Next Article in Journal
Development and Control of Biofilms in Diabetic Foot Infections: A Narrative Review
Previous Article in Journal
The Trend of Long Pentraxin 3 and Other Inflammatory Serum Markers in the 30 Days After Total Hip Arthroplasty
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Taxonomic Identification, Complete Genome Sequencing, and In Silico Genome Mining of the Actinobacterium Lentzea sp. JNUCC 0626 Isolated from Jeju Gotjawal

1
Department of Biotechnology, College of Applied Life Science, Jeju National University, Jeju 63243, Republic of Korea
2
Department of Chemistry and Cosmetics, Jeju Inside Agency and Cosmetic Science Center, Jeju National University, Jeju 63243, Republic of Korea
*
Author to whom correspondence should be addressed.
Acta Microbiol. Hell. 2025, 70(1), 8; https://doi.org/10.3390/amh70010008
Submission received: 25 December 2024 / Revised: 28 January 2025 / Accepted: 4 February 2025 / Published: 7 February 2025

Abstract

:
In our previous study, Lentzea sp. JNUCC 0626 was isolated from Hwasun Gotjawal on Jeju Island, and its melanogenic effects were confirmed in B16F10 melanoma cells through the identification of 1-acetyl-β-carboline. In this study, we conducted a comprehensive taxonomic characterization of Lentzea sp. JNUCC 0626, including enzymatic activities, carbohydrate metabolism, growth conditions, and cellular composition. Major fatty acids identified were iso-C16:0, iso-C15:0, and C15:0 anteiso, with polar lipids such as diphosphatidylglycerol, phosphatidylethanolamine, and several unidentified lipids. Ubiquinone Q-9 was determined as the predominant respiratory quinone. Enzymatic activity analysis (API ZYM) showed alkaline phosphatase, esterase (C4), esterase lipase (C8), and leucine arylamidase activities, while carbohydrate metabolism analysis (API 50CHB) indicated acid production from esculin alone. Complete genome sequencing revealed a 10,602,950 bp linear chromosome and a 177,940 bp plasmid. This plasmid encodes essential plasmid-related genes, including a Type IV secretion system and ParA proteins critical for plasmid transfer and stability. These findings suggest that the plasmid in Lentzea sp. JNUCC 0626 could be utilized for developing host–vector systems to facilitate the combinatorial biosynthesis of novel bioactive compounds. Comparative genomic analysis identified Lentzea pudingi CGMCC 4.7319 as the closest relative, but significant genetic divergence (dDDH 46.7%, ANI 88.02%) strongly supports the classification of Lentzea sp. JNUCC 0626 as a novel species. AntiSMASH analysis revealed 34 biosynthetic gene clusters (BGCs), highlighting the strain’s capacity to produce diverse bioactive compounds. Finally, the JNUCC 0626 extract exhibited concentration-dependent NO inhibition in LPS-stimulated RAW 264.7 cells, demonstrating significant anti-inflammatory activity. This suggests that the secondary metabolites inferred from genomic analysis may contribute to these observed bioactivities.

1. Introduction

Microorganisms, particularly actinomycetes, have long been regarded as one of the most valuable sources of pharmacologically important secondary metabolites, including antiviral, antibacterial, antifungal, and antiparasitic agents; chemotherapeutics; immunomodulators; and cardiovascular drugs. The extraction of these significant metabolites has traditionally been achieved through the cultivation of filtrates, yet it has become evident that many compounds remain undiscovered and unexplored [1,2]. The chemical diversity found in actinomycetes includes a wide range of prominent chemical classes, such as polyketides (PKs), nonribosomal peptides (NRPs), hybrid PK/NRPs, terpenes, and ribosomally synthesized and post-translationally modified peptides (RiPPs) [3,4,5,6]. These chemically diverse natural products are produced within highly conserved genetic regions known as biosynthetic gene clusters (BGCs).
For decades, natural product discovery has relied primarily on bioactivity-guided isolation approaches. While this method, which uses bioactivity as the main indicator, has demonstrated high success rates, it also comes with several challenges. The isolation of active compounds from complex mixtures is often time-consuming, and non-targeted approaches frequently lead to the rediscovery of known compounds. Therefore, establishing more efficient protocols to reduce the rates of rediscovery and re-isolation during the early stages of drug development from actinomycetes has become a pressing concern [7,8,9].
Research into “rare actinomycetes” has emerged as a promising approach for uncovering novel drug candidates in nature. The Lentzea genus is a group of rare actinomycetes with significant potential for the exploration of bioactive compounds. Despite their demonstrated capacity to produce medically relevant compounds, the genomic analysis of Lentzea remains underexplored [10,11,12]. To date, 58 genomes have been reported in the NCBI genome database. Among these, Lentzea sp. HUAS12 (CP099738.1), Lentzea sp. NBC_00516 (CP107840.1), Lentzea sp. DG1S-22 (CP143276.1), and Lentzea guizhouensis DHS C013 (CP016793.1) are the only genomes represented by a single complete contig, while the remaining genomes are draft sequences, some consisting of over 30 contigs, with one even composed of 2241 contigs.
The 2020s have ushered in an era of biological revolution driven by advancements in “omics” technologies. The convergence of these biological and technological developments has dramatically reduced the cost of DNA sequencing, and unprecedented access to genomic data has made genome mining an indispensable tool in the field of natural product discovery, sparking a renaissance in this area [13,14,15]. Genome mining is a technique that analyzes the genomes of actinomycetes to identify biosynthetic gene clusters (BGCs), which enables the prediction of potential natural products that microorganisms can produce. Recent advancements in sequencing technologies, particularly long-read sequencing, have significantly improved the accuracy of genomic analysis in actinomycetes. This has allowed for the discovery of previously hidden BGCs and the efficient exploration of bioactive compounds from actinomycetes [16,17]. Although chemical structures exhibit remarkable diversity, nature often employs a few mechanisms to generate the same chemical building blocks. By utilizing the genetic signatures of enzymes, researchers can identify new biosynthetic pathways. Once the genetic basis for the production of a molecule is identified, further discoveries become possible. Today, researchers are proficient in analyzing genome sequences to predict whether they BGCs and subsequently target those BGCs for the isolation of related compounds [18,19,20].
The word “Gotjawal” originates from two Korean terms: “Got”, which means forest, and “Jawal”, which refers to thick, bushy vegetation. It denotes a distinctive forest ecosystem found on Jeju Island, where dense, vibrant vegetation thrives on volcanic lava fields. This area, shaped by volcanic eruptions, is home to an extraordinary array of biodiversity, including several types of actinomycetes [21,22]. These microorganisms flourish in Gotjawal’s porous, nutrient-dense volcanic soils, playing a pivotal role in nutrient cycling and the breakdown of organic materials. The vast variety of actinomycetes in this region are noted for their capacity to generate bioactive compounds, which positions them as valuable candidates for industrial research [23,24,25]. As a result, the investigation and isolation of actinomycetes from Gotjawal are crucial for discovering novel bioactive substances that may have applications in both industrial and pharmaceutical sectors, underscoring the importance of microbial research in this unique ecosystem [26].
In a previous study, we successfully isolated Lentzea sp. JNUCC 0626 from Hwasun Gotjawal on Jeju Island, identified 1-acetyl-β-carboline, and confirmed its melanogenic effects in B16F10 melanoma cells [27]. In this study, we provided taxonomic insights into the newly isolated strain Lentzea JNUCC 0626 from the Gotjawal soil in Hwasun, Jeju Island, through its physiological, biochemical, and chemotaxonomic characterization. Additionally, we conducted an in-depth analysis of 34 BGCs predicted by antiSMASH from the whole-genome sequencing of the rare actinomycete Lentzea JNUCC 0626. This analysis aims to uncover the potential of previously undiscovered compounds and establish a foundation for cost-effective and efficient drug development.

2. Materials and Methods

2.1. Media and Chemicals

The bacterial media used in this study included actinomycete isolation agar (AIA), Bennett’s agar, ISP2, ISP4, ISP5, and tryptic soy broth (TSB). The AIA contained sodium caseinate (0.2%), asparagine (0.01%), sodium propionate (0.4%), dipotassium phosphate (0.05%), magnesium sulfate (0.01%), ferrous sulfate (0.0001%), and 1.5% agar. Bennett’s agar was composed of yeast extract (0.1%), N-Z amine type A (0.2%), glucose (1%), beef extract (0.1%), and 1.5% agar. The ISP2 (yeast–malt extract agar), ISP4 (inorganic salt starch casein agar), ISP5 (glycerol asparagine agar), and TSB were purchased from BD Biosciences (Franklin Lakes, NJ, USA).
For the cell culture, Dulbecco’s modified Eagle’s medium (DMEM) and 1% penicillin/streptomycin were used, sourced from Thermo Fisher Scientific (Waltham, MA, USA). Fetal bovine serum (FBS) was obtained from Sytiva (Marlborough, MA, USA). Lipopolysaccharides (LPS) from Escherichia coli O111 were purchased from Sigma-Aldrich (St. Louis, MO, USA). For the cell viability assays, 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) and dimethylsulfoxide (DMSO) were obtained from Biosesang (Seongnam, Gyeonggi-do, Republic of Korea). The Griess reagent for measuring NO production was obtained from Enzo Life Sciences (Farmingdale, NY, USA).

2.2. Taxonomic Characterization of Lentzea sp. JNUCC 0626

The actinobacterium Lentzea sp. JNUCC 0626 utilized in this study was originally isolated from Hwasun Gotjawal, located on Jeju Island (33°15′52.6″ N, 126°19′56.4″ E), Republic of Korea, using ISP5 medium. The growth of the strain was observed on various media, including ISP2, ISP4, ISP5, AIA, and Bennett’s agar plates. The strain was routinely subcultured in TSB at 28 °C and preserved in a 20% (v/v) glycerol suspension at −70 °C for long-term storage.
The morphological and physiological characteristics of Lentzea sp. JNUCC 0626 were primarily investigated on TSB medium, unless otherwise specified. The temperature range for growth was determined by incubating the strain in TSB at temperatures ranging from 4 °C to 50 °C. Salt tolerance was tested by growing the cells in modified TSB medium containing various NaCl concentrations (0–10.0%, w/v) at 1.0% increments. Additionally, the pH range for growth was assessed by incubating the cells at 28 °C in TSB at pH levels ranging from 4 to 10 (with increments of one pH unit). The pH conditions were adjusted using the following buffer systems: pH 4.0–5.0, 0.1 M citric acid/0.1 M sodium citrate; pH 6.0–8.0, 0.1 M KH2PO4/0.1 M NaOH; and pH 9.0–10.0, 0.1 M NaHCO3/0.1 M Na2CO3 [28].
To evaluate the biochemical characteristics, the ability of Lentzea sp. JNUCC 0626 to produce acids from various carbon sources was assessed using the API 50CH system (bioMérieux, Marcy-l’Étoile, France), and enzymatic activity was further tested using API ZYM strips (bioMérieux), following the manufacturer’s instructions. Respiratory quinones were extracted and purified from lyophilized cells and analyzed via HPLC, as described by Hu et al. [29]. Polar lipids were examined using two-dimensional thin-layer chromatography (TLC) according to the procedure outlined by Minnikin et al. [30]. Cellular fatty acids from logarithmically growing cells were analyzed using the Microbial Identification System following standard procedures (Sherlock Version 6.3; MIDI database: TSBA6).

2.3. Fermentation and Sample Preparation for Anti-Inflammatory Assays

Following previous methodologies, hexane and ethyl acetate extracts were prepared to evaluate their anti-inflammatory efficacy. The strain Lentzea sp. JNUCC 0626 was cultivated in liquid TSB medium at 28 °C with shaking at 200 rpm for 7 days. For large-scale fermentation, 1% of the seed culture was inoculated into 20 flasks, each containing 500 mL of TSB medium supplemented with 0.5% tryptophan. The cultures were incubated under the same conditions for an additional 7 days. After completing the 10 L fermentation, the fermentation broth was subjected to centrifugation at 4000 rpm for 20 min to separate the mycelia from the supernatant. The supernatant was then filtered and sequentially extracted with hexane and ethyl acetate. This extraction process was repeated twice to maximize the yield of the proper extracts. The solvent from each extract was removed using a vacuum evaporator, and the extraction yields were calculated based on wet weight. The yields of the hexane and ethyl acetate extracts were 0.19% and 3.8%, respectively.

2.4. Cell Culture, Cell Viability, and Anti-Inflammatory Efficacy

We assessed the anti-inflammatory potential of JNUCC 0626 by determining its ability to inhibit nitric oxide (NO) production in RAW 264.7 murine macrophage cells. RAW 264.7 cells are widely utilized in in vitro models for inflammation research, specifically for studying immune responses and testing anti-inflammatory treatments. NO is recognized as a key mediator in the inflammatory process, being produced in macrophages by inducible nitric oxide synthase (iNOS) in response to stimuli such as lipopolysaccharide (LPS). Inhibiting NO production helps assess whether a treatment or compound can reduce the inflammatory activation of these immune cells.
The RAW 264.7 murine macrophage cells were purchased from the Korean Cell Line Bank (KCLB, Seoul, Republic of Korea) and cultured in Dulbecco’s modified Eagle’s medium (DMEM) supplemented with 10% fetal bovine serum (FBS) and 1% penicillin/streptomycin. The cells were maintained in a humidified incubator with 5% CO2 at 37 °C. To assess cell cytotoxicity, an MTT assay was performed. The RAW 264.7 cells were seeded at a density of 1.5 × 105 cells/well in 24-well plates and allowed to adhere overnight. The cells were then treated with various concentrations of JNUCC 0626 extracts and lipopolysaccharide (LPS, 1 µg/mL) for 24 h. After treatment, 0.2 mg/mL of MTT reagent was added to each well, and the cells were incubated for an additional 4 h. The medium was then removed, and the resulting purple formazan crystals were dissolved in 800 μL of DMSO per well. Absorbance was measured at 570 nm using a microplate spectrophotometer (Epoch, BioTek, Santa Clara, CA, USA).
NO production was assessed using the Griess assay. The cells were seeded at a density of 1.5 × 105 cells/well in 24-well plates and allowed to adhere overnight. They were then treated with various concentrations of JNUCC 0626 extracts and LPS (1 µg/mL) for 24 h. Cell culture supernatants were mixed with an equal volume of Griess reagent (100 µL) in a 96-well plate and incubated at room temperature for 10 min. Absorbance was measured at 540 nm using a microplate spectrophotometer (Epoch, BioTek, CA, USA). The nitrite levels measured in the supernatant served as an indicator of NO production.

2.5. Genome De Novo Sequencing, Assembly, and Annotation

The whole genome sequencing of Lentzea sp. JNUCC 0626 was outsourced to LabGenomics Co., Ltd. (Seongnam, Gyeonggi-do, Republic of Korea) and performed using the PacBio Sequel II (Pacific Biosciences) platform. A total of 15 μg of high-quality DNA was sheared into fragments larger than 15 kb, purified, and subjected to DNA damage repair and end repair processes, after which an Overhang Adapter was ligated. The DNA fragments of 9–13 kb and those larger than 15 kb were separated using the BluePippin system to construct the library, which was then sequenced on the Sequel II platform using the SMRT cell 8M.
The raw sequencing data generated were assembled de novo using Flye (v2.8.3), with improvements made using HGAP4 or NextDenovo (v2.4.0) as necessary. The linear or circular nature of the assembled genome was determined using Circlator (v1.5.5). Gene prediction and annotation were performed using NCBI PGAP and the RefSeq database. Functional classification and annotation were completed by referencing HMM libraries, including TIGRFAM, Pfam, and PRK HMMs [31,32,33].

2.6. Comparative Genomic Studies and Genome Mining of the Lentzea sp. JNUCC 0626

To assess the genomic similarity between Lentzea sp. JNUCC 0626 and its closely related species, digital DNA-DNA hybridization (dDDH) values were calculated using the Genome-to-Genome Distance Calculator (GGDC 4.0) available within the Type (Strain) Genome Server (TYGS) provided by the Leibniz Institute DSMZ [34]. Additionally, average nucleotide identity (ANI) values between Lentzea sp. JNUCC 0626 and its nearest phylogenetic neighbors were computed using the ANI calculator provided by EzBioCloud, an online tool for prokaryotic genome sequence comparisons [19].
For genome mining and the discovery of biosynthetic gene clusters (BGCs) responsible for the production of secondary metabolites, including pacidamycin, trioxacarcin, BE-54017, and benzastatin, several computational tools were employed. The identification and comparative analysis of the BGCs were carried out using Known ClusterBlast, ClusterBlast, SubClusterBlast, ActiveSiteFinder, and Cluster PFam analysis. AntiSMASH 7.0 was utilized to predict and annotate secondary metabolite BGCs across the entire genome [35]. The PRISM 4 (v4.4.5) and BAGEL 4 tools were employed to further analyze the BGCs, focusing on RiPPs (ribosomally synthesized and post-translationally modified peptides) and bacteriocins, with BAGEL 4 being specifically used for bacteriocin mining [36,37,38]. These programs operated with default settings to ensure consistency and accuracy in the analysis. The combination of these genome mining tools enabled a comprehensive analysis of the secondary metabolite biosynthesis potential encoded within the genome of Lentzea sp. JNUCC 0626. This approach provided detailed predictions regarding the chemical structures and biological activities of the identified secondary metabolites, facilitating a deeper understanding of the strain’s metabolic capabilities.

2.7. Statistical Analysis

Statistical analysis was conducted using IBM SPSS (v.20, SPSS Inc., Armonk, NY, USA). To assess the differences between experimental groups, either Student’s t-test or a one-way analysis of variance (ANOVA) was applied. The data are expressed as the mean ± standard deviation (SD), derived from a minimum of three independent experiments or a single experiment conducted in triplicate. Statistical significance is indicated as # p < 0.001 in comparison to the untreated control group, and *** p < 0.001 when compared to the positive control group.

3. Results and Discussion

3.1. Taxonomic Characterization of Lentzea sp. JNUCC 0626

Strain JNUCC 0626 exhibited robust growth on ISP2, ISP4, ISP5, and AIA plates. The aerial mycelium of JNUCC 0626 was smooth and powdery, and predominantly white on these media (Figure 1). The substrate mycelium exhibited a yellow coloration. Strain JNUCC 0626 was capable of growing in tryptic soy broth (TSB) at temperatures between 15 °C and 35 °C, at pH values ranging from 4.0 to 10.0, and in the presence of 0–4.0% (w/v) NaCl. Optimal growth occurred on tryptic soy agar (TSA) at 25–30 °C, at pH 7.0, and in the presence of 0.5–1.0% (w/v) NaCl. In contrast, the aerial and substrate mycelia of the closest relatives, Lentzea cavernae KCTC 39804 and Lentzea pudingi KCTC 39694, exhibited differences in coloration compared to JNUCC 0626 (Table S1).
The major fatty acids (>15%) of strain JNUCC 0626 were iso-C16:0 (19.6%), iso-C15:0 (18.8%), and C15:0 anteiso (17.4%). The detailed fatty acid profiles of the strains are presented in Table S2. The polar lipids of strain JNUCC 0626 were composed of diphosphatidylglycerol (DPG), phosphatidylethanolamine (PE), unidentified phospholipid (UPL), unidentified lipid (UL), and unidentified aminophospholipid (UAPL) (Figure S1). Strain JNUCC 0626 contained ubiquinone Q-9 as a predominant respiratory quinone, as observed in other Lentzea species. Strain JNUCC 0626 exhibited enzymatic activities for alkaline phosphatase, esterase (C4), esterase lipase (C8), leucine arylamidase, naphtol-AS-BI-phosphohydrolase, N-acetyl-β-glucosaminidase, and α-mannosidase, as determined using the API ZYM system. In terms of carbohydrate metabolism, cells are only capable of producing acid from esculin, as assessed by the API 50CHB system. However, no acid production is observed from glycerol, erythritol, D-arabinose, L-arabinose, ribose, D-xylose, L-xylose, adonitol, β-methyl-xyloside, galactose, D-glucose, D-fructose, D-mannose, L-sorbose, rhamnose, dulcitol, inositol, mannitol, sorbitol, α-methyl-D-mannoside, α-methyl-D-glucoside, N-acetyl-glucosamine, amygdaline, arbutin, salicine, cellobiose, maltose, lactose, melibiose, saccharose trehalose, inuline, melezitose, D-raffinose, amidon, glycogen, xylitol, β-gentiobiose, D-turanose, D-lyxose, D-tagatose, D-fucose, L-fucose, D-arabitol, L-arabitol, gluconate, 2-ceto-gluconate, or 5-ceto-gluconate (Table S3).
In our previous study, the 16S ribosomal RNA sequence of Lentzea sp. JNUCC 0626 was analyzed using MEGA 11 software. The results indicated that L. cavernae SYSU K10001 and L. pudingi CGMCC 4.7319 are the closest phylogenetic neighbors of Lentzea sp. JNUCC 0626. The major fatty acids of L. cavernae SYSU K10001 are iso-C16:0 (32.9%) and iso-C14:0 (17.3%), while L. pudingi CGMCC 4.7319 predominantly contains iso-C16:0 (35.5%) and C16:1 (19.5%). Both species share a similar polar lipid profile, comprising DPG, PE, UPL, hydroxyphosphatidylethanolamine (HPE), phosphatidylinositol (PI), and phosphatidylinositol mannoside (PIM).

