adjuvants recognized by toll-like receptors inhibit the induction of polarized type 2 T cell responses by natural attachment (G) protein of respiratory syncytial virus. Vaccine 2003, 21, 4348–4358. [Google Scholar] [CrossRef]
- Hancock, G.E.; Heers, K.M.; Smith, J.D.; Scheuer, C.A.; Ibraghimov, A.R.; Pryharski, K.S. CpG containing oligodeoxynucleotides are potent adjuvants for parenteral vaccination with the fusion (F) protein of respiratory syncytial virus (RSV). Vaccine 2001, 19, 4874–4882. [Google Scholar] [CrossRef]
- Iwata-Yoshikawa, N.; Uda, A.; Suzuki, T.; Tsunetsugu-Yokota, Y.; Sato, Y.; Morikawa, S.; Tashiro, M.; Sata, T.; Hasegawa, H.; Nagata, N. Effects of Toll-like receptor stimulation on eosinophilic infiltration in lungs of BALB/c mice immunized with UV-inactivated severe acute respiratory syndrome-related coronavirus vaccine. J. Virol. 2014, 88, 8597–8614. [Google Scholar] [CrossRef] [Green Version]
- Powell, T.J.; Tang, J.; Derome, M.E.; Mitchell, R.A.; Jacobs, A.; Deng, Y.; Palath, N.; Cardenas, E.; Boyd, J.G.; Nardin, E. Plasmodium falciparum synthetic LbL microparticle vaccine elicits protective neutralizing antibody and parasite-specific cellular immune responses. Vaccine 2013, 31, 1898–1904. [Google Scholar] [CrossRef] [PubMed]
- Motevalian, S.P.; Steen, J.; De Leon, J.; Sriskanda, V.; Carino, I.; Prashad, A.S.; Carrillo Conde, B.; Arve, B. Evaluation of single-use tangential flow filtration technology for purification of activated polysaccharides used in conjugate vaccine manufacturing. Biotechnol. Prog. 2021, 37, e3204. [Google Scholar] [CrossRef] [PubMed]
- Liu, H.W.; Hu, Y.; Ren, Y.; Nam, H.; Santos, J.L.; Ng, S.; Gong, L.; Brummet, M.; Carrington, C.A.; Ullman, C.G.; et al. Scalable Purification of Plasmid DNA Nanoparticles by Tangential Flow Filtration for Systemic Delivery. ACS Appl. Mater. Interfaces 2021, 13, 30326–30336. [Google Scholar] [CrossRef]
- Murray, J.; Bergeron, H.C.; Jones, L.P.; Reener, Z.B.; Martin, D.E.; Sancilio, F.D.; Tripp, R.A. Probenecid Inhibits Respiratory Syncytial Virus (RSV) Replication. Viruses 2022, 14, 912. [Google Scholar] [CrossRef] [PubMed]
- Connors, M.; Collins, P.L.; Firestone, C.Y.; Sotnikov, A.V.; Waitze, A.; Davis, A.R.; Hung, P.P.; Chanock, R.M.; Murphy, B.R. Cotton rats previously immunized with a chimeric RSV FG glycoprotein develop enhanced pulmonary pathology when infected with RSV, a phenomenon not encountered following immunization with vaccinia—RSV recombinants or RSV. Vaccine 1992, 10, 475–484. [Google Scholar] [CrossRef] [PubMed]
- van Diepen, A.; Brand, H.K.; de Waal, L.; Bijl, M.; Jong, V.L.; Kuiken, T.; van Amerongen, G.; van den Ham, H.J.; Eijkemans, M.J.; Osterhaus, A.D.; et al. Host proteome correlates of vaccine-mediated enhanced disease in a mouse model of respiratory syncytial virus infection. J. Virol. 2015, 89, 5022–5031. [Google Scholar] [CrossRef] [Green Version]
- Schneider-Ohrum, K.; Cayatte, C.; Bennett, A.S.; Rajani, G.M.; McTamney, P.; Nacel, K.; Hostetler, L.; Cheng, L.; Ren, K.; O’Day, T.; et al. Immunization with Low Doses of Recombinant Postfusion or Prefusion Respiratory Syncytial Virus F Primes for Vaccine-Enhanced Disease in the Cotton Rat Model Independently of the Presence of a Th1-Biasing (GLA-SE) or Th2-Biasing (Alum) Adjuvant. J. Virol. 2017, 91, e02180-16. [Google Scholar] [CrossRef] [Green Version]
