Chitin Synthases in Cordyceps militaris: Genome-Wide Gene Identification, Evolutionary Insights, and Life Cycle Transcript Profiling
Abstract
:1. Introduction
2. Materials and Methods
2.1. Strains, Media and Growth Conditions
2.2. Identification of CHS Genes from Cordyceps militaris
2.3. Phylogenetic Analysis of CHS Proteins in Cordyceps Sensu Lato
2.4. CHSs Protein Structure Analysis
2.5. Distribution of CHSs in Ascomycota and Basidiomycota Fungi with Different Life Styles
2.6. Conidia Germination Assays
2.7. Fungal Virulence Assays
2.8. Fruiting Body Production Assays
2.9. PCR Array and Data Analysis
3. Results
3.1. Identification of CHSs in Cordyceps militaris
3.2. Chromosome Distribution of CmCHS Family Genes
3.3. Phylogenetic Analysis of CHS Proteins of Cordyceps s.l.
3.4. Distribution of CHS Proteins in Basidiomycota and Ascomycota Fungi with Different Lifestyles
3.5. Transcript Analysis of CmChs Genes during Conidia Germination
3.6. Transcript Analysis of CmChs Genes during Infecting Antheraea pernyi
3.7. Transcript Analysis of CmChs Genes during Fruiting Body Development
4. Discussion
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Data Availability Statement
Conflicts of Interest
References
- Shrestha, B.; Zhang, W.; Zhang, Y.; Liu, X. The medicinal fungus Cordyceps militaris: Research and development. Mycol. Prog. 2012, 11, 599–614. [Google Scholar] [CrossRef]
- Guo, M.M.; Guo, S.P.; Yan, H.J.; Bu, N.; Dong, C.H. Comparison of major bioactive compounds of the caterpillar medicinal mushroom, Cordyceps militaris (Ascomycetes), fruiting bodies cultured on wheat substrate and pupae. Int. J. Med. Mushrooms 2016, 18, 327–336. [Google Scholar] [CrossRef] [PubMed]
- Liu, F.; Zhu, Z.; Sun, X.; Gao, H.; Zhang, Y. The preparation of three selenium-containing Cordyceps militaris polysaccharides: Characterization and anti-tumor activities. Int. J. Biol. Macromol. 2017, 99, 196–204. [Google Scholar] [CrossRef] [PubMed]
- Lee, H.H.; Park, H.; Sung, G.-H.; Lee, K.; Lee, T.; Lee, I.; Park, M.-S.; Jung, Y.W.; Shin, Y.S.; Kang, H.; et al. Anti-influenza effect of Cordyceps militaris through immunomodulation in a DBA/2 mouse model. J. Microbiol. 2014, 52, 696–701. [Google Scholar] [CrossRef] [PubMed]
- Summary of announcements by the Ministry of Health on new resource foods. Food Ferment. Ind. 2011, 37, 60. (In Chinese)
- Gow, N.A.R.; Latge, J.P.; Munro, C.A. The fungal cell wall: Structure, biosynthesis, and function. Microbiol. Spectr. 2017, 5, 10–1128. [Google Scholar] [CrossRef]
- Alcazar-Fuoli, L.; Bayry, J.; Aimanianda, V. Editorial: The role of the fungal cell wall in host-fungal interactions. Front. Cell. Infect. Microbiol. 2020, 10, 392. [Google Scholar] [CrossRef] [PubMed]
- Brown, H.E.; Esher, S.K.; Alspaugh, J.A. Chitin: A “hidden figure” in the fungal cell wall. Curr. Top. Microbiol. Immunol. 2020, 425, 83–111. [Google Scholar] [CrossRef] [PubMed]
- Merzendorfer, H. The cellular basis of chitin synthesis in fungi and insects: Common principles and differences. Eur. J. Cell Biol. 2011, 90, 759–769. [Google Scholar] [CrossRef]
- Li, M.; Jiang, C.; Wang, Q.; Zhao, Z.; Jin, Q.; Xu, J.R.; Liu, H. Evolution and functional insights of different ancestral orthologous clades of chitin synthase genes in the fungal tree of life. Front. Plant Sci. 2016, 7, 37. [Google Scholar] [CrossRef]
- Dorfmueller, H.C.; Ferenbach, A.T.; Borodkin, V.S.; van Aalten, D.M.F. A structural and biochemical model of processive chitin synthesis. J. Biol. Chem. 2014, 289, 23020–23028. [Google Scholar] [CrossRef] [PubMed]