3.2. Sequencing, Assembly, and Genomic Characteristics

The genome of Lentzea sp. JNUCC 0626 was successfully sequenced using the PacBio Sequel II platform, resulting in an assembled genome of 10.78 Mb. This included a single linear chromosome with a length of 10,602,950 bp (Contig 01) and a plasmid measuring 177,940 bp (Contig 02), with no assembly gaps (Figure 2). The PacBio sequencing provided further insight, revealing that 165,349 subreads were obtained, with a mean subread length of 9791 bp and an N50 value of 12,162 bp. These metrics demonstrate the high quality and length of the sequencing reads. The overall genome coverage was calculated to be 150.17×, and the DNA G + C content was measured at 69.02% for the chromosome and 70.12% for the plasmid. The GenBank accession numbers for the genome are to be specified. The genomic analysis of Lentzea sp. JNUCC 0626 revealed that the chromosome contains 9761 protein-coding sequences (CDSs), along with 15 rRNAs and 87 tRNAs. In contrast, the plasmid consists of 197 CDSs and 2 tRNAs. These findings highlight the genetic composition of both the chromosomal and plasmid components, providing valuable insights for further functional and comparative genomic studies. The gene ontology (GO) annotation for Lentzea sp. JNUCC 0626 was performed to categorize its protein-coding sequences (CDSs). GO terms link gene products to three main categories: Biological Process (BP), Molecular Function (MF), and Cellular Component (CP). In the Biological Process category, 2449 CDSs were associated with metabolic processes, and 2356 were linked to cellular processes. For Molecular Function, 2772 CDSs exhibited catalytic activity, and 2211 CDSs were involved in binding activities. In the Cellular Component category, 1813 CDSs were related to cellular anatomical entities. These annotations help in understanding the functional roles of genes in the context of the organism’s biology (Table S4).

3.3. Characterization of Lentzea sp. JNUCC 0626 as a Novel Strain via dDDH Analysis

In this study, we applied digital DNA-DNA hybridization (dDDH), an in silico method for assessing genomic similarity between organisms, to investigate whether Lentzea sp. JNUCC 0626 represents a novel species. dDDH provides a reliable and reproducible alternative to traditional DDH, enabling the precise evaluation of genome-wide similarity. This method allows for automated calculations based on genome sequence data, making it a key tool in modern microbial taxonomy.
The dDDH values are computed based on three primary formulas, each providing a different perspective on genomic similarity. The first formula, D0 (Genome-to-Genome Distance), evaluates the overall gene content between genomes, giving a comprehensive view of their genetic relatedness. The second formula, D4 (High-Scoring Segment Pairs), specifically measures the similarity of conserved core gene sequences, focusing on essential genes shared by the organisms. Lastly, D6 (Gene Family Content) examines the similarity in gene family structures, comparing the presence of shared gene families across the genomes. Together, these formulas offer a detailed assessment of genomic similarity, each contributing a unique aspect to the overall comparison. Typically, dDDH values of ≥70% are considered indicative of the same species, whereas dDDH values below 70% suggest different species. Values below 60% strongly indicate a novel species, as such low similarity is uncommon within the same species [39].
To determine the taxonomic position of Lentzea sp. JNUCC 0626, we performed dDDH analysis using the TYGS (Type Strain Genome Server), comparing the genome of JNUCC 0626 with the genomes of the 13 most closely related strains (Table S5). Among these, the closest strain identified was L. pudingi CGMCC 4.7319. The dDDH values between Lentzea sp. JNUCC 0626 and L. pudingi CGMCC 4.7319 were as follows: dDDH (D0) = 46.7%, dDDH (D4) = 34.7%, and dDDH (D6) = 43.4%. Additionally, the confidence intervals (95% CI) were calculated as 43.4–50.2% for D0, 32.3–37.2% for D4, and 40.5–46.5% for D6.
These results demonstrate that the dDDH values between Lentzea sp. JNUCC 0626 and L. pudingi CGMCC 4.7319 fall significantly below the 70% threshold typically used to define species boundaries. As all three formulas yielded values well below this threshold, we conclude that Lentzea sp. JNUCC 0626 represents a novel species. The substantial genomic divergence from L. pudingi CGMCC 4.7319 further supports this conclusion.

3.4. Characterization of Lentzea sp. JNUCC 0626 as a Novel Strain via ANI Analysis

The average nucleotide identity (ANI) is a widely accepted metric for evaluating the genomic relatedness of microorganisms. By comparing the average sequence identity of shared genomic regions, ANI is effective in assessing whether two strains belong to the same species. Typically, ANI calculations involve aligning homologous sequences between genomes and measuring the sequence similarity. The commonly accepted threshold for species delineation is 95–96%, with values below this range suggesting that the organisms represent different species [39].
In this study, we calculated the ANI values for 13 closely related species within the Lentzea genus (Table S6). Using the OrthoANIu algorithm on the EZBioCloud platform, we evaluated the genomic similarity between Lentzea sp. JNUCC 0626 and its closest relative, L. pudingi CGMCC 4.7319. The resulting ANI value was 88.02%, which is significantly below the species boundary threshold, indicating considerable genetic divergence. This result strongly suggests that Lentzea sp. JNUCC 0626 represents a distinct species within the Lentzea genus. The genetic difference between the two strains underscores the novelty of Lentzea sp. JNUCC 0626 and supports its classification as a previously undescribed species. Additional phenotypic, biochemical, and ecological studies will be necessary to further validate this classification and provide a comprehensive characterization of this strain.

3.5. Analysis of Plasmid Presence and Antibiotic Resistance Genes

The genome of Lentzea sp. JNUCC 0626 contains a second circular contig measuring 177,940 bp with a GC content of 70.12%, harboring 197 predicted proteins (Figure 2b). This study aims to investigate the potential presence of plasmids or bacteriophages in L. jejuensis. In microbial genome analysis, differentiating between plasmids and bacteriophages is achieved by identifying specific genes unique to each entity. Although both plasmids and phages are classified as mobile genetic elements, they can be distinguished by their distinct protein expression profiles.
The genomic analysis of Lentzea sp. JNUCC 0626 revealed essential genes for plasmid functionality within the second circular DNA contig. These genes encode homologous proteins critical for plasmid transfer, including a Type IV secretory system conjugative DNA transfer protein from Alloactinosynnema sp. L-07 (XIJ19586.1; identity 81%), a Type IV secretion system protein from Amycolatopsis saalfeldensis (XIJ19590.1; identity 60%), and a ParA family protein from Pseudonocardiaceae bacterium YIM PH 21723 (XIJ19448.1; identity 54%) (GenBank: CP171636.1).
Type IV secretion system (T4SS) proteins play a critical role in plasmid functionality by initiating plasmid DNA transfer through conjugation, enabling horizontal gene transfer between adjacent cells [40]. They also form the essential components of the machinery that translocate plasmid DNA across the cell membrane from donor to recipient cells [41]. ParA proteins ensure stable plasmid maintenance by facilitating the proper partitioning of plasmid DNA during cell division. Without ParA or its partner proteins, plasmids may be lost or unequally distributed to daughter cells, leading to instability [42].
Importantly, the second circular contig of Lentzea sp. JNUCC 0626 contains a gene homologous to L,D-transpeptidase, which may function as an antibiotic resistance gene. L,D-transpeptidase is an enzyme involved in bacterial cell wall synthesis and is particularly linked to resistance against β-lactam antibiotics. Unlike conventional D,D-transpeptidases, L,D-transpeptidases can form crosslinks between peptides containing both L- and D-amino acids. While β-lactam antibiotics inhibit D,D-transpeptidases, L,D-transpeptidases remain unaffected, enabling bacteria to sustain their antibiotic resistance.
In conclusion, the presence of these genes strongly supports the existence of plasmids within Lentzea sp. JNUCC 0626, suggesting that these plasmids may play a significant role in gene transfer and contribute to the genetic diversity of microbial populations. Furthermore, the identification of plasmids could pave the way for developing host–vector systems in Lentzea sp. JNUCC 0626, facilitating the application of combinatorial biosynthesis in actinobacterial hosts for the production of novel bioactive compounds.

3.6. In Silico Prediction of Secondary Metabolites and Biosynthetic Gene Cluster Analysis of Lentzea sp. JNUCC 0626

Genome mining and the antiSMASH program are powerful tools for discovering novel secondary metabolites derived from microorganisms. Genome mining involves exploring microbial genomes to identify potential compounds, while antiSMASH supports this exploration through efficient and automated means. Together, these approaches significantly advance the discovery and understanding of new secondary metabolites [43,44,45]. In this study, we performed a comprehensive genome analysis and an antiSMASH analysis of Lentzea sp. JNUCC 0626. As shown in Table 1, we identified 34 BGCs including those related to terpenes, indolocarbazoles, nucleosides, peptides, polyketides, and peptidyl–polyketide hybrids. Subsequently, we conducted a homologous protein analysis of these individual BGCs using the National Center for Biotechnology Information (NCBI) databases. The protein structural characteristics were further analyzed using prediction programs such as AlphaFold, SWISS-MODEL, and HHPred. Based on these results, we categorized the 34 BGCs into six groups: terpene-related gene clusters, thiopeptide and LAP gene clusters, lanthipeptide and RiPP gene clusters, indole-related gene clusters, NRPS and PKS gene clusters, and other gene clusters. This categorization allowed for a more detailed analysis of each gene cluster.

3.6.1. Terpene-Related Gene Clusters

BGC Region 1 Derived from Lentzea sp. JNUCC 0626

The BLASTP analysis of region 1 in the BGCs of Lentzea sp. JNUCC 0626 revealed that both copies of Family 2 encapsulin nanocompartment cargo protein terpene cyclases (EncT, proteins XIJ14781 and XIJ14782) and Family 2B encapsulin nanocompartment shell proteins (EncS, proteins XIJ14780 and XIJ14783; referred to as Esh in this study) are arranged in the same transcriptional orientation. Downstream of this region, other proteins such as XIJ14779 (a distinct terpene cyclase/polyprenyl transferase), XIJ14778 (4-hydroxy-3-methylbut-2-enyl diphosphate reductase), and XIJ14777 (1-Deoxy-D-xylulose-5-phosphate synthase) are organized in an operon-like structure (Figure 3, Table S7). AlphaFold predicted that protein XIJ14779 shares a tertiary structure with (2E,6E)-farnesyl diphosphate synthases from Mycobacterium tuberculosis (UniProt: P9WKH1) and Mycobacterium bovis (UniProt: P0A5H9), with a sequence identity of 48% and 61% similarity. HHPred structural analysis further suggested that protein XIJ14779.1 resembles sesquiterpene cyclases, such as Kitasatospora setae hedycaryol synthase (PDB: 4MC3), Streptomyces pristinaespiralis selinadiene synthase (PDB: 4OKZ), and Streptomyces coelicolor epi-isozizaene synthase (PDB: 8SU3), as well as the monoterpene cyclase S. coelicolor geosmin synthase (PDB: 5DZ2). The SWISS-MODEL analysis indicated a broader structural similarity with bacterial terpene cyclases, such as S. coelicolor polyprenyl synthetase (PDB: 3NF2), Pyrococcus horikoshii geranylgeranyl pyrophosphate synthetase (PDB: 1WY0), and Rhodobacter capsulatus decaprenyl diphosphate synthase (PDB: 3MZV). Protein XIJ14779 contains the conserved motifs of trans-prenyltransferases, including the “first aspartate-rich motif” (FARM, DDX2–4D) and the “second aspartate-rich motif” (SARM, DDXXD), with motifs 104DDVMD107 (FARM) and 234DDXXD238 (SARM). Notably, the third aspartate in the SARM motif is replaced by glycine at position 238. Proteins XIJ14781 (337 aa) and XIJ14782 (359 aa) were annotated as EncT based on the BLASTP analysis. The structural predictions made by AlphaFold, HHPred, and SWISS-MODEL revealed similarities to germacradienol/geosmin synthase, pentalenene synthase, and epi-isozizaene synthase. However, the sequence identity between proteins XIJ14781 and XIJ14782 was only 36.18%, with a similarity of 51.68%, which is relatively low. Moreover, neither protein exhibited the conserved FARM and SARM motifs typically found in GGDPS and other prenyltransferases. These terpene cyclases are specialized enzymes operating within encapsulin nanocompartments, enhancing their efficiency. Proteins XIJ14780 (466 aa) and XIJ14783 (468 aa) were both annotated as cyclic nucleotide-binding domain-containing proteins, EncS proteins, and Crp/Fnr family transcriptional regulators in the BLASTP analysis. Compared to the proteins XIJ14779 and XIJ14782, XIJ14780 and XIJ14783 showed a high sequence identity (62.24%) and similarity (77.85%). No structural homologs were found for protein XIJ14780 in AlphaFold and Swiss-Prot, but TrEMBL predicted a structure resembling those from Lentzea sp. The HHPred analysis showed that the N-terminus of protein XIJ14780 shared structural homology with cyclic AMP-dependent transcriptional regulators from Corynebacterium glutamicum, Agathobacter rectalis, and Thermus thermophilus, while the C-terminus resembled the encapsulin shell of the Acinetobacter baumannii family 2A cargo-loaded encapsulin. In contrast, protein XIJ14783 showed structural homology to eukaryotic cGMP-dependent protein kinase regulatory subunits, such as those from Homo sapiens, Euglena gracilis, Mus musculus, Bos taurus, Trypanosoma cruzi, and Rattus norvegicus, as revealed by SWISS-MODEL. The N-terminus of protein XIJ14783, like that of protein XIJ14780.1, exhibited homology with the cAMP-binding domains of the CRP/FNR family, but with closer evolutionary ties to proteins from Deinococcus radiodurans, Bacteroides thetaiotaomicron, and Sinorhizobium meliloti. Both proteins XIJ14780 and XIJ14783 shared C-terminal similarity to the Acinetobacter baumannii EncS. In conclusion, the terpene BGC in region 1 exhibits a unique genetic composition and arrangement, with two copies of EncT (XIJ14781 and XIJ14782) paired with EncS proteins (XIJ14780 and XIJ14783), alongside a distinct terpene cyclase (XIJ14779). Further investigation is needed to explore the under-researched EncS proteins, particularly focusing on the divergent N-terminal features and the conserved C-terminal characteristics of proteins XIJ14780 and XIJ14783.

BGC Region 3 Derived from Lentzea sp. JNUCC 0626

The BLASTP analysis revealed that in BGC region 3 of Lentzea sp. JNUCC 0626, two terpene biosynthesis-related genes, namely, geranyl diphosphate 2-C-methyltransferase (2-CMT, 284 aa) and 2-methylisoborneol synthase (2-MIBS, 354 aa), are arranged in the same transcriptional direction. AlphaFold structure predictions indicate that protein XIJ15369 shows the highest similarity to 2-MIBS from Streptomyces lasalocidi (UniProt: D3KYU2), Streptomyces ambofaciens (UniProt: A3KI17), S. coelicolor (UniProt: Q9F1Y6), Streptomyces griseus (UniProt: Q9F1V8), and Saccharopolyspora erythraea (UniProt: A4FG19), with sequence identities of 37%, 36%, 34%, 34%, and 30%, respectively. These results suggest that protein XIJ15369 may functionally resemble enzymes involved in 2-MIB biosynthesis. In contrast, structural predictions using SWISS-MODEL and HHPred indicate that the protein XIJ15369 is most similar to the 2-MIBS from S. coelicolor (PDB: 3V1V) and also shares structural similarities with isoprenoid synthase from Streptomyces lydicus (PDB: 4ZQ8) and (E)-biformene synthase LrdC from Streptomyces sp. strain K155 (PDB: 6OH6). This suggests a close structural relationship with terpene biosynthesis enzymes. The biosynthesis of 2-MIB occurs in two stages. In the first stage, MT methylates geranyl pyrophosphate (GPP) to produce 2-methyl GPP. In the second stage, 2-MIBS cyclizes this intermediate to form 2-MIB [46]. Therefore, the 2-MIB BGC requires the presence of a CMT gene. Our analysis confirmed the expected presence of a corresponding CMT gene downstream of the 2-MIBS gene in a translational coupling arrangement. Additionally, AlphaFold, SWISS-MODEL, and HHPred structure predictions show that this gene exhibits high structural similarity to geranyl diphosphate 2-CMT from actinobacteria. In many bacteria, 2-MIB BGCs commonly include cyclic nucleotide-binding proteins alongside 2-MIBS and CMT. Studies on the model soil bacterium S. griseus have suggested that the cyclic nucleotide-binding protein EshA encodes a conserved transcription factor. However, recent studies have revised this function, indicating that EshA functions as an EncS protein. Based on these findings, 2-MIB biosynthesis appears to be compartmentalized within protein shells. An analysis of 723 2-MIB BGCs in actinobacteria revealed that approximately 80% code for EncS proteins, while the remaining 20% contain only geranyl diphosphate 2-CMT and terpene cyclase genes without EncS proteins [47]. This suggests that while EncS proteins are generally associated with 2-MIB biosynthesis, they are not essential. Notably, the 2-MIB BGC in region 3 of Lentzea sp. JNUCC 0626 does not include an EncS protein (see Figure S2 and Table S8).

BGC Region 6 Derived from Lentzea sp. JNUCC 0626

The antiSMASH analysis of the complete genome sequence of Lentzea sp. JNUCC 0626 revealed that BGC region 6 shares 100% genetic similarity with the isorenieratene BGC from S. griseus subsp. griseus NBRC 13350 (GenBank: AP009493). Isorenieratene, a carotenoid pigment, is synthesized by a gene cluster containing key biosynthetic genes, such as phytoene synthase, phytoene desaturase, lycopene cyclase, and a methyltransferase. In S. griseus, the isorenieratene BGC consists of seven genes: crtY (lycopene cyclase), crtT (methyltransferase), crtU (β-carotene desaturase/methylase), crtV (methylesterase), crtB (phytoene synthase), crtI (phytoene dehydrogenase), and crtE (geranylgeranyl pyrophosphate synthase). In contrast, the isorenieratene BGC from Streptomyces argillaceus ATCC 12956 (GenBank: LT989886) includes an additional gene encoding a sigma-70 family RNA polymerase sigma factor (crtQ), bringing the total to eight genes. In Lentzea sp. JNUCC 0626, BGC region 6 also contains the seven essential genes (crtY, crtT, crtU, crtV, crtB, crtI, and crtE), as shown in Figure 4 and Table S9. However, unlike S. griseus and S. argillaceus, which have lycopene cyclase genes with 413 and 396 amino acids, respectively, JNUCC 0626 has two smaller lycopene cyclase genes, crtY1 (117 aa) and crtY2 (105 aa). Furthermore, instead of the sigma factor crtQ found in S. argillaceus, BGC region 6 of Lentzea sp. JNUCC 0626 contains two regulatory genes: a MerR family transcriptional regulator (XIJ15578, 287 aa) and a WhiB family transcriptional regulator (XIJ15579, 95 aa). Of particular note is the presence of two proteins, XIJ15576 and XIJ15577, within the middle region of the L. jejuensis isorenieratene BGC. Structural homologs for these proteins were not identified through AlphaFold or Swiss-Prot. However, TrEMBL predicted that these proteins are similar to flavin-containing amine oxidoreductase and deoxyribodipyrimidine photolyase, both derived from Lentzea species. Additionally, SWISS-MODEL and HHPred analyses indicated that protein XIJ15576 resembles protoporphyrinogen oxidase from Bacillus subtilis (PDB: 3i6d), Myxococcus xanthus (PDB: 2IVE), and Exiguobacterium sp. 255-15 (PDB: 3LOV), while protein XIJ15577 shares structural similarity with cryptochrome B from Rhodobacter sphaeroides (PDB: 3ZXS), as well as bacterial photolyases from Agrobacterium tumefaciens (PDB: 4DJA) and Vibrio cholerae (PDB: 8A1H). Cryptochrome B and photolyases are evolutionarily related photoreceptors. While they share structural similarities, cryptochrome B primarily functions in light signaling, such as regulating circadian rhythms, whereas photolyases play a role in DNA repair by fixing UV-induced damage. Although the relationship between cryptochrome B and terpene synthesis remains unclear, it is plausible that cryptochrome B could influence terpene biosynthesis, given that terpene biosynthesis is often responsive to environmental factors such as light. Cryptochrome B might regulate the expression or activity of enzymes involved in terpene synthesis, potentially linking circadian regulation and metabolic pathways to terpene biosynthesis.