- Russell, M.S.; Creskey, M.; Muralidharan, A.; Li, C.; Gao, J.; Chen, W.; Larocque, L.; Lavoie, J.R.; Farnsworth, A.; Rosu-Myles, M.; et al. Unveiling Integrated Functional Pathways Leading to Enhanced Respiratory Disease Associated with Inactivated Respiratory Syncytial Viral Vaccine. Front. Immunol. 2019, 10, 597. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Walsh, E.E.; Falsey, A.R.; Scott, D.A.; Gurtman, A.; Zareba, A.M.; Jansen, K.U.; Gruber, W.C.; Dormitzer, P.R.; Swanson, K.A.; Radley, D.; et al. A Randomized Phase 1/2 Study of a Respiratory Syncytial Virus Prefusion F Vaccine. J. Infect. Dis. 2022, 225, 1357–1366. [Google Scholar] [CrossRef] [PubMed]
- Tripp, R.A.; Power, U.F.; Openshaw, P.J.M.; Kauvar, L.M. Respiratory Syncytial Virus: Targeting the G Protein Provides a New Approach for an Old Problem. J. Virol. 2018, 92, e01302-17. [Google Scholar] [CrossRef] [Green Version]
- Chirkova, T.; Lin, S.; Oomens, A.G.P.; Gaston, K.A.; Boyoglu-Barnum, S.; Meng, J.; Stobart, C.C.; Cotton, C.U.; Hartert, T.V.; Moore, M.L.; et al. CX3CR1 is an important surface molecule for respiratory syncytial virus infection in human airway epithelial cells. J. Gen. Virol. 2015, 96, 2543–2556. [Google Scholar] [CrossRef]
- Radu, G.U.; Caidi, H.; Miao, C.; Tripp, R.A.; Anderson, L.J.; Haynes, L.M. Prophylactic treatment with a G glycoprotein monoclonal antibody reduces pulmonary inflammation in respiratory syncytial virus (RSV)-challenged naive and formalin-inactivated RSV-immunized BALB/c mice. J. Virol. 2010, 84, 9632–9636. [Google Scholar] [CrossRef] [Green Version]
- Boyoglu-Barnum, S.; Gaston, K.A.; Todd, S.O.; Boyoglu, C.; Chirkova, T.; Barnum, T.R.; Jorquera, P.; Haynes, L.M.; Tripp, R.A.; Moore, M.L.; et al. A Respiratory Syncytial Virus (RSV) Anti-G Protein F(ab’)2 Monoclonal Antibody Suppresses Mucous Production and Breathing Effort in RSV rA2-line19F-Infected BALB/c Mice. J. Virol. 2013, 87, 10955–10967. [Google Scholar] [CrossRef] [Green Version]
- Cheon, I.S.; Shim, B.S.; Park, S.M.; Choi, Y.; Jang, J.E.; Jung, D.I.; Kim, J.O.; Chang, J.; Yun, C.H.; Song, M.K. Development of Safe and Effective RSV Vaccine by Modified CD4 Epitope in G Protein Core Fragment (Gcf). PLoS ONE 2014, 9, e94269. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Rainho-Tomko, J.N.; Pavot, V.; Kishko, M.; Swanson, K.; Edwards, D.; Yoon, H.; Lanza, L.; Alamares-Sapuay, J.; Osei-Bonsu, R.; Mundle, S.T.; et al. Immunogenicity and protective efficacy of RSV G central conserved domain vaccine with a prefusion nanoparticle. NPJ Vaccines 2022, 7, 74. [Google Scholar] [CrossRef] [PubMed]
- Kim, A.R.; Lee, D.H.; Lee, S.H.; Rubino, I.; Choi, H.J.; Quan, F.S. Protection induced by virus-like particle vaccine containing tandem repeat gene of respiratory syncytial virus G protein. PLoS ONE 2018, 13, e0191277. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Schmidt, M.E.; Varga, S.M. The CD8 T Cell Response to Respiratory Virus Infections. Front. Immunol. 2018, 9, 678. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Lee, S.; Stokes, K.L.; Currier, M.G.; Sakamoto, K.; Lukacs, N.W.; Celis, E.; Moore, M.L. Vaccine-Elicited CD8+ T Cells Protect against Respiratory Syncytial Virus Strain A2-Line19F-Induced Pathogenesis in BALB/c Mice. J. Virol. 2012, 86, 13016–13024. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Kinnear, E.; Lambert, L.; McDonald, J.U.; Cheeseman, H.M.; Caproni, L.J.; Tregoning, J.S. Airway T cells protect against RSV infection in the absence of antibody. Mucosal Immunol. 2018, 11, 249–256. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Lee, Y.T.; Ko, E.J.; Kim, K.H.; Hwang, H.S.; Lee, Y.; Kwon, Y.M.; Kim, M.C.; Lee, Y.N.; Jung, Y.J.; Kang, S.M. Cellular Immune Correlates Preventing Disease Against Respiratory Syncytial Virus by Vaccination with Virus-Like Nanoparticles Carrying Fusion Proteins. J. Biomed. Nanotechnol. 2017, 13, 84–98. [Google Scholar] [CrossRef] [Green Version]