- Lombard, V.; Golaconda, R.H.; Drula, E.; Coutinho, P.M.; Henrissat, B. The carbohydrate-active enzymes database (CAZy) in 2013. Nucleic Acids Res. 2014, 2, D490–D495. [Google Scholar] [CrossRef] [PubMed]
- Roncero, C.; Sánchez, Y. Cell separation and the maintenance of cell integrity during cytokinesis in yeast: The assembly of a septum. Yeast 2010, 27, 521–530. [Google Scholar] [CrossRef] [PubMed]
- Wang, Q.; Liu, H.; Szaniszlo, P.J. Compensatory expression of five chitin synthase genes, a response to stress stimuli, in Wangiella (Exophiala) dermatitidis, a melanized fungal pathogen of humans. Microbiol. 2002, 148, 2811–2817. [Google Scholar] [CrossRef]
- Zhang, J.; Jiang, H.; Du, Y.; Keyhani, N.O.; Xia, Y.; Jin, K. Members of chitin synthase family in Metarhizium acridum differentially affect fungal growth, stress tolerances, cell wall integrity and virulence. PLoS Pathog. 2019, 15, e1007964. [Google Scholar] [CrossRef] [PubMed]
- Roncero, C. The genetic complexity of chitin synthesis in fungi. Curr. Genet. 2002, 41, 367–378. [Google Scholar] [CrossRef]
- Liu, R.; Xu, C.; Zhang, Q.; Wang, S.; Fang, W. Evolution of the chitin synthase gene family correlates with fungal morphogenesis and adaption to ecological niches. Sci. Rep. 2017, 16, 44527. [Google Scholar] [CrossRef] [PubMed]
- Choquer, M.; Boccara, M.; Gonçalves, I.R.; Soulié, M.C.; Vidal-Cros, A. Survey of the Botrytis cinerea chitin synthase multigenic family through the analysis of six euascomycetes genomes. Eur. J. Biochem. 2004, 271, 2153–2164. [Google Scholar] [CrossRef]
- Mandel, M.A.; Galgiani, J.N.; Kroken, S.; Orbach, M.J. Coccidioides posadasii contains single chitin synthase genes corresponding to classes I to VII. Fungal Genet. Biol. 2006, 43, 775–788. [Google Scholar] [CrossRef]
- Ford, R.A.; Shaw, J.A.; Cabib, E. Yeast chitin synthases 1 and 2 consist of a non-homologous and dispensable N-terminal region and of a homologous moiety essential for function. Mol. Gen. Genet. 1996, 252, 420–428. [Google Scholar] [CrossRef]
- Klis, F.M.; Boorsma, A.; De Groot, P.W. Cell wall construction in Saccharomyces cerevisiae. Yeast 2006, 23, 185–202. [Google Scholar] [CrossRef] [PubMed]
- Schmidt, M.; Bowers, B.; Varma, A.; Roh, D.H.; Cabib, E. In budding yeast, contraction of the actomyosin ring and formation of the primary septum at cytokinesis depend on each other. J. Cell Sci. 2002, 115, 293–302. [Google Scholar] [CrossRef] [PubMed]
- Muszkieta, L.; Aimanianda, V.; Mellado, E.; Gribaldo, S.; Alcàzar-Fuoli, L.; Szewczyk, E.; Prevost, M.C.; Latgé, J.P. Deciphering the role of the chitin synthase families 1 and 2 in the in vivo and in vitro growth of Aspergillus fumigatus by multiple gene targeting deletion. Cell. Microbiol. 2014, 16, 1784–1805. [Google Scholar] [CrossRef] [PubMed]
- Latgé, J.P. The cell wall: A carbohydrate armour for the fungal cell. Mol. Microbiol. 2007, 66, 279–290. [Google Scholar] [CrossRef]
- Ji, Q.; Ge, Z.; Chen, K.; Wu, H.; Liu, X.; Huang, Y.; Yuan, L.; Yang, X.; Liao, F. Synthesis and biological evaluation of novel phosphoramidate derivatives of coumarin as chitin synthase inhibitors and antifungal agents. Eur. J. Med. Chem. 2016, 27, 166–176. [Google Scholar] [CrossRef] [PubMed]
- Lenardon, M.D.; Munro, C.A.; Gow, N.A. Chitin synthesis and fungal pathogenesis. Curr. Opin. Microbiol. 2010, 13, 416–423. [Google Scholar] [CrossRef] [PubMed]
- Chen, Y.; Tang, Y.Q.; Wang, H.R.; Liu, A.; Wang, Q.J.; Wang, W. Characterization and expression analysis of chitin synthase family in Flammulina filiformis. Microbiol. China 2024, 51, 612–625. (In Chinese) [Google Scholar] [CrossRef]