BGC Region 23 Derived from Lentzea sp. JNUCC 0626

As shown in Figure S3 and Table S10, BGC region 23 contains two terpene biosynthesis-related genes: Type I geranylgeranyl diphosphate synthase (XIJ18858, 353 aa) and a phytoene/squalene synthase family protein (XIJ18860, 296 aa). Additionally, polyprenol phosphomannose-dependent alpha-1,6 mannosyltransferase MptB (XIJ18859, 482 aa) is located in the middle region of the cluster, with all genes oriented in the same transcriptional direction. The protein XIJ18858 was predicted to have structural similarity to the (2E,6E)-farnesyl diphosphate synthase from M. tuberculosis (PDB: 8F8F) by AlphaFold, SWISS-MODEL, and HHPred, as well as to geranylgeranyl pyrophosphate synthases (GGPPS) from various microorganisms. GGPPS, an enzyme in the isoprenoid biosynthesis pathway, catalyzes the production of geranylgeranyl pyrophosphate (GGPP), a key precursor for terpenoid biosynthesis. It is considered a rate-limiting enzyme that influences terpene production. Photosynthetic organisms rely on GGPP to synthesize critical compounds such as carotenoids, chlorophyll side chains, and plastoquinones. GGPPS enzymes contain two conserved motifs, the first (FARM, DDX2–4D) and the second aspartate-rich motif (SARM, DDXXD). In protein XIJ18858, the motifs were present as 120DDLMD124 for FARM and 268DDLLG273 for SARM, although no large aromatic amino acids were found near the FARM motif, and the third aspartate residue of the SARM was replaced by glycine. Protein XIJ18860 showed over 90% homology to members of the squalene/phytoene synthase family, according to BLASTP analysis. This family of proteins catalyzes the head-to-head condensation of C15 and C20 prenyl units (e.g., farnesyl diphosphate and geranylgeranyl diphosphate), key steps in steroid and carotenoid biosynthesis. Squalene synthase (SQS) catalyzes the formation of squalene from farnesyl diphosphate (FPP), while phytoene synthase (PSY) facilitates the conversion of geranylgeranyl pyrophosphate to phytoene. These two enzymes share significant structural similarities, including three highly conserved regions involved in substrate binding or catalysis. In region 23, the presence of GGPPS downstream of protein XIJ18860 suggests that the latter may function more as a PSY than as an SQS. The AlphaFold-based 3D structure prediction supported this hypothesis, revealing 59% sequence identity and 70% similarity to S. griseus phytoene synthase (CrbB) in the Swiss-Prot database. A SWISS-MODEL analysis further indicated structural homology to dehydrosqualene synthases from Enterococcus hirae and Staphylococcus aureus, reinforcing the likelihood of PSY functionality over SQS. Finally, protein XIJ18859, located within the terpene BGC of region 23, showed high amino acid sequence homology to polyprenol phosphomannose-dependent alpha-1,6 mannosyltransferase (MptB). The Swiss-Prot data indicated homology with M. tuberculosis and Corynebacterium glutamicum alpha-(1->6)-mannopyranosyltransferase A (MptA), with 43% and 36% sequence identity, respectively. Structural prediction tools such as SWISS-MODEL and HHPred suggested that protein XIJ18859 shared structural similarity with dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase from Saccharomyces cerevisiae (PDB: 6SNI) and aminoarabinose transferase ArnT from Cupriavidus metallidurans (PDB: 5EZM). However, the exact function of this protein remains unclear.

BGC Region 26 Derived from Lentzea sp. JNUCC 0626

The BGC in region 26 contains a single terpene cyclase gene composed of 710 amino acids (Figure S4, Table S11). Protein structure prediction using AlphaFold indicated that this gene showed the highest high-scoring segment pair (HSP) score with the germacradienol/geosmin synthase from S. coelicolor, demonstrating 57% amino acid sequence identity and 71% similarity (positives). In comparison, the pristinol synthase from S. pristinaespiralis exhibited 29% sequence identity and 46% similarity. The HHPred analysis predicted structural similarities in the C-terminal region with the selinadiene synthase from S. pristinaespiralis (PDB: 4OKZ) and in the N-terminal region with the geosmin synthase from S. coelicolor (PDB: 5DZ2). Additionally, the protein located upstream of the terpene cyclase, referred to as 5270, shows high amino acid sequence homology with the Uma2 family endonucleases from various bacteria, according to BLSATP searches. Uma2 family endonucleases are primarily involved in RNA processing and degradation, including RNA maturation, surveillance, and level regulation, and appear unrelated to terpene biosynthesis.

3.6.2. Thiopeptide and LAP Gene Clusters

BGC Region 2 Derived from Lentzea sp. JNUCC 0626

The antiSMASH-based genomic analysis of Lentzea sp. JNUCC 0626 identified genes in BGC region 2 that are homologous to those responsible for lactazole biosynthesis, a potent antibiotic thiopeptide primarily synthesized by Streptomyces lactacystinaeus. Within this region, homologs of key biosynthetic genes (lazA-lazF) were found that are responsible for precursor synthesis, azole ring formation, and maturation [48]. Specifically, the lazA gene encodes the precursor peptide, which undergoes post-translational modifications to yield the active thiopeptide. The genes lazB, lazC, lazD, and lazE are involved in modifying the precursor peptide, facilitating the formation of azole rings and other structural elements essential for lactazole activity. The lazF gene likely participates in further modifications, potentially contributing to cyclization or other maturation processes necessary for the production of the final bioactive compound. The comparative analysis of the lactazole biosynthetic gene clusters in JNUCC 0626 and S. lactacystinaeus—as depicted in Figure S5 and detailed in Table S12—demonstrates a conserved operon-like structure across both species. This structural similarity suggests a shared evolutionary pathway for lactazole biosynthesis. A significant finding from this comparative analysis is the sequence variation in the precursor peptide encoded by the lazA gene. In S. lactacystinaeus, the precursor peptide sequence is “MSDITASRVESLDLQDLDLSELTVTSLRDTVALPENGASWGSCSCQASSSCAQPQDM”, whereas in JNUCC 0626, it is “MKDLSFDPDDLELGDLAVTSLRDSVALPESGASGGASSCSCGSSSCSSCTQPQLPAQNA”. These sequence variations may impact the final structure and bioactivity of the lactazole compounds produced by each species. These findings underscore both the genetic and functional homology between JNUCC 0626 and S. lactacystinaeus, suggesting that while both organisms retain the core machinery for lactazole biosynthesis, they may produce distinct yet related thiopeptides due to minor modifications. Such comparative genomic studies are essential for understanding the diversity in natural product biosynthesis and may offer valuable insights into novel antibiotic discovery.

BGC Region 31 Derived from Lentzea sp. JNUCC 0626

The bacteriocin biosynthetic gene cluster (BGC) found in region 31 of Lentzea sp. JNUCC 0626 exhibits similarities to other well-characterized BGCs, such as those responsible for the production of the DNA gyrase inhibitor microcin B17 (GenBank: FM877811), the exotoxin streptolysin (GenBank: AF465842), and the pore-forming toxin listeriolysin (GenBank: AE017262). These clusters typically encode precursor peptides (e.g., SagA) alongside enzymes such as SagB/ThcOx family dehydrogenases (e.g., SagB), cyclodehydratases (e.g., SagC), and YcaO-like proteins (e.g., SagD). As depicted in Figure S6 and Table S13, the BGC from JNUCC 0626 region 31 contains proteins with a low sequence identity to these known bacteriocin-related proteins yet retains predicted functional similarities. Specifically, the BLASTP, SWISS-MODEL, and HHPred analyses suggest that proteins XIJ13287, XIJ13290, and XIJ13288 have analogous functions to SagB (19.20%), SagC (22.96%), and SagD (24.45%), respectively.
Protein XIJ13285 was predicted to be a short peptide composed of 78 amino acids. In contrast, protein XIJ13291 was identified as a MerR family transcriptional regulator. Structural and sequence analyses of protein XIJ13292, conducted using AlphaFold, HHPred, and SWISS-MODEL, revealed a 69% sequence identity and 82% positive alignment (131 out of 160 residues) with the Mycobacterium tuberculosis amino acid acetyltransferase (PDB: 5YGE) [49]. Interestingly, unlike many bacteriocin BGCs, no genes encoding peptidases or transporter proteins were found in this region of the Lentzea sp. JNUCC 0626 genome, indicating a potentially unique mechanism of bacteriocin biosynthesis and secretion.

3.6.3. Lanthipeptide and RiPP Gene Clusters

BGC Region 5 Derived from Lentzea sp. JNUCC 0626

An analysis of region 5 of the Lentzea sp. JNUCC 0626 BGC revealed that protein XIJ15501 was predicted to have the highest structural similarity to the Enterococcus faecalis class II lanthipeptide synthetase CylM (PDB: 5DZT) and the Bacillus licheniformis LicM2 (PDB: 6ST5) based on HHPred and SWISS-MODEL searches. Additionally, BLASTP searches indicated that protein XIJ15502 shares similarities with various lanthionine synthetases, including LanC, LanL, and LanKC. HHPred and SWISS-MODEL analyses further suggested that protein XIJ15502 is structurally similar to the Thermomonospora curvata curvocidin synthetase CuvL (PDB: 8CAR) and the Bacillus thuringiensis serovar andalousiensis Class III metal-independent lanthipeptide synthetase LP-GS-ThurKC (PDB: 8SAM). The presence of both LanM (protein XIJ15501) and a different type of lanthipeptide synthetase (protein XIJ15502) in the RiPP BGC suggests the potential for a lanthipeptide hybrid BGC involving both class II lanthipeptides and class I or III types. The antiSMASH analysis identified two precursor peptides—one with 46 amino acids and the other with 70 amino acids—located between proteins XIJ15501 and XIJ15502. These sequences are “MENTTIASCLRTGHYACSPMPLADRLSRWVPCRCSWWSRTAVFEWW” and “MRTHLPEEGLAVGRTTAAHRITGAPVSSGSRSRSRRCRGSCPPSAARRPRSPWSAGRSRRRSSPSECTSV”, respectively. Additionally, protein XIJ15500.1 contains a distinct 74-amino-acid peptide fragment. Protein XIJ15503 exhibits high homology with the GNAT family N-acetyltransferase, suggesting its potential involvement in post-translational modifications via the N-acetylation of amino acid residues in the RiPP biosynthesis pathway. This function could modulate the functional properties of RiPP peptides or alter their structures to confer new physiological activities. Moreover, protein XIJ15505 shows high homology with the S9 family peptidase, indicating its potential role in the modification processes of RiPPs, such as leader sequence cleavage. For instance, protein XIJ15505 could be responsible for the cleavage of the leader sequence to generate mature peptides from their precursor forms (Figure S7, Table S14).

BGC Region 13 Derived from Lentzea sp. JNUCC 0626

Protein XIJ16542 showed high homology to various class III LanKC proteins in BLASTP analysis, and SWISS-MODEL predicted its structure to be most similar to T. curvata curvocidin synthetase CuvL (PDB: 8CAR) and E. faecalis class II lanthipeptide synthetase CylM (PDB: 5DZT). A potential precursor peptide, protein XIJ16543, consisting of 54 amino acids, was also identified. Proteins XIJ16544 to XIJ16548 exhibited similarity to radical SAM proteins, iron-containing redox enzyme family proteins, aroma-sacti cluster domain-containing proteins, AAA family ATPases, and S8 family serine peptidases, respectively. Protein XIJ16545 displayed homology to Shewanella denitrificans TENA/THI-4 (PDB: 3DDE) and methylobacterium extorquens PqqC (PDB: 5VRC) in the HHPred analysis, and structural similarity to Pseudomonas aeruginosa heme oxygenase-like oxidase (PDB: 9B9N), Chlamydia trachomatis redox enzyme (PDB: 1RCW), and Pseudomonas protegens Pf-5 desaturase/decarboxylase UndA (PDB: 5V1T) was predicted by SWISS-MODEL. Protein XIJ16546 shared homology with aroma-sacti cluster domain-containing proteins, MFS transporters, and helix-turn-helix transcriptional regulators (partial) in the BLASTP analysis. Protein XIJ16547 was structurally similar to S. coelicolor transcription factor AfsR (PDB: 8K60) and Bos taurus adenylyl cyclase 8 (PDB: 8BUZ) in HHPred, and to Escherichia coli (PDB: 8BOB) and Pyrococcus horikoshii signal transduction ATPases (PDB: 6MFV) in SWISS-MODEL. Protein XIJ16548, predicted by AlphaFold to be structurally similar to Bacillus amyloliquefaciens subtilisin BPN (UniProt: P00782) with 35% identity and 52% positive alignment, was also linked to the Plasmodium vivax SUB1 protease (PDB: 8QKE) in HHPred and the Plasmodium falciparum SUB1 protease (PDB: 8POL) in SWISS-MODEL. Protein XIJ16549 displayed high homology to GAF domain-containing proteins, which are involved in signal transduction and ligand binding, and play key roles in regulating biological processes across various organisms (Figure S8, Table S15).

BGC Region 19 Derived from Lentzea sp. JNUCC 0626

In BGC region 19, protein XIJ18177 was predicted to have functional similarity to class II lanthipeptide synthetases, such as E. faecalis CylM (PDB: 5DZT) and B. licheniformis LicM2 (PDB: 6ST5), based on analyses from BLASTP, AlphaFold, SWISS-MODEL, and HHPred. Additionally, antiSMASH analysis identified the presence of a 41-amino acid precursor peptide (“MSLGPIGRQYMGGDPPYSPRPPESGGLVPMCRTPARARLAG”) located downstream of the XIJ18177 protein, suggesting its role as LanM. Protein XIJ18179 was structurally predicted to resemble P. horikoshii OT3 signal transduction ATPases (PDB: 6MFV) and E. coli HTH-type transcriptional regulator MalT (PDB: 8BOB). Further upstream, proteins XIJ18180, XIJ18181, and XIJ18183 were identified as transport-related proteins, all located in the same transcriptional orientation. Notably, typical components of Class II lanthipeptide BGCs, such as protease genes and immunity genes, were absent in this region (Figure S9, Table S16).

BGC Region 21 Derived from Lentzea sp. JNUCC 0626

Biosynthetic gene cluster (BGC) region 21 contains several gene clusters involved in daptide biosynthesis. Specifically, the proteins XIJ18556 (LjvM, 248 aa), XIJ18557 (LjvD, 405 aa), XIJ18558 (LjvC, 363 aa), and XIJ18560 (LjvP, 527 aa) encode daptide-type RiPP biosynthesis enzymes: a methyltransferase, aminotransferase, dehydrogenase, and intramembrane metalloprotease, respectively. These proteins share significant sequence similarity with their counterparts in Microbacterium maritypicum—MpaM (GenBank: WKT89666; 275 aa), MpaD (GenBank: WKT89671; 419 aa), MpaC (GenBank: WKT89670; 396 aa), and MpaP (GenBank: WKT89665; 562 aa)—with identity/similarity values of 37.33%/52.05%, 49.66%/63.09%, 37.32%/49.30%, and 38.15%/49.45%, respectively. Additionally, protein XIJ18549 (LjvB, 341 aa), which exhibits high homology to a daptide biosynthesis RiPP recognition protein, is homologous to two MpaB proteins from M. maritypicum. One MpaB (GenBank: WKT89672) consists of 349 amino acids, while the other (GenBank: WKT89673) is 335 amino acids long. The XIJ18549 protein shows 31.89% identity/43.51% similarity with the first MpaB and 34.17% identity/43.35% similarity with the second. Furthermore, three proteins in the daptide BGC—XIJ18553 (LjvK, 350 aa), XIJ18554 (LjvY, 297 aa), and XIJ18555 (LjvJ, 312 aa)—show homology to components of the Streptomyces rochei lexamycin BGC (GenBank: KP823601). Specifically, they are homologous to the class V lanthionine synthetase subunit LxmK (401 aa; 36.64% identity/47.00% similarity), T3SS effector HopA1 family protein LxmY (376 aa; 41.79% identity/51.54% similarity), and F420-dependent peptide dehydroalanine reductase LxmJ (339 aa; 48.74% identity/60.78% similarity). LxmK is responsible for catalyzing the formation of lanthionine and methyllanthionine crosslinks, which are essential for the structural and functional maturation of the lanthipeptide, specifically between cysteine and dehydrated serine or threonine residues. Finally, protein XIJ18559 encodes a YcaO-like family protein. While the role of YcaO-like proteins in class V lanthipeptide biosynthesis is not fully understood, it is known that other enzymes such as LxmK, LxmJ, and LxmY are key players in this process, and YcaO-like proteins are more commonly associated with Class I–III lanthipeptides. In summary, BGC region 21 contains a cryptic Ljv gene cluster involved in the biosynthesis of class V lanthipeptides. This cluster includes regulatory genes (XIJ18547, LjvR1; XIJ18548, LjvR2) and transport-related genes such as XIJ18563 (LjvT3), highlighting the region’s potential for producing novel antibiotics (Figure 5, Table S17).

BGC Region 22 Derived from Lentzea sp. JNUCC 0626

The antiSMASH analysis of BGC region 22 identified the XIJ18652 protein as a core biosynthetic gene, implicating its involvement in a RiPP biosynthetic cluster (Figure S10, Table S18). Additionally, the XIJ18652 protein was found to encode a member of the domain of unknown function 692 (DUF692), an emerging family of enzymes associated with post-translational modifications during the biosynthesis of RiPPs. These enzymes are characterized by multinuclear iron centers, with only two family members, MbnB and TglH, functionally characterized to date. A recent study has proposed reclassifying this family as multinuclear non-heme iron-dependent oxidative enzymes (MNIOs) [50]. As expected, structural predictions using HHPred and SWISS-MODEL indicated that the XIJ18652 protein shares the highest similarity with the methanobactin biosynthetic protein MbnB from Methylosinus trichosporium (PDB: 7TCX), MbnB from Vibrio caribbeanicus (PDB: 7DZ9), and the RiPP recognition protein TglH involved in peptidyl (S)-2-mercaptoglycine biosynthesis from Pseudomonas syringae (PDB: 8HI7).
The intriguing aspect of BGC region 22 is the presence of four consecutive TIGR04222 domain-containing membrane proteins located in an operon-like arrangement within the DUF692 downstream. Notably, the proteins XIJ18648, XIJ18649, XIJ18650, and XIJ18651 each exhibit Cys- and Ser-rich C-terminal sequences, as follows: “CSSSSSSCSSGSSCGGGGGCGGGCGGGS”, “SCGGTSSCSSNSCNSSSGCSSSSSSCSSSSSSCSSSSCSSSSSSCSSSSS”, “SACGSSSGCGSSGCSGGSSCGGGGGGCGGGGGS”, and “GGAASSSAAACGSCGSGCGSSSCGSSSCSSSSSSCSSSSGSSCSSGGSSCGGGGGGGD”. Furthermore, neither PubMed nor HHPred or SWISS-MODEL provided significant functional or structural information regarding these TIGR04222 domain-containing membrane proteins. On the other hand, the protein XIJ18647 exhibits high homology with peptide-methionine (R)-S-oxide reductase (MsrB). MsrB functions as an enzyme that reduces methionine sulfoxide, generated from the oxidation of methionine residues, back to methionine [51]. This reduction restores protein function and protects cells from oxidative stress. The significant homology between protein XIJ18647 and MsrB suggests that protein XIJ18647 may be involved in the reduction in methionine sulfoxide. However, it appears unlikely that protein XIJ18647 plays a direct role in the biosynthesis of lantipeptides. Protein XIJ18653 (123 aa) is annotated as an uncharacterized protein in AlphaFold predictions. However, structural predictions from HHPred and SWISS-MODEL suggest low-level similarity to a regulatory protein from Neisseria gonorrhoeae (PDB: 3DEE). In contrast, protein XIJ18654 encodes an S8 family serine peptidase. S8 family serine peptidases are critical in the lantipeptide biosynthetic pathway, where they facilitate the precise processing and maturation of precursor peptides, a process essential for the production of biologically active lantipeptides [52,53].