- Blander, J.M.; Medzhitov, R. Regulation of phagosome maturation by signals from toll-like receptors. Science 2004, 304, 1014–1018. [Google Scholar] [CrossRef] [PubMed]
- Blander, J.M.; Medzhitov, R. On regulation of phagosome maturation and antigen presentation. Nat. Immunol. 2006, 7, 1029–1035. [Google Scholar] [CrossRef]
- Vissers, M.; Ahout, I.M.; de Jonge, M.I.; Ferwerda, G. Mucosal IgG Levels Correlate Better with Respiratory Syncytial Virus Load and Inflammation than Plasma IgG Levels. Clin. Vaccine Immunol. 2015, 23, 243–245. [Google Scholar] [CrossRef] [Green Version]
- Walsh, E.R.; Thakar, J.; Stokes, K.; Huang, F.; Albert, R.; August, A. Computational and experimental analysis reveals a requirement for eosinophil-derived IL-13 for the development of allergic airway responses in C57BL/6 mice. J. Immunol. 2011, 186, 2936–2949. [Google Scholar] [CrossRef] [Green Version]
- Pope, S.M.; Brandt, E.B.; Mishra, A.; Hogan, S.P.; Zimmermann, N.; Matthaei, K.I.; Foster, P.S.; Rothenberg, M.E. IL-13 induces eosinophil recruitment into the lung by an IL-5- and eotaxin-dependent mechanism. J. Allergy Clin. Immunol. 2001, 108, 594–601. [Google Scholar] [CrossRef]
- Rijavec, M.; Krumpestar, T.; Skrgat, S.; Kern, I.; Korosec, P. T2-high Asthma, Classified by Sputum mRNA Expression of IL4, IL5, and IL13, is Characterized by Eosinophilia and Severe Phenotype. Life 2021, 11, 92. [Google Scholar] [CrossRef] [PubMed]
- Elsner, J.; Hochstetter, R.; Kimmig, D.; Kapp, A. Human eotaxin represents a potent activator of the respiratory burst of human eosinophils. Eur J. Immunol. 1996, 26, 1919–1925. [Google Scholar] [CrossRef] [PubMed]
- Su, Y.C.; Townsend, D.; Herrero, L.J.; Zaid, A.; Rolph, M.S.; Gahan, M.E.; Nelson, M.A.; Rudd, P.A.; Matthaei, K.I.; Foster, P.S.; et al. Dual proinflammatory and antiviral properties of pulmonary eosinophils in respiratory syncytial virus vaccine-enhanced disease. J. Virol. 2015, 89, 1564–1578. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Yamashita, U.; Kuroda, E. Regulation of macrophage-derived chemokine (MDC, CCL22) production. Crit. Rev. Immunol. 2002, 22, 105–114. [Google Scholar] [CrossRef]
- Pinho, V.; Oliveira, S.H.; Souza, D.G.; Vasconcelos, D.; Alessandri, A.L.; Lukacs, N.W.; Teixeira, M.M. The role of CCL22 (MDC) for the recruitment of eosinophils during allergic pleurisy in mice. J. Leukoc. Biol. 2003, 73, 356–362. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Vestergaard, C.; Deleuran, M.; Gesser, B.; Larsen, C.G. Thymus- and activation-regulated chemokine (TARC/CCL17) induces a Th2-dominated inflammatory reaction on intradermal injection in mice. Exp. Dermatol. 2004, 13, 265–271. [Google Scholar] [CrossRef]
- Hieshima, K.; Imai, T.; Opdenakker, G.; Van Damme, J.; Kusuda, J.; Tei, H.; Sakaki, Y.; Takatsuki, K.; Miura, R.; Yoshie, O.; et al. Molecular cloning of a novel human CC chemokine liver and activation-regulated chemokine (LARC) expressed in liver. Chemotactic activity for lymphocytes and gene localization on chromosome 2. J. Biol. Chem. 1997, 272, 5846–5853. [Google Scholar] [CrossRef] [Green Version]
- Song, R.; Liu, S.; Leong, K.W. Effects of MIP-1 alpha, MIP-3 alpha, and MIP-3 beta on the induction of HIV Gag-specific immune response with DNA vaccines. Mol. Ther. 2007, 15, 1007–1015. [Google Scholar] [CrossRef]
- Shafique, M.; Meijerhof, T.; Wilschut, J.; de Haan, A. Evaluation of an intranasal virosomal vaccine against respiratory syncytial virus in mice: Effect of TLR2 and NOD2 ligands on induction of systemic and mucosal immune responses. PLoS ONE 2013, 8, e61287. [Google Scholar] [CrossRef] [Green Version]