- Zheng, P.; Xia, Y.; Xiao, G.; Xiong, C.; Hu, X.; Zhang, S.; Zheng, H.; Huang, Y.; Zhou, Y.; Wang, S.; et al. Genome sequence of the insect pathogenic fungus Cordyceps militaris, a valued traditional Chinese medicine. Genome Biol. 2011, 12, R116. [Google Scholar] [CrossRef] [PubMed]
- Kramer, G.; Nodwell, J.R. Chromosome level assembly and secondary metabolite potential of the parasitic fungus Cordyceps militaris. BMC Genom. 2017, 18, 912. [Google Scholar] [CrossRef]
- Wei, L.; Zhu, Y.; Liu, R.; Zhang, A.; Zhu, M.; Xu, W.; Lin, A.; Lu, K.; Li, J. Genome wide identification and comparative analysis of glutathione transferases (GST) family genes in Brassica napus. Sci. Rep. 2019, 9, 9196. [Google Scholar] [CrossRef]
- Finn, R.D.; Clements, J.; Eddy, S.R. HMMER web server: Interactive sequence similarity searching. Nucleic Acids Res. 2011, 39, W29–W37. [Google Scholar] [CrossRef] [PubMed]
- Chen, C.; Chen, H.; Zhang, Y.; Thomas, H.R.; Frank, M.H.; He, Y.; Xia, R. TBtools: An integrative toolkit developed for interactive analyses of big biological data. Mol. Plant 2020, 13, 1194–1202. [Google Scholar] [CrossRef] [PubMed]
- Kuraku, S.; Zmasek, C.M.; Nishimura, O.; Katoh, K. aLeaves facilitates on-demand exploration of metazoan gene family trees on MAFFT sequence alignment server with enhanced interactivity. Nucleic Acids Res. 2013, 41, W22–W28. [Google Scholar] [CrossRef] [PubMed]
- Katoh, K.; Rozewicki, J.; Yamada, K.D. MAFFT online service: Multiple sequence alignment, interactive sequence choice and visualization. Brief. Bioinform. 2019, 20, 1160–1166. [Google Scholar] [CrossRef] [PubMed]
- Kumar, S.; Stecher, G.; Li, M.; Knyaz, C.; Tamura, K. MEGA X: Molecular evolutionary genetics analysis across computing platforms. Mol. Biol. Evol. 2018, 35, 1547–1549. [Google Scholar] [CrossRef]
- Li, X.; Wang, F.; Xu, Y.Y.; Dong, C.H. Cysteine-rich hydrophobin gene family: Genome wide analysis, phylogeny and putative function in Cordyceps militaris. Int. J. Mol. Sci. 2021, 22, 643. [Google Scholar] [CrossRef] [PubMed]
- Lian, T.T.; Yang, T.; Liu, G.J.; Sun, J.D.; Dong, C.H. Reliable reference gene selection for Cordyceps militaris gene expression studies under different developmental stages and media. FEMS Microbiol. Lett. 2014, 356, 97–104. [Google Scholar] [CrossRef] [PubMed]
- Qin, J.; Zhao, P.; Ye, Z.; Sun, L.; Hu, X.; Zhang, J. Chitin synthase genes are differentially required for growth, stress response, and virulence in Verticillium dahliae. J. Fungi 2022, 8, 681. [Google Scholar] [CrossRef] [PubMed]
- Kong, L.A.; Yang, J.; Li, G.T.; Qi, L.L.; Zhang, Y.J.; Wang, C.F.; Zhao, W.S.; Xu, J.R.; Peng, Y.L. Different chitin synthase genes are required for various developmental and plant infection processes in the rice blast fungus Magnaporthe oryzae. PLoS Pathog. 2012, 8, e1002526. [Google Scholar] [CrossRef]
- Xu, Y.B.; Li, H.P.; Zhang, J.B.; Song, B.; Chen, F.F.; Duan, X.J.; Xu, H.Q.; Liao, Y.C. Disruption of the chitin synthase gene CHS1 from Fusarium asiaticum results in an altered structure of cell walls and reduced virulence. Fungal Genet. Biol. 2010, 47, 205–215. [Google Scholar] [CrossRef]
- Kim, J.E.; Lee, H.J.; Lee, J.; Kim, K.W.; Yun, S.H.; Shim, W.B.; Lee, Y.W. Gibberella zeae chitin synthase genes, GzCHS5 and GzCHS7, are required for hyphal growth, perithecia formation, and pathogenicity. Curr. Genet. 2009, 55, 449–459. [Google Scholar] [CrossRef] [PubMed]