BGC Region 25 Derived from Lentzea sp. JNUCC 0626

In BGC region 23, a class III lanthionine biosynthetic gene cluster (BGC) comprising six proteins was identified using the antiSMASH approach (Figure S11, Table S19). Proteins XIJ19011 (852 aa) and XIJ19012 (55 aa) exhibit significant sequence similarity to the class III lanthionine synthetase LanKC and the SapB/AmfS family lanthipeptides, as determined by BLASTP analysis. Additionally, proteins XIJ19013 (538 aa) and XIJ19014 (572 aa), which are ABC transporter ATP-binding proteins, are positioned in the same transcriptional direction in their upstream regions. Conversely, protein XIJ19015 (167 aa), which shares high similarity with DUF3145 domain-containing proteins, is oriented in the opposite transcriptional direction. However, protein XIJ19016 (440 aa), exhibiting similarity to S8 family serine peptidases, is located in the upstream region. Based on these observations, the minimal unit of the class III lanthionine BGC in region 25 is inferred to consist of six proteins. Notably, in class III BGCs, S8 family serine peptidases play a critical role in the processing of precursor peptides. These peptidases cleave the precursor peptides at specific sites to release mature lanthipeptides, a process that is essential for the proper maturation and biological activity of the lanthipeptides.

3.6.4. Indole-Related Gene Clusters

BGC Region 7 Derived from Lentzea sp. JNUCC 0626

The antiSMASH analysis predicted the presence of an indolocarbazole BGC in Lentzea sp. JNUCC 0626 BGC region 7, which shares 85% of the biosynthetic genes found in BE-54017, a natural product derived from uncultured bacterium AB1650 that belongs to the indolotryptoline family and exhibits potent activity against tumor cell lines [53]. As shown in Figure 6, Table 2 and Table S20, proteins XIJ15613 through 1138 in BGC region 7 display high amino acid identity with the corresponding proteins from the BE-54017 BGC, including AbeC (89.87%), AbeO (90.27%), AbeY (86.74%), AbeF (89.38%), AbeT (84.93%), AbeH (95.15%), AbeM3 (89.32%), AbeX2 (92.03%), AbeD (93.10%), AbeM1 (90.91%), AbeX1 (93.43%), and AbeM2 (91.30%). However, we observed the absence of two key proteins, AbeR and AbeP, in Lentzea sp. JNUCC 0626 BGC region 7. Further analysis revealed that protein XIJ15613 is located at the terminus of BGC region 7, prompting us to search the full genome contig for downstream proteins. Upon comparison with the BE-54017 BGC, we identified protein XIJ15611, which shares 71.37% amino acid identity with the LuxR-like transcription regulator AbeR, and protein XIJ15612, which shares 86.60% amino acid identity with the RebP-like cytochrome P450 AbeP. This study provides two key insights: first, that antiSMASH results may miss certain BGC components when homology is low or when the BGC is located at the genomic region’s boundary, underscoring the importance of in silico walking; and second, that a complete BE-54017 BGC is indeed present in the Lentzea sp. JNUCC 0626 BGC region.

BGC Region 20 Derived from Lentzea sp. JNUCC 0626

The antiSMASH analysis predicted that region 20 is associated with an indole-related BGC based on the homology of protein XIJ18501 to tryptophan dimethylallyltransferase. The structural comparison of protein XIJ18501 with crystal structures from the PDB, conducted using SWISS-MODEL and HHPred, confirmed its high similarity to Micromonospora olivasterospora 6-dimethylallyl tryptophan synthase (PDB: 6ZRY) and Marinactinospora thermotolerans indole prenyltransferase MpnD (PDB: 4YLA). Furthermore, the structure of protein XIJ18502 was analyzed in comparison to PDB crystal structures using HHPred, revealing significant similarity to Proteus vulgaris tryptophan indole-lyase (PDB: 9BNJ), Butyricicoccus sp. BIOML-A1 tryptophanase (PDB: 8SL7), and Fusobacterium varium tryptophanase (PDB: 8SIJ). Recently, the Mara1 enzyme, which contains indole prenyltransferase and tryptophan indole-lyase domains, has been identified as a key player in maramycin biosynthesis. Thus, it is proposed that the putative indole prenyltransferase MarA and tryptophan indole-lyase MarB in BGC region 20 may be instrumental in the production of maramycin intermediates [54]. Downstream of MarA and MarB, five proteins (XIJ18494 to XIJ18498) exhibit homology to glycosyltransferases, while protein XIJ18499 shows homology to an FAD-dependent oxidoreductase, and protein XIJ18500 is similar to lysyl oxidase. In contrast, the upstream proteins (XIJ18503 to XIJ18506) resemble ATP/GTP-binding proteins, DUF742 domain-containing proteins, roadblock/LC7 domain-containing proteins, and nitrate- and nitrite-sensing domain-containing proteins (see Figure S12 and Table S21). Ultimately, these proteins do not appear to be involved in the biosynthesis of maramycin and mansouramycin.
An intriguing aspect is the presence of the IS30 family transposase gene XIJ19173, located adjacent to the tryptophanase upstream region. According to the BLASTP analysis, three proteins—XIJ19304, XIJ19318, and XIJ19371—were identified within the genome of Lentzea sp. JNUCC 0626, all sharing 100% amino acid identity with XIJ19173 and consisting of 375 amino acids. The phenomenon of multiple instances of IS30 family transposases within microbial genomes may arise from various transposition and genomic evolution mechanisms. These transposases can replicate through a “copy–remove–insert” mechanism, allowing copies to integrate into new positions within the genome, which facilitates the dissemination of the same IS element through replication and homologous recombination, potentially resulting in the formation of minicycles or dimers [55]. Such repetitive sequences may be inherited as part of the genomic architecture and can assist in promoting genomic rearrangements or horizontal gene transfer. Additionally, the existence of multiple identical copies may be explained by selective pressure, where specific transposases contribute to adaptive functions such as antibiotic resistance or stress responses, which can lead to the retention of identical copies in the genome over time. This phenomenon is commonly observed in bacterial populations facing rapid environmental changes or selective pressures [56,57,58]. These findings underscore the adaptability of IS elements such as IS30, suggesting that they not only aid bacteria in responding to environmental challenges, but also contribute to genomic diversity.

3.6.5. NRPS and PKS Gene Clusters

BGC Region 8 Derived from Lentzea sp. JNUCC 0626

We conducted an antiSMASH analysis of the complete genome of Lentzea sp. JNUCC 0626 and identified two secondary metabolite BGCs for NRP and enediyne sporolide A/B within a large BGC, region 8, which is composed of approximately 100 genes. Based on these findings, we aimed to estimate the BGC boundary by investigating the transcriptional orientation, operon potential, and functions of the biosynthetic enzymes involved. The first BGC is related to siderophore biosynthesis. Protein XIJ15775, which shows homology to the SidA/IucD/PvdA family of monooxygenases, likely plays a critical role in siderophore biosynthesis. These enzymes are primarily involved in the N-hydroxylation of L-ornithine or L-lysine, essential reactions for the formation of hydroxamate siderophores. For example, SidA, found in A. fumigatus, hydroxylates L-ornithine to synthesize hydroxamate-based siderophores such as ferricrocin and fusarinine. IucD is involved in the biosynthesis of hydroxamate siderophores such as aerobactin, primarily hydroxylating L-lysine. PvdA is essential for the biosynthesis of pyoverdine, a siderophore in P. aeruginosa, and catalyzes the hydroxylation of amino acids. These enzymes are critical in siderophore biosynthesis because they mediate the formation of hydroxamate groups, which are essential for strong iron-binding properties [59]. On the other hand, protein XIJ15774, which shows similarity to FAD-dependent tricarballylate dehydrogenase, is an enzyme involved in oxidizing tricarballylate to aconitate in the TCA cycle and does not appear to be directly associated with siderophore biosynthesis [60]. Additionally, protein XIJ15790, which shows homology to 2,3-dihydroxybenzoyl adenylate synthase, may play a significant role in siderophore biosynthesis. It utilizes 2,3-dihydroxybenzoate (2,3-DHB) and ATP as substrates to form an adenylate intermediate (2,3-DHB-AMP), a key step observed in the biosynthesis of catechol siderophores [61]. In contrast, protein XIJ15792 shows similarity to pyridoxal kinase, an enzyme that phosphorylates pyridoxal into pyridoxal-5′-phosphate (PLP), a form of vitamin B6 [62]. However, it has no known direct role in siderophore biosynthesis. In conclusion, the NRP of BGC region 8 likely corresponds to a siderophore compound, with the BGC boundary consisting of seventeen enzymes, including two NRPSs, six transporters, two siderophore-interacting proteins, an MbtH family NRPS accessory protein, a phosphopantetheine-binding protein, decarboxylase, methyltransferase, a lysine N(6)-hydroxylase/L-ornithine N(5)-oxygenase protein, and (2,3-dihydroxybenzoyl) adenylate synthase. These enzymes are predicted to span from protein XIJ15775 to XIJ15790, including XIJ15779 (Figure S13, Table S22).
The second BGC is associated with enediyne biosynthesis. Protein XIJ15814.1 shows homology to NAD-dependent epimerase/dehydratase and shares 46.68% identity and 55.53% similarity with sporolide SpoT8 [63]. Additionally, proteins XIJ15813 (maleylpyruvate isomerase), XIJ19084.1 (acetyl-CoA carboxylase), and XIJ15814.1 are translationally coupled, suggesting their inclusion within the Ene gene cluster of Lentzea sp. JNUCC 0626. Meanwhile, protein XIJ15811 shows the highest similarity to carotenoid oxygenase, an enzyme involved in the oxidative reactions of carotenoids, which is crucial for generating various bioactive compounds through the degradation and modification of carotenoids [64]. However, no evidence suggests that carotenoid oxygenase directly participates in enediyne biosynthesis. Protein XIJ15812, located between proteins XIJ15811 and XIJ15813, shows similarity to the TetR/AcrR transcriptional regulator, with the transcriptional direction of the two adjacent proteins being reversed. Interestingly, the stop codon of protein XIJ15813 overlaps with the coding region of protein XIJ15812. Nearly all genes involved in the biosynthesis of the enediyne core, including the characteristic 1,5-diyne-3-ene motif of the 9-membered enediyne rings, are located upstream of protein XIJ15814.1 [63,64,65,66]. We have designated these genes as EneE to EneE11. A notable observation is the absence of KedF and KedJ, essential genes for kedarcidin, in this enediyne cluster. Given the possibility of antiSMASH misprediction at the BGC boundary, as previously observed in JNUCC 0626 BGC7, we extended our analysis downstream of protein XIJ15834, which revealed the presence of both KedF- and KedJ-like proteins, along with a sugar biosynthetic gene cluster. The additional genes have been designated using kedarcidin nomenclature, including EneF, EneS5, EneS12, EneS7, EneS2, EneR6, EneJ, EneL, EneS, EneU1, and EneU2. Ultimately, the enediyne BGC in Lentzea sp. JNUCC 0626 is composed of 38 proteins, spanning from protein XIJ15812 to protein XIJ15845, and is predicted to produce an enediyne core conjugated with a carbohydrate. However, the genes involved in the biosynthesis of sporolide’s cyclohexenone moiety, kedarcidin’s naphthonate moiety, or β-azatyrosine were not detected. Further studies involving natural product isolation will be necessary to explore the potential presence of new moieties in the Lentzea sp. JNUCC 0626 enediyne and its connection to the siderophore structure of the first BGC (Figure 7, Table S22).

BGC Region 9 Derived from Lentzea sp. JNUCC 0626

The BGC region 9 of Lentzea sp. JNUCC 0626 comprises several key components, as illustrated in Figure S14 and detailed in Table S23. This region includes one NRPS/PKS (protein XIJ15997), a Type I PKS consisting of KR and AT domains (protein XIJ16012), and two NRPSs (proteins XIJ16010 and XIJ16011). Additionally, it harbors over five regulatory genes of various types and more than three transporter proteins. Furthermore, region 9 features proteins characteristic of typical NRPS/PKS hybrid structures, including thioesterases (proteins XIJ15993 and XIJ16009), 3-oxoacyl-ACP synthase III (KAS III, proteins XIJ15991, XIJ16017, and XIJ16018), ACP (protein XIJ16020), MbtH family NRPS accessory protein (protein XIJ16015), and methylmalonyl-CoA epimerase (protein XIJ16021).

BGC Region 10 Derived from Lentzea sp. JNUCC 0626

The BGC region 10 of Lentzea sp. JNUCC 0626 comprises a hybrid gene cluster of Type I and Type III polyketide synthases. As shown in Table 3, bioinformatic analyses reveal that this region is related to known hybrid polyketides, such as kendomycin and venemycin [67,68,69]. Specifically, it includes a Type I PKS composed of two modules (XIJ19096), one module (XIJ16064), and three modules (XIJ16078), along with the biosynthetic enzymes for 3,5-dihydroxybenzoic acid (DpgA, DpgB, DpgC, and DpgD). Notably, an additional protein consisting of two modules and 2881 amino acids is located just downstream of XIJ19096, but it could not be found in the GenBank data (see Figure S15 and Table S24). We hypothesize that the biosynthesis of the Type I PKS in region 10 begins with the formation of 3,5-dihydroxybenzoic acid derivatives catalyzed by enzymes encoded by genes XIJ16057, XIJ16058, XIJ16059, and XIJ16076. These enzymes are homologous to DpgA-DpgD and are proposed to catalyze the formation of the 3,5-dihydroxybenzoic acid starter unit utilized by the Type I modular PKS for biarylpolyketide synthesis in Lentzea sp. JNUCC 0626 [70]. The XIJ16059 protein shares 65.6% and 68.0% identity with VemA and Ken2, respectively, which are Type III PKSs that catalyze the conversion of four malonyl-CoA molecules to (3,5-dihydroxyphenyl)acetyl-CoA in the BGCs of Streptomyces sp. S006 and Streptomyces violaceoruber. Proteins XIJ16076 and XIJ16057 are homologous to DpgB and DpgD, respectively, and are known to enhance the efficiency of the reactions catalyzed by DpgA. Protein XIJ16058 is homologous to DpgC, a cofactor-independent dioxygenase that contributes to the conversion of (3,5-dihydroxyphenyl)acetyl-CoA to (3,5-dihydroxyphenyl)oxoacetic acid. The (3,5-dihydroxyphenyl)glyoxylic acid produced by the DpgA-D proteins is a biosynthetic product with a conserved structure in actinobacteria that produce biarylpolyketides, which can be converted into the non-proteinogenic amino acid (3,5-dihydroxyphenyl)glycine, commonly found in antibiotics such as kendomycin and venemycin [67,68,69]. Additionally, it can be inferred that protein XIJ16079 catalyzes the thiamine diphosphate (TDP)-dependent decarboxylation of (3,5-dihydroxyphenyl)oxoacetic acid to yield 3,5-dihydroxybenzaldehyde. However, genes corresponding to aldehyde dehydrogenases that oxidize 3,5-dihydroxybenzaldehyde to 3,5-dihydroxybenzoic acid, such as VemF and Ken6, were not identified in the region 10 gene cluster. Macrolides synthesized by Type I modular PKS consist of macrocyclic lactones of varying ring sizes, to which one or more deoxy sugar or amino sugar residues are attached [71]. In this context, we further identified the presence of macrolide glycosyltransferase (protein XIJ16074) and three macrolide sugar-O-methyltransferases (proteins XIJ16072, XIJ16073, and XIJ16075) within BGC region 10. Ultimately, we conclude that the genes in BGC region 10 may play a role as starter units in the assembly of 18-membered polyketides with a single sugar moiety attached, synthesized by the Type I modular PKS.

BGC Region 11 Derived from Lentzea sp. JNUCC 0626

BGC region 11 contains a single modular PKS module with the 1907 proteins composed of KS-AT-DH-KR-TE domains. Analysis using data from repositories such as the MIBiG database through KnownClusterBlast revealed no significant similarity to previously characterized BGCs (Figure S16, Table S26).

BGC Region 12 Derived from Lentzea sp. JNUCC 0626

The BGC region 12 of Lentzea sp. JNUCC 0626 contains several key components, as depicted in Figure S17 and outlined in Table S27. This region includes three NRPS-related proteins (proteins XIJ16425, XIJ16428, and XIJ16433). In addition, it encompasses more than five regulatory genes of various types, one transporter protein, and an MbtH family protein (protein XIJ16429). Notably, region 12 is characterized by proteins associated with typical vancomycin resistance mechanisms, including vancomycin resistance histidine kinase VanS (protein XIJ16438), D-Ala-D-Ala dipeptidase VanX (protein XIJ16439), D-alanine-(R)-lactate ligase VanA-Sc (protein XIJ16440), and vancomycin resistance protein VanH (protein XIJ16441).

BGC Region 15 Derived from Lentzea sp. JNUCC 0626

The BGC region 15 of Lentzea sp. JNUCC 0626 consists of two key nonribosomal peptide synthetases (NRPSs), as illustrated in Figure S18 and detailed in Table S28. This region includes an NRPS comprising four modules (Ile-D-Val-D-Thr-Val) represented by protein XIJ17060, and another NRPS containing five modules (D-Vak-Orn-D-Orn-Orn-D-X) represented by protein XIJ17059. Additionally, this region harbors more than two regulatory genes of various types, one transporter protein, one β-lactamase, and an MbtH family protein (protein XIJ17062).

BGC Region 16 Derived from Lentzea sp. JNUCC 0626

Lentzea sp. JNUCC 0626 BGC region 16 comprises a large assembly of 10 modular PKS proteins, spanning proteins XIJ17218 to XIJ17225 and XIJ19137 (Figure S19 and Table S29). Specifically, protein XIJ17225 contains three modules (KS-AT/KS-AT-DH-KR/KS-AT-DH-KR), while protein XIJ17224 has one module (KS-AT). Protein XIJ17223 includes two modules (KS-AT/KS-AT/KR), protein XIJ17222 contains three modules (KS-AT-DH-KR/KS-AT-KR/KS-AT-DH-KR), and protein XIJ17221 consists of one module (KS-AT-DH-KR). Protein XIJ17220 has two modules (KS-AT-KR/KS-AT-KR(X)), protein XIJ19137 includes one module (KS-AT-DH-KR), protein XIJ17219 comprises two modules (KS-AT/KS-AT-DH-KR), and protein XIJ17218 contains two modules (KS-AT-DH-KR/KS-AT-DH-KR-TE). An additional Type I PKS exists between XIJ17222 and XIJ17223, originally found in the contig with 3428 amino acids, comprising two modules (KS-AT-KR/KS-AT-DH-ER-KR). However, in the GenBank annotation, it is divided into a Type I PKS with 2156 amino acids and six small protein fragments. Further sequence reanalysis and reannotation of this region appear necessary. In addition, three P450 proteins are present consecutively downstream of the modular PKS cluster.
Upstream of the Type I PKS cluster, we identified genes showing homology to queuosine biosynthesis genes (Figure S20, Table S29). However, unlike typical operon-like clusters, these queuosine biosynthesis genes are scattered throughout the region, with 6-carboxytetrahydropterin synthase QueD (protein 2813), GTP cyclohydrolase I (FolE, protein 2814), 7-cyano-7-deazaguanine synthase QueC (protein 2820), and 7-carboxy-7-deazaguanine synthase QueE (protein 2821) being dispersed. Given the absence of a densely packed queuosine BGC, we focused on the nucleoside toyocamycin BGC, which contains the queuosine precursor (Q0) structure [72]. As expected, the toyocamycin BGC exhibited high amino acid sequence homology with the queuosine biosynthesis proteins FolE, QueC, QueD, and QueE. Specifically, the homologous proteins were identified as ToyD (67.5% identity), ToyM (41.9%), ToyB (62.4%), and ToyC (57.6%). However, in BGC region 16, no genes related to the ribose moiety linked to the Q0 nitrogen-1 position of queuosine in toyocamycin were detected. Notably, between the FolE, QueC, QueD, and QueE proteins, several proteins were identified, including a GTP cyclohydrolase I (XIJ17237), an ATP-grasp domain-containing protein (XIJ17238), an MFS transporter (XIJ17239), a methyltransferase (XIJ17240), a diaminobutyrate-2-oxoglutarate transaminase (XIJ17241), and a 2-oxoglutarate and iron-dependent oxygenase domain-containing protein (XIJ17242). The presence of these proteins suggests the potential for novel nucleoside antibiotic biosynthesis.