- Boukhvalova, M.S.; Prince, G.A.; Soroush, L.; Harrigan, D.C.; Vogel, S.N.; Blanco, J.C. The TLR4 agonist, monophosphoryl lipid A, attenuates the cytokine storm associated with respiratory syncytial virus vaccine-enhanced disease. Vaccine 2006, 24, 5027–5035. [Google Scholar] [CrossRef]
- Cyr, S.L.; Jones, T.; Stoica-Popescu, I.; Burt, D.; Ward, B.J. C57Bl/6 mice are protected from respiratory syncytial virus (RSV) challenge and IL-5 associated pulmonary eosinophilic infiltrates following intranasal immunization with Protollin-eRSV vaccine. Vaccine 2007, 25, 3228–3232. [Google Scholar] [CrossRef]
- Kim, K.H.; Lee, Y.T.; Hwang, H.S.; Kwon, Y.M.; Kim, M.C.; Ko, E.J.; Lee, J.S.; Lee, Y.; Kang, S.M. Virus-Like Particle Vaccine Containing the F Protein of Respiratory Syncytial Virus Confers Protection without Pulmonary Disease by Modulating Specific Subsets of Dendritic Cells and Effector T Cells. J. Virol. 2015, 89, 11692–11705. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Matthews, S.P.; Tregoning, J.S.; Coyle, A.J.; Hussell, T.; Openshaw, P.J. Role of CCL11 in eosinophilic lung disease during respiratory syncytial virus infection. J. Virol. 2005, 79, 2050–2057. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Kim, D.M.; Seo, J.W.; Kim, Y.; Park, U.; Ha, N.Y.; Park, H.; Yun, N.R.; Kim, D.Y.; Yoon, S.H.; Na, Y.S.; et al. Eosinophil-mediated lung inflammation associated with elevated natural killer T cell response in COVID-19 patients. Korean J. Intern. Med. 2022, 37, 201–209. [Google Scholar] [CrossRef]
- Phipps, S.; Lam, C.E.; Mahalingam, S.; Newhouse, M.; Ramirez, R.; Rosenberg, H.F.; Foster, P.S.; Matthaei, K.I. Eosinophils contribute to innate antiviral immunity and promote clearance of respiratory syncytial virus. Blood 2007, 110, 1578–1586. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Castilow, E.M.; Legge, K.L.; Varga, S.M. Cutting edge: Eosinophils do not contribute to respiratory syncytial virus vaccine-enhanced disease. J. Immunol. 2008, 181, 6692–6696. [Google Scholar] [CrossRef] [PubMed]
- Ehrens, A.; Hoerauf, A.; Hübner, M.P. Eosinophils in filarial infections: Inducers of protection or pathology? Front. Immunol. 2022, 13, 983812. [Google Scholar] [CrossRef] [PubMed]
Epitope(s) | Sequence |
---|---|
GM2 | NFVPCSICSNNPTCWAICKRIPNKKPGKKTSGSESYIGSINNITKQSASVASGSK20 |
Pam3.GM2 | Pam3CSKKKKNFVPCSICSNNPTCWAICKRIPNKKPGKKTSGSESYIGSINNITKQSASVASGSK20 |
G169–198 | NFVPCSICSNNPTCWAICKRIPNKKPGKKT |
M281–95 | ESYIGSINNITKQSA |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Powell, T.J.; Jacobs, A.; Tang, J.; Cardenas, E.; Palath, N.; Daniels, J.; Boyd, J.G.; Bergeron, H.C.; Jorquera, P.A.; Tripp, R.A. Microparticle RSV Vaccines Presenting the G Protein CX3C Chemokine Motif in the Context of TLR Signaling Induce Protective Th1 Immune Responses and Prevent Pulmonary Eosinophilia Post-Challenge. Vaccines 2022, 10, 2078. https://doi.org/10.3390/vaccines10122078
Powell TJ, Jacobs A, Tang J, Cardenas E, Palath N, Daniels J, Boyd JG, Bergeron HC, Jorquera PA, Tripp RA. Microparticle RSV Vaccines Presenting the G Protein CX3C Chemokine Motif in the Context of TLR Signaling Induce Protective Th1 Immune Responses and Prevent Pulmonary Eosinophilia Post-Challenge. Vaccines. 2022; 10(12):2078. https://doi.org/10.3390/vaccines10122078
Chicago/Turabian StylePowell, Thomas J., Andrea Jacobs, Jie Tang, Edwin Cardenas, Naveen Palath, Jennifer Daniels, James G. Boyd, Harrison C. Bergeron, Patricia A. Jorquera, and Ralph A. Tripp. 2022. "Microparticle RSV Vaccines Presenting the G Protein CX3C Chemokine Motif in the Context of TLR Signaling Induce Protective Th1 Immune Responses and Prevent Pulmonary Eosinophilia Post-Challenge" Vaccines 10, no. 12: 2078. https://doi.org/10.3390/vaccines10122078