- Hassainia, A.; Satha, H.; Boufi, S. Chitin from Agaricus bisporus: Extraction and characterization. Int. J. Biol. Macromol. 2018, 117, 1334–1342. [Google Scholar] [CrossRef] [PubMed]
- Kang, Y.; Kim, H.; Choi, H.T. Biochemical characterization of chitinase 2 expressed during the autolytic phase of the inky cap, Coprinellus congregatus. J. Microbiol. 2013, 51, 189–193. [Google Scholar] [CrossRef] [PubMed]
- Zhang, Z.J.; Yin, Y.Y.; Cui, Y.; Zhang, Y.X.; Liu, B.Y.; Ma, Y.C.; Liu, Y.N.; Liu, G.Q. Chitinase is involved in the fruiting body development of medicinal fungus Cordyceps militaris. Life 2023, 13, 764. [Google Scholar] [CrossRef]
- López-Matas, M.A.; Eslava, A.P.; Díaz-Mínguez, J.M. Mcchs1, a member of a chitin synthase gene family in Mucor circinelloides, is differentially expressed during dimorphism. Curr. Microbiol. 2000, 40, 169–175. [Google Scholar] [CrossRef]
Name | Protein ID 1 | Feature Domains | Subcellular Localization | Number of Transmembrane Structures |
---|---|---|---|---|
CmCHS1 | CCM_00447/A9K55_001663 | Chitin synthase 1 | Plasma membrane | 7 |
Chitin synthase N | ||||
Chitin synthase C | ||||
Chitin synthase 2 | ||||
CmCHS2 | CCM_01980/A9K55_006911 | Chitin synthase 1 | Plasma membrane | 7 |
Chitin synthase N | ||||
Chitin synthase C | ||||
Chitin synthase 2 | ||||
CmCHS3 | CCM_02953/A9K55_006003 | Chitin synthase 2 | Plasma membrane | 4 |
CmCHS4 | CCM_02965/A9K55_005992 | Chitin synthase C | Plasma membrane | 6 |
Cyt-b5-PF00173 | ||||
MYSc_Myo17-cd14879 | ||||
Chitin synthase 2 | ||||
CmCHS5 | CCM_02966/A9K55_005991 | Chitin synthase C | Plasma membrane | 6 |
Cyt-b5-PF00173 | ||||
MYSc_Myo17-cd14879 | ||||
Chitin synthase 2 | ||||
CmCHS6 | CCM_06973/A9K55_007939 | Chitin synthase 2 | Plasma membrane | 4 |
Chitin synthase C | ||||
CmCHS7 | CCM_08096/A9K55_005325 | Chitin synthase 2 | Plasma membrane | 5 |
CmCHS8 | CCM_08511/A9K55_002055 | Chitin synthase 1N | Plasma membrane | 10 |
Chitin synthase C | ||||
Chitin synthase 1 | ||||
Chitin synthase 2 |
Motif | Length (aa) | Amino Acid Conserved Sequence | Motif Function |
---|---|---|---|
1 | 41 | PJTAIQNFEYKISNILDKPFESVFGSVTCLPGAFSMYRIRA | Chitin_synth_2 |
2 | 20 | TDVPDTWKVLLSQRRRWNGT | Chitin_synth_2 |
3 | 29 | YLLLLPTYNFVLPVYAFWNTDDFSWGTTR | Chitin_synth_2 |
4 | 41 | RPLNYEICLLVDADTKVGPBSLYHLVSAFDNDPKJGGACGE | Chitin_synth_2 |
5 | 50 | SEQEKAKPGNRGKRDSQIJLMSFLNRVHFDERMTPLELEMFHQIWNIIGV | Chitin_synth_2 |
6 | 41 | VHNLMELILVRDLCGFCCFSMRFVVFIDLLGTIVLPATIAY | Chitin_synth_2 |
7 | 41 | HTELFIVITMYNEDEVLFARTMHGVMRNIRHICNRKKSKTW | Chitin_synth_1 |
8 | 28 | VPVQMJFCLKEKNQKKINSHRWFFNAFG | Chitin_synth_1 |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Li, S.; Ren, H.; Zhang, J.; Gao, S.; Chen, Z.; Li, G.; Tian, J.; Wang, J.; Li, M.; Li, X.; et al. Chitin Synthases in Cordyceps militaris: Genome-Wide Gene Identification, Evolutionary Insights, and Life Cycle Transcript Profiling. Horticulturae 2024, 10, 494. https://doi.org/10.3390/horticulturae10050494
Li S, Ren H, Zhang J, Gao S, Chen Z, Li G, Tian J, Wang J, Li M, Li X, et al. Chitin Synthases in Cordyceps militaris: Genome-Wide Gene Identification, Evolutionary Insights, and Life Cycle Transcript Profiling. Horticulturae. 2024; 10(5):494. https://doi.org/10.3390/horticulturae10050494
Chicago/Turabian StyleLi, Shoumian, Huihui Ren, Jie Zhang, Shangpai Gao, Zixuan Chen, Guojie Li, Jinghua Tian, Junling Wang, Ming Li, Xiao Li, and et al. 2024. "Chitin Synthases in Cordyceps militaris: Genome-Wide Gene Identification, Evolutionary Insights, and Life Cycle Transcript Profiling" Horticulturae 10, no. 5: 494. https://doi.org/10.3390/horticulturae10050494