BGC Region 17 Derived from Lentzea sp. JNUCC 0626

The antiSMASH analysis of the BGC 17 region of Lentzea sp. JNUCC 0626 predicted 32% similarity to the BGC responsible for producing funisamine, a very long-chain fatty acid [73]. As shown in Figure S21 and Table S30, BGC 17 harbors a large PKS I cluster with 27 modules, spanning 10 multifunctional proteins from protein XIJ17345 to XIJ17358 and XIJ19142. Additionally, the KR domain of the 12th module in protein XIJ17358 and all KR domains across the five modules in protein XIJ17357 were inferred to be inactive. Furthermore, a one-to-one comparison with the funisamine BGC revealed the following identities: protein XIJ17350, resembling agmatinase, shares 65.7% identity with FunS1; protein XIJ17351, similar to ACP S-malonyltransferase, shares 44.5% identity with FunS3; protein XIJ17352, similar to acyl-CoA ligase, shares 57.8% identity with FunS2; and protein XIJ17361, similar to tryptophan 2-monooxygenase, shares 67.9% identity with FunA13. However, no notable gene clusters, including those related to sugar biosynthesis, were identified. Based on these findings, we tentatively infer that BGC 17 may be involved in the production of a very long-chain fatty acid, similar to funisamine.

BGC Region 24 Derived from Lentzea sp. JNUCC 0626

The antiSMASH analysis of Lentzea sp. JNUCC 0626 region 24 revealed a BGC comprising 41 genes, including a Type II polyketide synthase (PKS) along with a significant number of tailoring enzymes. As illustrated in Figure 8 and Table S31, a notable observation is that 28 out of these 41 biosynthetic genes exhibited homology to the trioxacarcin (Txn) biosynthetic genes from S. bottropensis, while two genes displayed sequence similarity to aromatic PKS genes found in nogalamycin (Sno) biosynthesis in S. nogalater [74,75]. The remaining 11 genes within the BGC include IteE, which shares similarity with the TOMM precursor leader peptide-binding protein; IteX2, similar to a SagB/ThcOx family dehydrogenase; IteG, homologous to a flavodoxin family protein; IteX3, related to the DinB family protein; IteX5, similar to NAD(P)H-binding proteins; IteW, which resembles an amino acid adenylation domain-containing protein; and IteR2 and IteR3, which are sensor histidine kinases. Additionally, there are three genes annotated as hypothetical proteins: IteX1, IteX6, and IteX7. Interestingly, genes commonly associated with sugar biosynthesis and glycosyltransferases, which are typically found in trioxacarcin and nogalamycin clusters, were absent in this region. Therefore, based on the genetic makeup of BGC region 24, we hypothesize the potential production of an aromatic polyketide structurally related to the trioxacarcin aglycone.

BGC Region 33 Derived from Lentzea sp. JNUCC 0626

The antiSMASH analysis of BGC region 33 predicted a 77% structural similarity with the pacidamycin BGC. Pacidamycin are uridyl tetra/pentapeptide antibiotics that act on the translocase MraY, inhibiting bacterial cell wall assembly, and they share structural similarity with napsamycin and sansanmycin. The pacidamycin BGC encodes 22 proteins (PacA-V), including highly dissociated NRPS modules and various tailoring enzymes [76,77,78]. All of these proteins share a common structural framework, where a (2S,3S)-diaminobutyric acid (DABA) residue acts as a connection point for the 3-deoxyuridine moiety via a 4,5-enamide linkage. As shown in Figure 9 and Table S32, region 33 comprises 26 ORFs (proteins XIJ14076-XIJ14100), exhibiting significant amino acid sequence similarity with the pacidamycin, sansanmycin, and napsamycin gene clusters [79,80]. Specifically, 18 ORFs in this cluster show high amino acid homology with 18 ORFs from the pacidamycin BGC, excluding PamB (hypothetical protein), PamK (FAD-dependent oxidoreductase), PamL (peptide synthetase), and PamO (ATP-dependent adenylase). Additionally, protein XIJ14078, which is not found in the pacidamycin BGC, shares sequence similarity with napsamycin NpsC and a hypothetical protein from the sansanmycin cluster, both of which belong to the exonuclease/phosphatase family. Notably, an additional copy of genes corresponding to PacA (PamA2) and PacD (PamD2) of the pacidamycin BGC was identified downstream of the Pam BGC. This suggests that, if the cluster extends to include PamA2 and PamD2, it could potentially consist of more than 39 ORFs. In conclusion, the translocase MraY, a key enzyme in bacterial cell wall assembly, remains an underexplored target for the development of novel antibacterial agents. Therefore, isolating natural products associated with the Pam BGC and elucidating the enzymatic mechanisms involved in scaffold assembly could significantly contribute to the generation of new MraY-targeted peptidyl nucleoside antibiotics through combinatorial biosynthesis.

BGC Region 34 Derived from Lentzea sp. JNUCC 0626

In BGC region 34, we identified several genes involved in phenazine biosynthesis. As depicted in Figure S22, the core region contains homologs of PhzD, PhzE, PhzF, PhzG, and PhzM, which are centrally located. Additionally, upstream of the phenazine BGC, a Type I PKS gene is present, suggesting the potential for complex biosynthetic processes within this cluster. A detailed comparison of the phenazine gene cluster in region 34 with the Streptomyces anulatus phenazine gene cluster shows high sequence similarity, as outlined in Table S33 [81]. This comparison provides important insights into the evolutionary conservation and functional similarities between these clusters. Phenazine compounds are heterocyclic molecules containing nitrogen, known for their potent biological activities and significant potential in both agriculture and pharmaceuticals. Among these, phenazine-1-carboxylic acid (PCA) is one of the most widely studied compounds due to its antimicrobial properties [82]. Based on recent findings, it is plausible that Lentzea sp. JNUCC 0626 utilizes chorismic acid as the starting material, with the coordinated actions of PhzA/B, PhzD, PhzE, PhzF, and PhzG facilitating the production of PCA. Furthermore, PhzM is likely involved in the subsequent methylation step, leading to the formation of 5-methyl-PCA [83]. These findings suggest that the phenazine biosynthetic pathway in Lentzea sp. JNUCC 0626 may hold significant promise for the development of novel natural products. Future research aimed at elucidating this pathway in greater detail could unlock new opportunities for biotechnological applications, particularly in the areas of sustainable agriculture and drug discovery.

3.6.6. Other Gene Clusters

BGC Region 4 Derived from Lentzea sp. JNUCC 0626

The antiSMASH analysis of BGC region 4 revealed a low similarity (~7%) to the known platencin BGC, suggesting limited direct relevance to platencin analog production. Further KnownClusterBlast analysis found that protein XIJ15412 shares 51.3% amino acid sequence identity with MaoC/PaaZ C-terminal domain-containing protein (Ptn). Additionally, protein XIJ15443, located at the terminal end of region 4, demonstrated 54.31% identity to PtnO7, a member of the SDR family oxidoreductases [84]. Despite these findings, the genes in BGC region 4 showed higher similarity to those involved in steroid catabolism rather than secondary metabolite production, such as platencin, when compared to gene clusters found in Salinispora arenicola and Rhodococcus ruber Chol-4. Specifically, as illustrated in Supplementary Figure S23 and Table S34, most of the 34 proteins, from protein XIJ15410 to XIJ15443, are implicated in steroid degradation pathways [85,86]. This discovery opens up several biotechnological applications. For instance, 3-ketosteroid 9α-hydroxylase (protein XIJ15415) plays a pivotal role in catalyzing hydroxylation at the 9α-position of steroids, leading to the production of biologically active metabolites. This enzyme could be harnessed for developing customized pharmaceutical agents targeting specific steroidal compounds [87]. Moreover, the metabolic engineering of pathways involving these enzymes could enhance the production of steroids such as testosterone, further underscoring the potential for tailored steroid drug synthesis [88]. In addition to pharmaceutical applications, steroid degradation pathways may contribute to bioremediation by breaking down steroidal pollutants such as cholate in contaminated environments. Microbes capable of degrading steroid structures offer promising solutions for environmental cleanup [89]. Finally, enzymes involved in steroid metabolism hold the potential for synthetic biology applications, where they can be used to engineer novel metabolic pathways for the synthesis of non-natural steroid compounds. Modifying these metabolic routes could yield new biocatalysts suited to industrial applications, expanding the scope of biotechnological catalysts for steroid-related processes [90]. Thus, the steroid degradation genes identified in BGC region 4 hold significant promise for applications ranging from drug development and environmental remediation to industrial biocatalysis.

BGC Region 14 Derived from Lentzea sp. JNUCC 0626

BGC region 14 was initially predicted to contain genes involved in the biosynthesis of aryl polyenes (APEs). APEs are bacterial secondary metabolites that serve as pigments and protect cells from oxidative stress. Structurally, APEs consist of a polyene chain conjugated to an aromatic ring (aryl group), giving them both antioxidant properties and their characteristic vibrant color. Recent studies on the APE BGC in Escherichia coli CFT073, which is composed of 18 genes spanning 15.5 kb, confirmed that this cluster plays a critical role in APE biosynthesis. Heterologous expression experiments have successfully demonstrated the production of APEs from this BGC [91].
To investigate whether the BGC region 14 of Lentzea sp. JNUCC 0626 contains genes related to APE biosynthesis, we performed a one-by-one BLASTP search on the genes in the region. Our analysis aimed to identify homologs of known APE biosynthetic genes, such as acyl carrier proteins (ACPs), 3-hydroxyacyl-ACP dehydratases, and 3-ketoacyl-ACP synthases, which are typically essential for the production of APEs. As a result, we found that region 14 contains a XIJ16829 protein with homology to 3-oxoacyl-ACP synthase, a key enzyme in fatty acid biosynthesis. However, no other genes commonly associated with APE biosynthesis, including ACP, 3-hydroxyacyl-ACP dehydratases, or 3-ketoacyl-ACP synthases, were detected in this region (Figure S24, Table S35). This absence of key biosynthetic genes indicates that region 14 is unlikely to be involved in the biosynthesis of APEs. Consequently, we conclude that BGC region 14 does not participate in APE biosynthesis and is, instead, likely involved in a different biosynthetic or metabolic pathway.

BGC Region 18 Derived from Lentzea sp. JNUCC 0626

BGC region 18 was analyzed with antiSMASH, revealing a benzastatin cluster (Bez) that exhibits 100% similarity to a previously established cluster. The newly identified cluster contains 11 open reading frames (ORFs), as shown in Figure 10. The functional annotation of the genes within the ben cluster (Table S36) revealed high similarity with those of the bez cluster previously reported by Tsutsumi et al. [92]. The main difference between the ben and bez clusters is the presence of a 3-deoxy-D-arabinoheptulosonate 7-phosphate (DAHP) synthase gene (protein XIJ17687) in the ben cluster, which is thought to form an operon structure with BenJ. On the other hand, there is one NRPS present in the closely related upper region of the benzastatin BGC; however, the antiSMASH analysis predicted that the corresponding domain would be inactive.

BGC Region 27 Derived from Lentzea sp. JNUCC 0626

The antiSMASH analysis of BGC region 27 revealed an 80% structural similarity to the C-nucleoside antibiotic minimycin BGC. This significant similarity provides important insights into the biosynthetic pathways of minimycin- and indigoidine-like compounds. Minimycin, a C-nucleoside antibiotic structurally related to pseudouridine, exhibits notable biosynthetic parallels with indigoidine, a blue pigment produced by various bacteria, despite their distinct biosynthetic pathways [93,94]. Protein XIJ10315, identified as a nonribosomal peptide synthetase (NRPS), shares 55.6% sequence identity with minA from Streptomyces hygroscopicus strain JCM 4712 and 54.9% with indC from Streptomyces chromofuscus ATCC 49982. This finding aligns with previous studies indicating that the NRPS protein MinA plays a pivotal role in regulating the divergent biosynthesis of minimycin and indigoidine. These results support the hypothesis that MinA governs a biosynthetic “switch” between these two molecules, warranting further experimental validation. Additionally, protein XIJ10317 exhibits 70.9% and 69.4% identity to pseudouridine-5-phosphate glycosidases MinB and IndA, respectively, further confirming the shared features of these two biosynthetic pathways. Interestingly, protein XIJ10318, composed of 221 amino acids, differs from MinC and IndB, which contain 613 and 614 amino acids, respectively. MinC and IndB possess both an N-terminal HAD phosphatase domain and a C-terminal DUF4243 domain, whereas protein XIJ10318 contains only the N-terminal HAD phosphatase domain. This structural difference may imply a specialized function of protein XIJ10318 within the minimycin-like biosynthesis, potentially contributing to its unique regulatory mechanisms. Protein XIJ10319 shares 70.0% and 69.9% sequence identity with MinD and Orf2 (uracil phosphoribosyltransferase) from S. chromofuscus ATCC 49982 (Table 1), suggesting a conserved role in nucleoside metabolism. Additionally, protein XIJ10320 encodes a transporter protein, likely responsible for exporting the antibiotic out of the producer cell. Unlike the major facilitator superfamily (MFS) transporters typically associated with minimycin and indigoidine, protein XIJ10320 belongs to the EamA family of transporters. This difference suggests that the transport mechanisms of minimycin and indigoidine biosynthesis may be distinct, raising the possibility of novel self-resistance strategies within these pathways. Notably, downstream of the minimycin-like BGC in L. jejuensis, there are four transporter genes aligned in the reverse transcriptional direction, while upstream, a dihydrofolate reductase family protein (protein XIJ10321) and a regulatory gene encoding an AAA family ATPase (protein XIJ10322) are transcribed in the opposite direction (Figure S25, Table S37). Further investigation is required to determine whether these genes play a role in the biosynthesis of minimycin-like compounds in L. jejuensis and their contribution to the overall metabolic pathway. Additionally, fermentation-based studies aimed at isolating natural products from Lentzea sp. JNUCC 0626 will be essential to validate the biosynthetic potential of these gene clusters. This approach will not only confirm the production of minimycin-like compounds but also enhance the significance of this research by uncovering novel bioactive molecules with potential pharmaceutical applications.

BGC Region 28 Derived from Lentzea sp. JNUCC 0626

Pyrroloquinoline quinone (PQQ) is a redox-active cofactor that has garnered significant attention in biotechnology and medicine due to its diverse biological roles. A particularly interesting aspect of PQQ is its biosynthetic pathway, which is encoded by a cluster of genes located in BGC region 28. These genes collaborate intricately, each playing a vital role in the synthesis of PQQ. The first key gene, pqqA, encodes a precursor peptide essential for PQQ synthesis, serving as the foundational substrate. Following this, pqqE functions as an S-adenosylmethionine (SAM)-dependent enzyme. It catalyzes a critical radical reaction that forms a bond between glutamic acid and tyrosine within the PqqA precursor. Meanwhile, pqqD contributes by protecting the PqqA precursor peptide and facilitating efficient reactions through its interaction with PqqE. As the process continues, pqqB takes on the role of promoting the structural modifications of PqqA, initiating the initial oxidation process. Subsequently, pqqC catalyzes the oxidative reactions required for forming the cyclic structure of PQQ, ultimately leading to the generation of a complete PQQ molecule. Finally, pqqF is involved in the final processing of the PQQ precursor, ensuring that the completed PQQ is prepared for export outside the cell [95]. The biosynthetic pathway is visually represented in Figure S26 and Table S38, highlighting the sequential actions of these proteins: XIJ10688 (PqqA) → XIJ10691 (PqqE) → XIJ10690 (PqqD) → XIJ10692 (PqqB) → XIJ10689 (PqqC) → XIJ10687 (PqqF). Interestingly, adjacent to the pqqB gene in the PQQ operon of L. jejuensis, there exists a protein (XIJ10693) with high homology to the CdaR family transcriptional regulator. This gene may influence the expression of PQQ biosynthetic enzymes by binding to specific genes in the pathway, thus modulating transcriptional activation [96,97]. The BGC linked to PQQ biosynthesis offers numerous potential applications. By leveraging PQQ’s ability to generate electrochemical signals through specific enzyme reactions, it holds promise in the development of biosensors. Moreover, functional foods containing PQQ could significantly enhance immune function, provide anti-aging benefits, and offer cardiovascular and neuroprotective effects, contributing to the advancement of nutraceuticals and pharmaceuticals. In summary, future research endeavors should aim to deepen our understanding of the PQQ biosynthesis pathway. This knowledge will pave the way for genetic manipulation and enzyme engineering strategies to maximize PQQ production, ultimately facilitating its commercialization.

BGC Region 29 Derived from Lentzea sp. JNUCC 0626

In BGC region 29, an enzyme responsible for the biosynthesis of epsilon-poly-L-lysine (ε-PL), identified as protein XIJ12648, has been located (Figure S27, Table S39). ε-PL is a polymer synthesized by NRPS and consists of 25–35 L-lysine residues linked by isopeptide bonds. Unlike conventional NRPSs, this ε-PL-producing NRPS lacks condensation and thioesterase domains, instead containing adenylation and thiolation domains, along with six transmembrane and three soluble domains [98,99]. The BLASTP analysis revealed that this ε-PL synthase shares significant sequence identity (56.03%) and similarity (67.42%) with Streptomyces noursei ε-PL synthase (WP_205368663). Adjacent to this NRPS is protein XIJ12647, encoding an M1 family metallopeptidase, which is part of a zinc-dependent enzyme group known as aminopeptidase N (APN). This enzyme class typically cleaves amino acids from the N-terminus of peptides and contains a conserved zinc-binding motif (HEXXHX18E), essential for its catalytic activity [100,101]. Protein XIJ12647 also possesses this motif (321HELAH325X18E) and exhibits amino acid identity (40.57%) and similarity (51.02%) with S. noursei M1 family metallopeptidases (WP_205368662.1). The accumulation of ε-PL is regulated by both the NRPS and ε-PL-degrading enzymes. The activation of the degrading enzyme inhibits ε-PL accumulation, while the suppression of its expression increases ε-PL levels. This suggests that strategies to enhance ε-PL production could involve inhibiting the degrading enzyme or increasing NRPS expression via genetic modification [102]. Furthermore, four serine hydrolase genes (XIJ12654–XIJ12657) were found to be located seven proteins upstream of the ε-PL and M1 metallopeptidase genes. These enzymes belong to a group characterized by a serine residue in their catalytic site and are responsible for hydrolyzing ester, amide, and peptide bonds [103]. All four serine hydrolases in region 29 showed high homology to D-alanyl-D-alanine carboxypeptidases, which are involved in bacterial cell wall synthesis. While no direct link between these hydrolases and ε-PL resistance or degradation has been established, the functional interaction between these enzymes remains a potential area for further investigation.

BGC Region 30 Derived from Lentzea sp. JNUCC 0626

An analysis of the KnownClusterBlast results for BGC region 30 indicated that it exhibits approximately 3% lower structural similarity compared to the LL-D49194α1 BGC [104]. The protein encoded by gene XIJ12721 shares 51.42% identity and 65.91% similarity with lldRg2, a YafY family regulator of LL-D49194α1, while the protein encoded by gene XIJ12722 shows 51.43% identity and 62.86% similarity with lldO1, an extradiol dioxygenase from the VOC family (Figure S28, Table S40). However, no significant similarities were identified among the remaining genes located in region 30, including those related to LL-D49194α1 and other BGCs.

BGC Region 32 Derived from Lentzea sp. JNUCC 0626

The proteins XIJ14006 and XIJ14007 located in BGC region 32 exhibit low levels of amino acid homology to the IucA/IucC family proteins and IucA/IucC family siderophore biosynthesis proteins, which are components of the aerobactin biosynthesis operon iucABCD, as determined by BLASTP analysis (Figure S29, Table S41). IucA and IucC are known to catalyze distinct steps in the biosynthesis of aerobactin from N ε-acetyl-N ε-hydroxylysine and citrate [105]. According to recent studies, the enzymatic synthesis of aerobactin was reconstituted biochemically through the heterologous expression of the four genes in E. coli. The biosynthesis of aerobactin requires the activity of the acetyltransferase IucD and hydroxylase IucB to form N6-acetyl-N6-hydroxylysine (ahLys), followed by the sequential addition of two molecules of the hydroxamate intermediate ahLys to the primary carboxyl groups of citrate, catalyzed by IucA and IucC, to generate aerobactin [106,107]. However, no candidate genes corresponding to IucB and IucD are present in BGC region 32.

3.7. Anti-Inflammatory Capacity of Lentzea sp. JNUCC 0626

The RAW264.7 cell line, a murine macrophage model, is frequently employed to assess the safety and efficacy of anti-inflammatory drugs due to its strong inflammatory response to stimuli such as LPS, alongside its accessibility, ease of culture, and scalability for large-scale screening. Upon activation by various stimuli or cytokines secreted by immune cells, macrophages produce proinflammatory mediators such as nitric oxide (NO) and prostaglandin E2 (PGE2), which drive inflammation characterized by pain, swelling, redness, dysfunction, and fever [108,109]. These mediators also facilitate the migration of immune cells to inflamed areas. NO is synthesized from L-arginine by nitric oxide synthase (NOS), particularly the inducible form (iNOS), which is highly expressed in cells such as hepatocytes, smooth muscle cells, bone marrow cells, monocytes, and macrophages when stimulated by inflammatory cytokines or external factors [110]. Thus, we employed the RAW264.7 cell model to evaluate the inhibitory effects of JNUCC 0626 extract on NO production, which plays a key role in regulating proinflammatory mediators. To begin, cytotoxicity was assessed using the MTT assay, where JNUCC 0626 extract concentrations ranging from 6.3 to 200 µg/mL were tested. After 24 h of treatment with 1 µg/mL LPS, cell viability remained above 90% across all concentrations, indicating minimal cytotoxicity even at the highest dose of 200 µg/mL. Based on these results, further experiments were conducted using extract concentrations up to 200 µg/mL. The impact of JNUCC 0626 extract on NO production in LPS-induced RAW 264.7 cells was then measured using the Griess reagent assay. As shown in Figure 11, LPS treatment caused a significant increase in NO levels, nearly four times the baseline. However, JNUCC 0626 extract effectively inhibited NO production in a concentration-dependent manner in LPS-stimulated cells. These findings suggest that the EtOAc extract of JNUCC 0626 exhibits anti-inflammatory effects, and that various secondary metabolites inferred through the genome mining of JNUCC 0626 may be associated with this activity. Furthermore, these metabolites hold potential for future applications in the treatment of related diseases.

4. Conclusions

This study conducted an in-depth analysis of Lentzea sp. JNUCC 0626, focusing on its taxonomic classification, complete genome sequencing, and biosynthetic gene cluster (BGC) mining. The findings highlight the strain’s uniqueness and significant potential for biotechnological applications. The genome analysis revealed 34 BGCs, showcasing the strain’s capacity to produce a diverse range of bioactive compounds, including terpenes, indolocarbazoles, nucleosides, peptides, polyketides, and peptide–polyketide hybrids. These discoveries position Lentzea sp. JNUCC 0626 as a valuable genetic platform for the development of microbial factory systems, with promising implications for pharmacological and industrial applications.
From a taxonomic perspective, Lentzea jejuensis JNUCC 0626 exhibits sufficient genetic differentiation from existing Lentzea species, supported by ANI (average nucleotide identity) and dDDH (digital DNA-DNA hybridization) analyses. This evidence strongly suggests that the strain could be considered a novel species. Furthermore, its isolation from the unique Jeju Gotjawal environment reflects its distinctive ecological origin and adaptive traits, underscoring its importance as a new taxonomic entity.
Notably, the presence of plasmids in L. jejuensis JNUCC 0626 provides significant opportunities for the development of host–vector systems. These plasmids enable combinatorial biosynthesis, facilitating the efficient production of novel bioactive compounds and demonstrating the strain’s potential as a critical tool in microbial factory technologies for drug discovery and other biotechnological applications. Moreover, this study experimentally confirmed the anti-inflammatory activity of L. jejuensis JNUCC 0626 extracts, providing direct evidence of the bioactivity of secondary metabolites predicted through genome analysis. This highlights the strain’s potential as a valuable resource for natural product-based drug development.
Additionally, L. jejuensis JNUCC 0626 offers a promising platform for genetic engineering to enhance the production of specific compounds or the design of novel molecules. Its diverse BGCs make it an excellent candidate for combinatorial biosynthesis, enabling modifications of existing drugs or the synthesis of entirely new compounds. The identified BGCs also hold significant promise for addressing challenges such as antibiotic resistance and developing new anti-inflammatory agents.
This research establishes L. jejuensis JNUCC 0626 as a unique and promising biological and biotechnological resource, providing new possibilities for natural product-based drug development. Future studies on gene function characterization, metabolic pathway analysis, and the experimental validation of bioactive compounds will further enhance the strain’s industrial and pharmacological potential.

Supplementary Materials

The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/amh70010008/s1. Table S1. Comparison of mycelium of Lentzea sp. JNUCC 0626, Lentzea cavernae KCTC 39804, and Lentzea pudingi KCTC 39694 on various actinomycete media; Table S2. Cellular fatty acid composition of strain JNUCC 0626; Table S3. Biochemical characteristics of Lentzea sp. strain JNUCC 0626 analyzed using the API ZYM system; Table S4. De novo assembly annotation gene ontology (GO) of strain JNUCC 0626; Table S5. Pairwise comparisons of Lentzea sp. strain JNUCC 0626 against selected type strain genomes; Table S6. Average nucleotide identity (ANI) values of Lentzea sp. strain JNUCC 0626 compared to selected type strain genomes; Tables S7–S41. Genetic organization and BLASTP annotation of proteins in BGCs from Lentzea sp. JNUCC 0626; Figure S1. Results of polar lipids analysis conducted by Korean Culture Center of Microorganisms (KCCM); Figures S2–S29. Genetic organization of the BGCs within the Lentzea sp. JNUCC 0626 genome.

Author Contributions

Conceptualization, K.-A.H. and C.-G.H.; methodology, K.-A.H.; bioinformatic analyses, K.-A.H.; writing—original draft preparation, C.-G.H.; writing—review and editing, C.-G.H.; supervision, K.-H.B. and C.-G.H.; funding acquisition, C.-G.H. All authors have read and agreed to the published version of the manuscript.

Funding

This research was financially supported by the Ministry of Trade, Industry and Energy, Korea, under the “Regional Innovation Cluster Development Program (Non-R&D, P0024160)” supervised by the Korea Institute for Advancement of Technology (KIAT).

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

The whole genome of Lentzea sp. JNUCC 0626 has been deposited at the NCBI genome database under the accession numbers CP171635 and CP171636. The assembly reported in this paper is associated with NCBI BioProject: PRJNA1169381 and BioSample: SAMN44073283. The authors confirm that all of the data needed to support the study are represented within the article and Supplementary Materials.

Conflicts of Interest

The authors declare no conflicts of interest.

References

  1. Jagannathan, S.V.; Manemann, E.M.; Rowe, S.E.; Callender, M.C.; Soto, W. Marine Actinomycetes, New Sources of Biotechnological Products. Mar. Drugs. 2021, 19, 365. [Google Scholar] [CrossRef] [PubMed]
  2. Katz, L.; Baltz, R.H. Natural product discovery: Past, present, and future. J. Ind. Microbiol. Biotechnol. 2016, 43, 155–176. [Google Scholar] [CrossRef] [PubMed]
  3. Li, L. Accessing hidden microbial biosynthetic potential from underexplored sources for novel drug discovery. Biotechnol. Adv. 2023, 66, 108176. [Google Scholar] [CrossRef]
  4. Selim, M.S.M.; Abdelhamid, S.A.; Mohamed, S.S. Secondary metabolites and biodiversity of actinomycetes. J. Genet. Eng. Biotechnol. 2021, 19, 72. [Google Scholar] [CrossRef] [PubMed]
  5. Hemmerling, F.; Piel, J. Strategies to access biosynthetic novelty in bacterial genomes for drug discovery. Nat. Rev. Drug Discov. 2022, 21, 359–378. [Google Scholar] [CrossRef] [PubMed]
  6. van Bergeijk, D.A.; Terlouw, B.R.; Medema, M.H.; van Wezel, G.P. Ecology and genomics of Actinobacteria: New concepts for natural product discovery. Nat. Rev. Microbiol. 2020, 18, 546–558. [Google Scholar] [CrossRef]
  7. Girão, M.; Ribeiro, I.; Carvalho, M.d.F. Actinobacteria from Marine Environments: A Unique Source of Natural Products. In Natural Products from Actinomycetes: Diversity, Ecology and Drug Discovery; Springer: Berlin/Heidelberg, Germany, 2022; pp. 1–45. [Google Scholar]
  8. González-Salazar, L.A.; Quezada, M.; Rodríguez-Orduña, L.; Ramos-Aboites, H.; Capon, R.J.; Souza-Saldívar, V.; Barona-Gomez, F.; Licona-Cassani, C. Biosynthetic novelty index reveals the metabolic potential of rare actinobacteria isolated from highly oligotrophic sediments. Microb. Genom. 2023, 9, mgen000921. [Google Scholar] [CrossRef]
  9. van Santen, J.A.; Poynton, E.F.; Iskakova, D.; McMann, E.; Alsup, T.A.; Clark, T.N.; Fergusson, C.H.; Fewer, D.P.; Hughes, A.H.; McCadden, C.A.; et al. The Natural Products Atlas 2.0: A database of microbially-derived natural products. Nucleic Acids Res. 2022, 50, D1317–D1323. [Google Scholar] [CrossRef]
  10. Parra, J.; Beaton, A.; Seipke, R.F.; Wilkinson, B.; Hutchings, M.I.; Duncan, K.R. Antibiotics from rare actinomycetes, beyond the genus Streptomyces. Curr. Opin. Microbiol. 2023, 76, 102385. [Google Scholar] [CrossRef] [PubMed]
  11. Beck, M.L.; Song, S.; Shuster, I.E.; Miharia, A.; Walker, A.S. Diversity and taxonomic distribution of bacterial biosynthetic gene clusters predicted to produce compounds with therapeutically relevant bioactivities. J. Ind. Microbiol. Biotechnol. 2023, 50, kuad024. [Google Scholar] [CrossRef]
  12. Maiti, P.K.; Mandal, S. Comprehensive genome analysis of Lentzea reveals repertoire of polymer-degrading enzymes and bioactive compounds with clinical relevance. Sci. Rep. 2022, 12, 8409. [Google Scholar] [CrossRef] [PubMed]
  13. Albarano, L.; Esposito, R.; Ruocco, N.; Costantini, M. Genome Mining as New Challenge in Natural Products Discovery. Mar. Drugs. 2020, 18, 199. [Google Scholar] [CrossRef]
  14. Aborode, A.T.; Awuah, W.A.; Mikhailova, T.; Abdul-Rahman, T.; Pavlock, S.; Kundu, M.; Yarlagadda, R.; Pustake, M.; Correia, I.F.D.S.; Mehmood, Q.; et al. OMICs Technologies for Natural Compounds-based Drug Development. Curr. Top. Med. Chem. 2022, 22, 1751–1765. [Google Scholar] [CrossRef]
  15. Zhang, H.W.; Lv, C.; Zhang, L.J.; Guo, X.; Shen, Y.W.; Nagle, D.G.; Zhou, Y.D.; Liu, S.H.; Zhang, W.D.; Luan, X. Application of omics- and multi-omics-based techniques for natural product target discovery. Biomed. Pharmacother. 2021, 141, 111833. [Google Scholar] [CrossRef]
  16. Espinosa, E.; Bautista, R.; Larrosa, R.; Plata, O. Advancements in long-read genome sequencing technologies and algorithms. Genomics 2024, 116, 110842. [Google Scholar] [CrossRef] [PubMed]
  17. Rajwani, R.; Ohlemacher, S.I.; Zhao, G.; Liu, H.B.; Bewley, C.A. Genome-Guided Discovery of Natural Products through Multiplexed Low-Coverage Whole-Genome Sequencing of Soil Actinomycetes on Oxford Nanopore Flongle. mSystems 2021, 6, e0102021. [Google Scholar] [CrossRef] [PubMed]
  18. Biermann, F.; Wenski, S.L.; Helfrich, E.J.N. Navigating and expanding the roadmap of natural product genome mining tools. Beilstein J. Org. Chem. 2022, 18, 1656–1671. [Google Scholar] [CrossRef] [PubMed]
  19. Malit, J.J.L.; Leung, H.Y.C.; Qian, P.Y. Targeted Large-Scale Genome Mining and Candidate Prioritization for Natural Product Discovery. Mar. Drugs. 2022, 20, 398. [Google Scholar] [CrossRef] [PubMed]
  20. Medema, M.H.; de Rond, T.; Moore, B.S. Mining genomes to illuminate the specialized chemistry of life. Nat. Rev. Genet. 2021, 22, 553–571. [Google Scholar] [CrossRef]
  21. Hong, C.Y.; Yoon, R.; Hwang, J.D.; Jwa, M.S. Exploring Community Symbiotic Tourism Programs for the Utilization and Conservation of Ecology in Lava Stony Forest (Gotjawal) of Jeju Island, Korea. Sustainability 2020, 12, 8371. [Google Scholar] [CrossRef]
  22. Kim, J.S.; Kim, D.S.; Lee, K.C.; Lee, J.S.; King, G.M.; Kang, S. Microbial community structure and functional potential of lava-formed Gotjawal soils in Jeju, Korea. PLoS ONE 2018, 13, e0204761. [Google Scholar] [CrossRef] [PubMed]
  23. Hernández, M.; Calabi, M.; Conrad, R.; Dumont, M.G. Analysis of the microbial communities in soils of different ages following volcanic eruptions. Pedosphere 2020, 30, 126–134. [Google Scholar] [CrossRef]
  24. Kim, K.K.; Lee, K.C.; Eom, M.K.; Kim, J.S.; Kim, D.S.; Ko, S.H.; Lee, J.S. Variibacter gotjawalensis gen. nov., sp. nov., isolated from soil of a lava forest. Antonie Van Leeuwenhoek 2014, 105, 915–924. [Google Scholar] [CrossRef]
  25. Kim, M.; Cha, I.T.; Lee, K.E.; Park, S.J. Chryseobacterium gotjawalense sp. nov. Isolated from Soil in the Volcanic Forest Gotjawal, Jeju Island. Curr. Microbiol. 2024, 81, 187. [Google Scholar] [CrossRef] [PubMed]
  26. Um, S.; Lee, J.; Kim, S.H. Lobophorin Producing Endophytic Streptomyces olivaceus JB1 Associated With Maesa japonica (Thunb.) Moritzi & Zoll. Front. Microbiol. 2022, 13, 881253. [Google Scholar] [CrossRef]
  27. Hyun, K.A.; Xu, Y.; Boo, K.H.; Hyun, C.G. 1-Acetyl-β-Carboline from a Jeju Gotjawal Strain Lentzea sp. JNUCC 0626 and Its Melanogenic Stimulating Activity in B16F10 Melanoma Cells. Molecules 2024, 29, 4586. [Google Scholar] [CrossRef]
  28. Li, X.; Zhang, L.; Huang, F.; Zhao, J.; Wang, H.; Jiao, Y.; Qian, L.; Wang, X.; Xiang, W. Microbacterium helvum sp. nov., a novel actinobacterium isolated from cow dung. Arch. Microbiol. 2021, 203, 3287–3294. [Google Scholar] [CrossRef]
  29. Hu, H.Y.; Lim, B.R.; Goto, N.; Bhupathiraju, V.K.; Fujie, K. Characterization of microbial community in an activated sludge process treating domestic wastewater using quinone profiles. Water Sci. Technol. 2001, 43, 99–106. [Google Scholar] [CrossRef] [PubMed]
  30. Minnikin, D.E.; Minnikin, S.M.; Parlett, J.H.; Goodfellow, M.; Magnusson, M. Mycolic acid patterns of some species of Mycobacterium. Arch. Microbiol. 1984, 139, 225–231. [Google Scholar] [CrossRef] [PubMed]
  31. Koren, S.; Walenz, B.P.; Berlin, K.; Miller, J.R.; Bergman, N.H.; Phillippy, A.M. Canu: Scalable and accurate long-read assembly via adaptive k-mer weighting and repeat separation. Genome Res. 2017, 27, 722–736. [Google Scholar] [CrossRef] [PubMed]
  32. Hunt, M.; Silva, N.D.; Otto, T.D.; Parkhill, J.; Keane, J.A.; Harris, S.R. Circlator: Automated circularization of genome assemblies using long sequencing reads. Genome Biol. 2015, 16, 294. [Google Scholar] [CrossRef] [PubMed]
  33. Tatusova, T.; DiCuccio, M.; Badretdin, A.; Chetvernin, V.; Nawrocki, E.P.; Zaslavsky, L.; Lomsadze, A.; Pruitt, K.D.; Borodovsky, M.; Ostell, J. NCBI prokaryotic genome annotation pipeline. Nucleic Acids Res. 2016, 44, 6614–6624. [Google Scholar] [CrossRef]
  34. Meier-Kolthoff, J.P.; Carbasse, J.S.; Peinado-Olarte, R.L.; Göker, M. TYGS and LPSN: A database tandem for fast and re-liable genome-based classification and nomenclature of prokaryotes. Nucleic Acids Res. 2022, 50, D801–D807. [Google Scholar] [CrossRef]
  35. Chalita, M.; Kim, Y.O.; Park, S.; Oh, H.S.; Cho, J.H.; Moon, J.; Baek, N.; Moon, C.; Lee, K.; Yang, J.; et al. EzBioCloud: A genome-driven database and platform for microbiome identification and discovery. Int. J. Syst. Evol. Microbiol. 2024, 74, 006421. [Google Scholar] [CrossRef] [PubMed]
  36. Blin, K.; Shaw, S.; Augustijn, H.E.; Reitz, Z.L.; Biermann, F.; Alanjary, M.; Fetter, A.; Terlouw, B.R.; Metcalf, W.W.; Helfrich, E.J.N.; et al. antiSMASH 7.0: New and improved predictions for detection, regulation, chemical structures and visualisation. Nucleic Acids Res. 2023, 51, W46–W50. [Google Scholar] [CrossRef]
  37. van Heel, A.J.; de Jong, A.; Song, C.; Viel, J.H.; Kok, J.; Kuipers, O.P. BAGEL4: A user-friendly web server to thoroughly mine RiPPs and bacteriocins. Nucleic Acids Res. 2018, 46, W278–W281. [Google Scholar] [CrossRef] [PubMed]
  38. Skinnider, M.A.; Johnston, C.W.; Gunabalasingam, M.; Merwin, N.J.; Kieliszek, A.M.; MacLellan, R.J.; Li, H.; Ranieri, M.R.M.; Webster, A.L.H.; Cao, M.P.T.; et al. Comprehensive prediction of secondary metabolite structure and biological activity from microbial genome sequences. Nat. Commun. 2020, 11, 6058. [Google Scholar] [CrossRef]
  39. Deng, A.; Fu, L.; Mo, P.; Zheng, Y.; Tang, T.; Gao, J. New insights into the relationship between the average nucleotide identity and the digital DNA-DNA hybridization values in the genus Amycolatopsis and Amycolatopsis cynarae sp. nov., a novel actinobacterium from the rhizosphere soil of Cynara scolymus, and proposal of Amycolatopsis niigatensis as a synonym of Amycolatopsis echigonensis based on comparative genomic analysis. Front. Microbiol. 2024, 15, 1359021. [Google Scholar] [CrossRef]
  40. Alvarez-Martinez, C.E.; Christie, P.J. Biological diversity of prokaryotic type IV secretion systems. Microbiol. Mol. Biol. Rev. 2009, 73, 775–808. [Google Scholar] [CrossRef] [PubMed]
  41. Kohler, V.; Keller, W.; Grohmann, E. Regulation of Gram-Positive Conjugation. Front. Microbiol. 2019, 10, 1134. [Google Scholar] [CrossRef]
  42. McLean, T.C.; Le, T.B. CTP switches in ParABS-mediated bacterial chromosome segregation and beyond. Curr. Opin. Microbiol. 2023, 73, 102289. [Google Scholar] [CrossRef] [PubMed]
  43. Feng, Y.; Qaseem, A.; Moumbock, A.F.A.; Pan, S.; Kirchner, P.A.; Simoben, C.V.; Malange, Y.I.; Babiaka, S.B.; Gao, M.; Günther, S. StreptomeDB 4.0: A comprehensive database of streptomycetes natural products enriched with protein interactions and interactive spectral visualization. Nucleic. Acids Res. 2024, 53, gkae1030. [Google Scholar] [CrossRef]
  44. Hyun, K.A.; Kim, S.Y.; Boo, K.H.; Chi, W.J.; Hyun, C.G. Complete Genome Sequence of the Butirosin-Producing Bacillus vitellinus NBRC 13296 and Its Reclassification to Paenibacillus chitinolyticus. Microbiol. Res. 2024, 15, 1747. [Google Scholar] [CrossRef]
  45. Hyun, K.A.; Liang, X.; Xu, Y.; Kim, S.Y.; Boo, K.H.; Park, J.S.; Chi, W.J.; Hyun, C.G. Analysis of the Setomimycin Biosynthetic Gene Cluster from Streptomyces nojiriensis JCM3382 and Evaluation of Its α-Glucosidase Inhibitory Activity Using Molecular Docking and Molecular Dynamics Simulations. Int. J. Mol. Sci. 2024, 25, 10758. [Google Scholar] [CrossRef] [PubMed]
  46. Kschowak, M.J.; Maier, F.; Wortmann, H.; Buchhaupt, M. Analyzing and Engineering the Product Selectivity of a 2-Methylenebornane Synthase. ACS Synth. Biol. 2020, 9, 981–986. [Google Scholar] [CrossRef]
  47. Andreas, M.P.; Giessen, T.W. The biosynthesis of the odorant 2-methylisoborneol is compartmentalized inside a protein shell. bioRxiv 2024. [Google Scholar] [CrossRef] [PubMed]
  48. Hayashi, S.; Ozaki, T.; Asamizu, S.; Ikeda, H.; Ōmura, S.; Oku, N.; Igarashi, Y.; Tomoda, H.; Onaka, H. Genome mining reveals a minimum gene set for the biosynthesis of 32-membered macrocyclic thiopeptides lactazoles. Chem. Biol. 2014, 21, 679–688. [Google Scholar] [CrossRef]
  49. Yang, X.; Wu, L.; Ran, Y.; Xu, A.; Zhang, B.; Yang, X.; Zhang, R.; Rao, Z.; Li, J. Crystal structure of l-glutamate N-acetyltransferase ArgA from Mycobacterium tuberculosis. Biochim. Biophys. Acta Proteins Proteom. 2017, 1865, 1800–1807. [Google Scholar] [CrossRef]
  50. Ayikpoe, R.S.; Zhu, L.; Chen, J.Y.; Ting, C.P.; van der Donk, W.A. Macrocyclization and Backbone Rearrangement During RiPP Biosynthesis by a SAM-Dependent Domain-of-Unknown-Function 692. ACS Cent. Sci. 2023, 9, 1008–1018. [Google Scholar] [CrossRef]
  51. Kim, S.; Lee, K.; Park, S.H.; Kwak, G.H.; Kim, M.S.; Kim, H.Y.; Hwang, K.Y. Structural Insights into a Bifunctional Peptide Methionine Sulfoxide Reductase MsrA/B Fusion Protein from Helicobacter pylori. Antioxidants 2021, 10, 389. [Google Scholar] [CrossRef]
  52. Eslami, S.M.; van der Donk, W.A. Proteases Involved in Leader Peptide Removal during RiPP Biosynthesis. ACS Bio. Med. Chem. Au 2023, 4, 20–36. [Google Scholar] [CrossRef] [PubMed]
  53. Chang, F.Y.; Brady, S.F. Cloning and characterization of an environmental DNA-derived gene cluster that encodes the biosynthesis of the antitumor substance BE-54017. J. Am. Chem. Soc. 2011, 133, 9996–9999. [Google Scholar] [CrossRef]
  54. Maleckis, M.; Wibowo, M.; Williams, S.E.; Gotfredsen, C.H.; Sigrist, R.; Souza, L.D.O.; Cowled, M.S.; Charusanti, P.; Gren, T.; Saha, S.; et al. Maramycin, a Cytotoxic Isoquinolinequinone Terpenoid Produced through Heterologous Expression of a Bifunctional Indole Prenyltransferase/Tryptophan Indole-Lyase in S. albidoflavus. ACS Chem. Biol. 2024, 19, 1303–1310. [Google Scholar] [CrossRef] [PubMed]
  55. Olasz, F.; Szabó, M.; Veress, A.; Bibó, M.; Kiss, J. The dynamic network of IS30 transposition pathways. PLoS ONE 2022, 17, e0271414. [Google Scholar] [CrossRef] [PubMed]
  56. Lysnyansky, I.; Calcutt, M.J.; Ben-Barak, I.; Ron, Y.; Levisohn, S.; Methé, B.A.; Yogev, D. Molecular characterization of newly identified IS3, IS4 and IS30 insertion sequence-like elements in Mycoplasma bovis and their possible roles in genome plasticity. FEMS Microbiol. Lett. 2009, 294, 172–182. [Google Scholar] [CrossRef]
  57. Sansevere, E.A.; Robinson, D.A. Staphylococci on ICE: Overlooked agents of horizontal gene transfer. Mob. Genet. Elem. 2017, 7, 1–10. [Google Scholar] [CrossRef] [PubMed]
  58. El Gharniti, F.; Dols-Lafargue, M.; Bon, E.; Claisse, O.; Miot-Sertier, C.; Lonvaud, A.; Le Marrec, C. IS30 elements are mediators of genetic diversity in Oenococcus oeni. Int. J. Food Microbiol. 2012, 158, 14–22. [Google Scholar] [CrossRef]
  59. Olucha, J.; Lamb, A.L. Mechanistic and structural studies of the N-hydroxylating flavoprotein monooxygenases. Bioorg. Chem. 2011, 39, 171–177. [Google Scholar] [CrossRef]
  60. Lewis, J.A.; Escalante-Semerena, J.C. The FAD-dependent tricarballylate dehydrogenase (TcuA) enzyme of Salmonella enterica converts tricarballylate into cis-aconitate. J. Bacteriol. 2006, 188, 5479–5486. [Google Scholar] [CrossRef] [PubMed]
  61. Liu, Z.; Huang, T.; Shi, Q.; Deng, Z.; Lin, S. Catechol siderophores framed on 2,3-dihydroxybenzoyl-L-serine from Streptomyces varsoviensis. Front. Microbiol. 2023, 14, 1182449. [Google Scholar] [CrossRef]
  62. Lu, P.; Dong, X.; Ji, X. Cronobacter sakazakii Pyridoxal Kinase PdxY Mediated by TreR and pESA3 Is Essential for Vitamin B6 (PLP) Maintenance and Virulence. Appl. Environ. Microbiol. 2023, 89, e0092423. [Google Scholar] [CrossRef] [PubMed]
  63. McGlinchey, R.P.; Nett, M.; Moore, B.S. Unraveling the biosynthesis of the sporolide cyclohexenone building block. J. Am. Chem. Soc. 2008, 130, 2406–2407. [Google Scholar] [CrossRef]
  64. Liang, M.H.; Zhu, J.; Jiang, J.G. Carotenoids biosynthesis and cleavage related genes from bacteria to plants. Crit. Rev. Food Sci. Nutr. 2018, 58, 2314–2333. [Google Scholar] [CrossRef]
  65. Han, E.J.; Seyedsayamdost, M.R. Genome mining for new enediyne antibiotics. Curr. Opin. Chem. Biol. 2024, 81, 102481. [Google Scholar] [CrossRef] [PubMed]
  66. Lohman, J.R.; Huang, S.X.; Horsman, G.P.; Dilfer, P.E.; Huang, T.; Chen, Y.; Wendt-Pienkowski, E.; Shen, B. Cloning and sequencing of the kedarcidin biosynthetic gene cluster from Streptoalloteichus sp. ATCC 53650 revealing new insights into biosynthesis of the enediyne family of antitumor antibiotics. Mol. Biosyst. 2013, 9, 478–491. [Google Scholar] [CrossRef]
  67. Thanapipatsiri, A.; Gomez-Escribano, J.P.; Song, L.; Bibb, M.J.; Al-Bassam, M.; Chandra, G.; Thamchaipenet, A.; Challis, G.L.; Bibb, M.J. Discovery of Unusual Biaryl Polyketides by Activation of a Silent Streptomyces venezuelae Biosynthetic Gene Cluster. ChemBioChem. 2016, 17, 2189–2198. [Google Scholar] [CrossRef]
  68. Song, R.; Shi, H.; Zhu, J.; Wang, H.; Shen, Y. A Single-Component Flavoenzyme Catalyzed Regioselective Halogenation of Pyrone in the Biosynthesis of Venemycins. ACS Chem. Biol. 2019, 14, 2533–2537. [Google Scholar] [CrossRef] [PubMed]
  69. Chen, J.; Zhang, S.; Chen, Y.; Tian, X.; Gu, Y.; Ju, J. Identification and Heterologous Expression of the Kendomycin B Biosynthetic Gene Cluster from Verrucosispora sp. SCSIO 07399. Mar. Drugs. 2021, 19, 673. [Google Scholar] [CrossRef] [PubMed]
  70. Lacey, H.J.; Chen, R.; Vuong, D.; Lacey, E.; Rutledge, P.J.; Chooi, Y.H.; Piggott, A.M.; Booth, T.J. Resorculins: Hybrid polyketide macrolides from Streptomyces sp. MST-91080. Org. Biomol. Chem. 2023, 21, 2531–2538. [Google Scholar] [CrossRef]
  71. Dinos, G.P. The macrolide antibiotic renaissance. Br. J. Pharmacol. 2017, 174, 2967–2983. [Google Scholar] [CrossRef]
  72. McCarty, R.M.; Bandarian, V. Deciphering deazapurine biosynthesis: Pathway for pyrrolopyrimidine nucleosides toyocamycin and sangivamycin. Chem. Biol. 2008, 15, 790–798. [Google Scholar] [CrossRef] [PubMed]
  73. Covington, B.C.; Spraggins, J.M.; Ynigez-Gutierrez, A.E.; Hylton, Z.B.; Bachmann, B.O. Response of Secondary Metabolism of Hypogean Actinobacterial Genera to Chemical and Biological Stimuli. Appl. Environ. Microbiol. 2018, 84, e01125-18. [Google Scholar] [CrossRef] [PubMed]
  74. Zhang, M.; Hou, X.F.; Qi, L.H.; Yin, Y.; Li, Q.; Pan, H.X.; Chen, X.Y.; Tang, G.L. Biosynthesis of trioxacarcin revealing a different starter unit and complex tailoring steps for type II polyketide synthase. Chem. Sci. 2015, 6, 3440–3447. [Google Scholar] [CrossRef] [PubMed]
  75. Torkkell, S.; Ylihonko, K.; Hakala, J.; Skurnik, M.; Mäntsälä, P. Characterization of Streptomyces nogalater genes encoding enzymes involved in glycosylation steps in nogalamycin biosynthesis. Mol. Gen. Genet. 1997, 256, 203–209. [Google Scholar] [CrossRef] [PubMed]
  76. Rackham, E.J.; Grüschow, S.; Ragab, A.E.; Dickens, S.; Goss, R.J. Pacidamycin biosynthesis: Identification and heterologous expression of the first uridyl peptide antibiotic gene cluster. ChemBioChem. 2010, 11, 1700–1709. [Google Scholar] [CrossRef]
  77. Zhang, W.; Ostash, B.; Walsh, C.T. Identification of the biosynthetic gene cluster for the pacidamycin group of peptidyl nucleoside antibiotics. Proc. Natl. Acad. Sci. USA 2010, 107, 16828–16833. [Google Scholar] [CrossRef]
  78. Zhang, W.; Ntai, I.; Bolla, M.L.; Malcolmson, S.J.; Kahne, D.; Kelleher, N.L.; Walsh, C.T. Nine enzymes are required for assembly of the pacidamycin group of peptidyl nucleoside antibiotics. J. Am. Chem. Soc. 2011, 133, 5240–5243. [Google Scholar] [CrossRef] [PubMed]
  79. Li, Q.; Wang, L.; Xie, Y.; Wang, S.; Chen, R.; Hong, B. SsaA, a member of a novel class of transcriptional regulators, controls sansanmycin production in Streptomyces sp. strain SS through a feedback mechanism. J. Bacteriol. 2013, 195, 2232–2243. [Google Scholar] [CrossRef] [PubMed]
  80. Kaysser, L.; Tang, X.; Wemakor, E.; Sedding, K.; Hennig, S.; Siebenberg, S.; Gust, B. Identification of a napsamycin biosynthesis gene cluster by genome mining. ChemBioChem 2011, 12, 477–487. [Google Scholar] [CrossRef] [PubMed]
  81. Saleh, O.; Gust, B.; Boll, B.; Fiedler, H.P.; Heide, L. Aromatic prenylation in phenazine biosynthesis: Dihydrophenazine-1-carboxylate dimethylallyltransferase from Streptomyces anulatus. J. Biol. Chem. 2009, 284, 14439–14447. [Google Scholar] [CrossRef]
  82. Bauman, K.D.; Li, J.; Murata, K.; Mantovani, S.M.; Dahesh, S.; Nizet, V.; Luhavaya, H.; Moore, B.S. Refactoring the Cryptic Streptophenazine Biosynthetic Gene Cluster Unites Phenazine, Polyketide, and Nonribosomal Peptide Biochemistry. Cell Chem. Biol. 2019, 26, 724–736. [Google Scholar] [CrossRef]
  83. Huang, W.; Wan, Y.; Su, H.; Zhang, Z.; Liu, Y.; Sadeeq, M.; Xian, M.; Feng, X.; Xiong, P.; Hou, F. Recent Advances in Phenazine Natural Products: Biosynthesis and Metabolic Engineering. J. Agric. Food Chem. 2024, 72, 21364–21379. [Google Scholar] [CrossRef] [PubMed]
  84. Smanski, M.J.; Casper, J.; Peterson, R.M.; Yu, Z.; Rajski, S.R.; Shen, B. Expression of the platencin biosynthetic gene cluster in heterologous hosts yielding new platencin congeners. J. Nat. Prod. 2012, 75, 2158–2167. [Google Scholar] [CrossRef] [PubMed]
  85. Maldonado, L.A.; Fenical, W.; Jensen, P.R.; Kauffman, C.A.; Mincer, T.J.; Ward, A.C.; Bull, A.T.; Goodfellow, M. Salinispora arenicola gen. nov., sp. nov. and Salinispora tropica sp. nov., obligate marine actinomycetes belonging to the family Micromonosporaceae. Int. J. Syst. Evol. Microbiol. 2005, 55, 1759–1766. [Google Scholar] [CrossRef] [PubMed]
  86. Fernández de Las Heras, L.; Alonso, S.; de la Vega de León, A.; Xavier, D.; Perera, J.; Navarro Llorens, J.M. Draft Genome Sequence of the Steroid Degrader Rhodococcus ruber Strain Chol-4. Genome Announc. 2013, 1, e00215-13. [Google Scholar] [CrossRef] [PubMed]
  87. Baldanta, S.; Navarro Llorens, J.M.; Guevara, G. Further Studies on the 3-Ketosteroid 9α-Hydroxylase of Rhodococcus ruber Chol-4, a Rieske Oxygenase of the Steroid Degradation Pathway. Microorganisms 2021, 9, 1171. [Google Scholar] [CrossRef] [PubMed]
  88. Guevara, G.; Olortegui Flores, Y.; Fernández de Las Heras, L.; Perera, J.; Navarro Llorens, J.M. Metabolic engineering of Rhodococcus ruber Chol-4: A cell factory for testosterone production. PLoS ONE 2019, 14, e0220492. [Google Scholar] [CrossRef]
  89. Mohn, W.W.; Wilbrink, M.H.; Casabon, I.; Stewart, G.R.; Liu, J.; van der Geize, R.; Eltis, L.D. Gene cluster encoding cholate catabolism in Rhodococcus spp. J. Bacteriol. 2012, 194, 6712–6719. [Google Scholar] [CrossRef]
  90. Guevara, G.; Castillo Lopez, M.; Alonso, S.; Perera, J.; Navarro-Llorens, J.M. New insights into the genome of Rhodococcus ruber strain Chol-4. BMC Genom. 2019, 20, 332. [Google Scholar] [CrossRef]
  91. Johnston, I.; Osborn, L.J.; Markley, R.L.; McManus, E.A.; Kadam, A.; Schultz, K.B.; Nagajothi, N.; Ahern, P.P.; Brown, J.M.; Claesen, J. Identification of essential genes for Escherichia coli aryl polyene biosynthesis and function in biofilm formation. npj Biofilms Microbiomes 2021, 7, 56. [Google Scholar] [CrossRef]
  92. Tsutsumi, H.; Katsuyama, Y.; Izumikawa, M.; Takagi, M.; Fujie, M.; Satoh, N.; Shin-Ya, K.; Ohnishi, Y. Unprecedented Cyclization Catalyzed by a Cytochrome P450 in Benzastatin Biosynthesis. J. Am. Chem. Soc. 2018, 140, 6631–6639. [Google Scholar] [CrossRef] [PubMed]
  93. Kong, L.; Xu, G.; Liu, X.; Wang, J.; Tang, Z.; Cai, Y.S.; Shen, K.; Tao, W.; Zheng, Y.; Deng, Z.; et al. Divergent Biosynthesis of C-Nucleoside Minimycin and Indigoidine in Bacteria. iScience 2019, 22, 430–440. [Google Scholar] [CrossRef] [PubMed]
  94. Yu, D.; Xu, F.; Valiente, J.; Wang, S.; Zhan, J. An indigoidine biosynthetic gene cluster from Streptomyces chromofuscus ATCC 49982 contains an unusual IndB homologue. J. Ind. Microbiol. Biotechnol. 2013, 40, 159–168. [Google Scholar] [CrossRef] [PubMed]
  95. Zhu, W.; Klinman, J.P. Biogenesis of the peptide-derived redox cofactor pyrroloquinoline quinone. Curr. Opin. Chem. Biol. 2020, 59, 93–103. [Google Scholar] [CrossRef]
  96. Cordell, G.A.; Daley, S.K. Pyrroloquinoline Quinone Chemistry, Biology, and Biosynthesis. Chem. Res. Toxicol. 2022, 35, 355–377. [Google Scholar] [CrossRef] [PubMed]
  97. Gao, H.; Wang, Y.; Yang, J.; Qiu, M.; Lei, Z.; Zhang, W.; Jiang, W.; Xin, F.; Jiang, M. Microbial synthesis of pyrroloquinoline quinone. World J. Microbiol. Biotechnol. 2023, 40, 31. [Google Scholar] [CrossRef]
  98. Okamoto, T.; Yamanaka, K.; Hamano, Y.; Nagano, S.; Hino, T. Crystal structure of the adenylation domain from an ε-poly-l-lysine synthetase provides molecular mechanism for substrate specificity. Biochem. Biophys. Res. Commun. 2022, 596, 43–48. [Google Scholar] [CrossRef] [PubMed]
  99. Yamanaka, K.; Maruyama, C.; Takagi, H.; Hamano, Y. Epsilon-poly-L-lysine dispersity is controlled by a highly unusual nonribosomal peptide synthetase. Nat. Chem. Biol. 2008, 4, 766–772. [Google Scholar] [CrossRef]
  100. Kito, M.; Takimoto, R.; Yoshida, T.; Nagasawa, T. Purification and characterization of an epsilon-poly-L-lysine-degrading enzyme from an epsilon-poly-L-lysine-producing strain of Streptomyces albulus. Arch. Microbiol. 2002, 178, 325–330. [Google Scholar] [CrossRef]
  101. Agrawal, R.; Goyal, V.D.; Kumar, A.; Gaur, N.K.; Jamdar, S.N.; Kumar, A.; Makde, R.D. Two-domain aminopeptidase of M1 family: Structural features for substrate binding and gating in absence of C-terminal domain. J. Struct. Biol. 2019, 208, 51–60. [Google Scholar] [CrossRef]
  102. Wang, L.; Zhang, C.; Zhang, J.; Rao, Z.; Xu, X.; Mao, Z.; Chen, X. Epsilon-poly-L-lysine: Recent Advances in Biomanufacturing and Applications. Front. Bioeng. Biotechnol. 2021, 9, 748976. [Google Scholar] [CrossRef]
  103. Fellner, M.; Lentz, C.S.; Jamieson, S.A.; Brewster, J.L.; Chen, L.; Bogyo, M.; Mace, P.D. Structural Basis for the Inhibitor and Substrate Specificity of the Unique Fph Serine Hydrolases of Staphylococcus aureus. ACS Infect Dis. 2020, 6, 2771–2782. [Google Scholar] [CrossRef] [PubMed]
  104. Dong, L.; Shen, Y.; Hou, X.F.; Li, W.J.; Tang, G.L. Discovery of Druggability-Improved Analogues by Investigation of the LL-D49194α1 Biosynthetic Pathway. Org. Lett. 2019, 21, 2322–2325. [Google Scholar] [CrossRef] [PubMed]
  105. de Lorenzo, V.; Neilands, J.B. Characterization of iucA and iucC genes of the aerobactin system of plasmid ColV-K30 in Escherichia coli. J. Bacteriol. 1986, 167, 350–355. [Google Scholar] [CrossRef]
  106. Mydy, L.S.; Bailey, D.C.; Patel, K.D.; Rice, M.R.; Gulick, A.M. The Siderophore Synthetase IucA of the Aerobactin Biosynthetic Pathway Uses an Ordered Mechanism. Biochemistry 2020, 59, 2143–2153. [Google Scholar] [CrossRef]
  107. Bailey, D.C.; Alexander, E.; Rice, M.R.; Drake, E.J.; Mydy, L.S.; Aldrich, C.C.; Gulick, A.M. Structural and functional delineation of aerobactin biosynthesis in hypervirulent Klebsiella pneumoniae. J. Biol. Chem. 2018, 293, 7841–7852. [Google Scholar] [CrossRef]
  108. Lee, Y.; Hyun, C.G. Anti-Inflammatory Effects of Psoralen Derivatives on RAW264.7 Cells via Regulation of the NF-κB and MAPK Signaling Pathways. Int. J. Mol. Sci. 2022, 23, 5813. [Google Scholar] [CrossRef]
  109. Kang, J.K.; Chung, Y.C.; Hyun, C.G. Anti-Inflammatory Effects of 6-Methylcoumarin in LPS-Stimulated RAW 264.7 Macrophages via Regulation of MAPK and NF-κB Signaling Pathways. Molecules 2021, 26, 5351. [Google Scholar] [CrossRef]
  110. Pourbagher-Shahri, A.M.; Farkhondeh, T.; Talebi, M.; Kopustinskiene, D.M.; Samarghandian, S.; Bernatoniene, J. An Overview of NO Signaling Pathways in Aging. Molecules 2021, 26, 4533. [Google Scholar] [CrossRef]
Figure 1. Comparison of growth of Lentzea sp. JNUCC 0626, Lentzea cavernae KCTC 39804, and Lentzea pudingi KCTC 39694 on various actinomycete media. The aerial mycelium of JNUCC 0626 is white, and the substrate mycelium is yellow, whereas KCTC 39804 and KCTC 39694 exhibit somewhat different coloration; (a) shows the front view of colonies on solid media, and (b) shows the reverse view.
Figure 1. Comparison of growth of Lentzea sp. JNUCC 0626, Lentzea cavernae KCTC 39804, and Lentzea pudingi KCTC 39694 on various actinomycete media. The aerial mycelium of JNUCC 0626 is white, and the substrate mycelium is yellow, whereas KCTC 39804 and KCTC 39694 exhibit somewhat different coloration; (a) shows the front view of colonies on solid media, and (b) shows the reverse view.
Amh 70 00008 g001
Figure 2. Circular genome map (a) and plasmid map (b) of Lentzea sp. JNUCC 0626. Marked characteristics are shown from outside to the center; coding DNA sequences (CDS) on forward strand, CDS on reverse strand, tRNA, rRNA, GC content, and GC skew.
Figure 2. Circular genome map (a) and plasmid map (b) of Lentzea sp. JNUCC 0626. Marked characteristics are shown from outside to the center; coding DNA sequences (CDS) on forward strand, CDS on reverse strand, tRNA, rRNA, GC content, and GC skew.
Amh 70 00008 g002
Figure 3. Terpene gene cluster within BGC region 1 of Lentzea sp. JNUCC 0626 genome. In the lower subregion, proteins XIJ14775, XIJ14776, XIJ14777, and XIJ14778 are annotated as TetR/AcrR family transcriptional regulator, acyltransferase family protein, 1-deoxy-D-xylulose-5-phosphate synthase, and 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, respectively. In the upper subregion, XIJ14784.1 and XIJ14785.1 show similarity to a heme-degrading domain-containing protein and a Gfo/Idh/MocA family oxidoreductase, respectively. The spacing between protein-coding regions is indicated by “+” or “−” signs.
Figure 3. Terpene gene cluster within BGC region 1 of Lentzea sp. JNUCC 0626 genome. In the lower subregion, proteins XIJ14775, XIJ14776, XIJ14777, and XIJ14778 are annotated as TetR/AcrR family transcriptional regulator, acyltransferase family protein, 1-deoxy-D-xylulose-5-phosphate synthase, and 4-hydroxy-3-methylbut-2-enyl diphosphate reductase, respectively. In the upper subregion, XIJ14784.1 and XIJ14785.1 show similarity to a heme-degrading domain-containing protein and a Gfo/Idh/MocA family oxidoreductase, respectively. The spacing between protein-coding regions is indicated by “+” or “−” signs.
Amh 70 00008 g003
Figure 4. Isorenieratene gene cluster within BGC region 6 of the Lentzea sp. JNUCC 0626 genome. XIJ15576, XIJ15577, and XIJ15583, located near the isorenieratene gene cluster, show similarity to an NAD(P)/FAD-dependent oxidoreductase, a cryptochrome/photolyase family protein, and an alpha/beta hydrolase, respectively.
Figure 4. Isorenieratene gene cluster within BGC region 6 of the Lentzea sp. JNUCC 0626 genome. XIJ15576, XIJ15577, and XIJ15583, located near the isorenieratene gene cluster, show similarity to an NAD(P)/FAD-dependent oxidoreductase, a cryptochrome/photolyase family protein, and an alpha/beta hydrolase, respectively.
Amh 70 00008 g004
Figure 5. The Ljv gene cluster within BGC region 21 of the Lentzea sp. JNUCC 0626 genome. Centered around three short peptide fragments (LjvA1-A3), the cluster includes two regulatory genes (ljvR1-R2) located downstream and three transporter-associated genes (LjvT1-T3) positioned upstream of the core Ljv genes.
Figure 5. The Ljv gene cluster within BGC region 21 of the Lentzea sp. JNUCC 0626 genome. Centered around three short peptide fragments (LjvA1-A3), the cluster includes two regulatory genes (ljvR1-R2) located downstream and three transporter-associated genes (LjvT1-T3) positioned upstream of the core Ljv genes.
Amh 70 00008 g005
Figure 6. Genetic organization of the BE-54017 gene cluster within BGC region 21 of the Lentzea sp. JNUCC 0626 genome. In the antiSMASH analysis, genes XIJ15611 and XIJ15612, initially omitted, are now annotated as encoding a LuxR-like transcriptional regulator and a RebP-like cytochrome P450, respectively. In the upstream region, four genes (XIJ15625 to XIJ15628) show homology to a caspase family protein, a hypothetical protein, a Toll/interleukin-1 receptor domain-containing protein, and an adhesin.
Figure 6. Genetic organization of the BE-54017 gene cluster within BGC region 21 of the Lentzea sp. JNUCC 0626 genome. In the antiSMASH analysis, genes XIJ15611 and XIJ15612, initially omitted, are now annotated as encoding a LuxR-like transcriptional regulator and a RebP-like cytochrome P450, respectively. In the upstream region, four genes (XIJ15625 to XIJ15628) show homology to a caspase family protein, a hypothetical protein, a Toll/interleukin-1 receptor domain-containing protein, and an adhesin.
Amh 70 00008 g006
Figure 7. Genetic organization of the enediyne gene cluster from BGC region 8 in JNUCC 0626. This gene cluster consists of over 38 genes, including enediyne core genes, sugar biosynthesis genes, 6 regulatory genes, and 1 transporter gene. However, further experimental validation is required.
Figure 7. Genetic organization of the enediyne gene cluster from BGC region 8 in JNUCC 0626. This gene cluster consists of over 38 genes, including enediyne core genes, sugar biosynthesis genes, 6 regulatory genes, and 1 transporter gene. However, further experimental validation is required.
Amh 70 00008 g007
Figure 8. Genetic organization of the aromatic PKS gene cluster from BGC region 24 in JNUCC 0626. This region comprises genes with the highest homology to the trioxacarcin BGC, along with confirmed homology to other Type II PKS genes, such as those in the nogalamycin cluster. For detailed information, please refer to Table S31.
Figure 8. Genetic organization of the aromatic PKS gene cluster from BGC region 24 in JNUCC 0626. This region comprises genes with the highest homology to the trioxacarcin BGC, along with confirmed homology to other Type II PKS genes, such as those in the nogalamycin cluster. For detailed information, please refer to Table S31.
Amh 70 00008 g008
Figure 9. Organization of a putative Pam BGC from Lentzea sp. JNUCC 0626 with the respective homologous genes from S. coeruleorubidus layered onto it. The original relative orientation of individual genes (indicated by the direction of the arrow) has been maintained.
Figure 9. Organization of a putative Pam BGC from Lentzea sp. JNUCC 0626 with the respective homologous genes from S. coeruleorubidus layered onto it. The original relative orientation of individual genes (indicated by the direction of the arrow) has been maintained.
Amh 70 00008 g009
Figure 10. Organization of a putative ben BGC from Lentzea sp. JNUCC 0626 with the respective homologous genes from Streptomyces sp. RI18 layered onto it. The original relative orientation of individual genes (indicated by the direction of the arrow) has been maintained.
Figure 10. Organization of a putative ben BGC from Lentzea sp. JNUCC 0626 with the respective homologous genes from Streptomyces sp. RI18 layered onto it. The original relative orientation of individual genes (indicated by the direction of the arrow) has been maintained.
Amh 70 00008 g010
Figure 11. The effect of Lentzea sp. JNUCC 0626 on cell viability (a) and of nitric oxide production (b) in LPS-induced RAW264.7 cells. Cells were plated in 24-well plates (1.5 × 105 cells/well) and incubated for 24 h and then treated with samples and LPS stimulation for 24 h. The cytotoxicity of the samples was evaluated using MTT assays. The amount of nitric oxide in the medium was measured using the Griess reagent. The results are presented as the mean ± SD from three independent experiments. *** p < 0.001 vs. LPS-induced control group.
Figure 11. The effect of Lentzea sp. JNUCC 0626 on cell viability (a) and of nitric oxide production (b) in LPS-induced RAW264.7 cells. Cells were plated in 24-well plates (1.5 × 105 cells/well) and incubated for 24 h and then treated with samples and LPS stimulation for 24 h. The cytotoxicity of the samples was evaluated using MTT assays. The amount of nitric oxide in the medium was measured using the Griess reagent. The results are presented as the mean ± SD from three independent experiments. *** p < 0.001 vs. LPS-induced control group.
Amh 70 00008 g011
Table 1. Predicted biosynthetic gene clusters (BGCs) related to biosynthesis of secondary metabolites in Lentzea sp. JNUCC 0626.
Table 1. Predicted biosynthetic gene clusters (BGCs) related to biosynthesis of secondary metabolites in Lentzea sp. JNUCC 0626.
RegionTypeFromToMost Similar Known ClusterSimilarity
Region 1Terpene261,693283,778Geosmin100%
Region 2Thiopeptide, LAP680,669708,665Lactazole A
Region 3Terpene969,749990,8132-Methylisoborneol50%
Region 4Betalactone1,018,1511,049,578Olefin,
Cholesterol catabolism
6%
Region 5Lanthipeptide-class-ii1,104,6851,127,087
Region 6Terpene1,188,2781,209,204Isorenieratene85%
Region 7Indole1,243,4401,266,478BE-5401785%
Region 8NRP-metallophore, NRPS, T1PKS1,394,5231,504,164Sporolde A/B36%
Region 9NRPs, T1PKS, PKS-like1,668,9911,752,869None1%
Region 10T3PKS, T1PKS, thioamide-NRP, NRPS-like1,761,3481,875,228Venemycin13%
Region 11NRPS-like, T1PKS2,126,6442,173,729None13%
Region 12NRPS, NRPS-like2,196,8602,255,047Teicoplanin13%
Region 13Lanthipeptide-class-iv2,350,8512,373,559
Region 14Arylpolyene2,670,0652,711,225
Region 15NRPS2,926,3962,999,505Lysolipin I4%
Region 16T1PKS, NRPS-like, Nucleoside3,135,0543,288,715Queuosine35%
Region 17Hg1E-KS, T1PKS3,367,9983,546,677Funisamine32%
Region 18NRPS-like3,876,8083,920,068Benzastatins100%
Region 19Lanthipeptide-class-ii4,402,7454,425,351
Region 20Indole4,704,7334,725,827Maramycin6%
Region 21Lanthipeptide-class-v, RiPP-like4,766,9094,808,848Pristinin A311%
Region 22RiPP-like4,885,4344,896,252
Region 23Terpene5,100,3985,123,964Isorenieratene28%
Region 24T2PKS, PKS-like, RiPP-like5,153,1265,239,843Trioxacarcin39%
Region 25Lanthipeptide-class-iii5,253,7455,276,303RiPP/Lanthipeptide75%
Region 26Terpene5,896,7655,918,897Geosmin100%
Region 27C-nucleoside5,955,2625,999,125Minimycin derivative80%
Region 28Redox cofactor6,385,0276,407,063Pyrroloquinoline quinone26%
Region 29NAPAA8,425,3568,459,093ε-Poly-L-lysine100%
Region 30None8,527,5068,572,852 3%
Region 31LAP, thiopeptide9,115,4899,141,517
Region 32NI-siderophore9,879,5659,910,373
Region 33NRPS-like, NRPS, T1PKS9,975,72410,072,579Pacidamycin 1/2/3/4/5/6/7 DNRP77%
Region 34NRPS, phenazine, hg1E-KS10,131,33910,205,680Phenazine derivatives11%
“Similarity” represents the proportion of homologous genes between the query cluster and the hit cluster. The concept of “100% similarity” follows the same principle. As defined by antiSMASH 7.0, homologous genes were selected based on high sequence identity (>30%) and short BLAST alignments (>25%). The original data from antiSMASH 7.0 were modified using various analytical tools, including BLASTP, and detailed explanations are provided in the main text and Supplementary Materials.
Table 2. BE-54017 BGC of Lentzea sp. JNUC C0626.
Table 2. BE-54017 BGC of Lentzea sp. JNUC C0626.
GenBankPutative FunctionsProteins (Amino Acids)Identity/
Similarity
XIJ15611LuxR-like transcription regulatorLjeR (917 aa)/AbeR (932 aa)79.06%/86.18%
XIJ15612RebP-like cytochrome P450LjeP (400 aa)/AbeP (392 aa)86.60%/92.06%
XIJ15613RebC-like FAD-monooxygenase LjeC (525 aa)/AbeC (533 aa)89.87%/94.56%
XIJ15614RebO-like tryptophan oxidaseLjeO (501 aa)/AbeO (513 aa)90.27%/94.36%
XIJ15615Alpha/beta hydrolase LjeY (262 aa)/AbeY (264 aa)86.74%/91.67%
XIJ15616Flavin reductase family protein LjeF (160 aa)/AbeF (160 aa)89.38%/92.50%
XIJ15617Cation/proton antiporterLjeT (411 aa)/AbeT (412 aa)84.93%/90.19%
XIJ15618Tryptophan halogenase LjeH (515 aa)/AbeH (515 aa)95.15%/97.09%
XIJ15619O-methyltransferaseLjeM3 (336 aa)/AbeM3 (336 aa) 89.32%/93.77%
XIJ15620FAD-dependent oxidoreductaseLjeX2 (413 aa)/AbeX2 (407 aa)92.03%/96.14%
XIJ15621Chromopyrrolic acid synthaseLjeD (1012 aa)/AbeD (1015 aa)93.10%/96.45%
XIJ15622N-methyltransferaseLjeM1 (231 aa)/AbeM1 (231 aa)90.91%/95.67%
XIJ15623FAD-dependent monooxygenaseLjeX1 (532 aa)/AbeX1 (533 aa)93.43%/96.81%
XIJ15624N-methyltransferaseLjeM2 (230 aa)/AbeM2 (230 aa)91.30%/93.91%
Table 3. Comparison of homology between the biosynthetic enzymes of Lentzea sp. JNUCC 0626 BGC region 10 and those of venemycin and kendomycin.
Table 3. Comparison of homology between the biosynthetic enzymes of Lentzea sp. JNUCC 0626 BGC region 10 and those of venemycin and kendomycin.
GenBankPutative FunctionsVenemycin (Identity/
Similarity)
Kendomycin (Identity/
Similarity)
XIJ19095Transcriptional regulator Ken21 (33.73%/50.00%)
XIJ16057Enoyl-CoA-hydratase DpgDVemD 68.00%/79.64%)Ken7 (73.33%/79.63%)
XIJ16058Enoyl-CoA hydratase/isomerase DpgC VemC (54.24%/63.56%)Ken4 (56.02%/64.52%)
XIJ160593,5-dihydroxyphenylacetyl-CoA synthase DpgAVemA (65.61%/80.16%)Ken2 (68.04%/77.06%)
XIJ16070Transcriptional regulatorVemR (38.90%/51.35%)
XIJ16076Enoyl-CoA-hydratase DpgB VemD (31.51%)/43.15%)Ken3 (49.60%/62.30%)
XIJ16077NAD(P)/FAD-dependent oxidoreductase Ken15 (46.40%/62.18%)
XIJ16079Thiamine pyrophosphate-binding proteinVemE (31.30%/44.73%)Ken5 (34.57%/46.36%)
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Hyun, K.-A.; Boo, K.-H.; Hyun, C.-G. Taxonomic Identification, Complete Genome Sequencing, and In Silico Genome Mining of the Actinobacterium Lentzea sp. JNUCC 0626 Isolated from Jeju Gotjawal. Acta Microbiol. Hell. 2025, 70, 8. https://doi.org/10.3390/amh70010008

AMA Style

Hyun K-A, Boo K-H, Hyun C-G. Taxonomic Identification, Complete Genome Sequencing, and In Silico Genome Mining of the Actinobacterium Lentzea sp. JNUCC 0626 Isolated from Jeju Gotjawal. Acta Microbiologica Hellenica. 2025; 70(1):8. https://doi.org/10.3390/amh70010008

Chicago/Turabian Style

Hyun, Kyung-A, Kyung-Hwan Boo, and Chang-Gu Hyun. 2025. "Taxonomic Identification, Complete Genome Sequencing, and In Silico Genome Mining of the Actinobacterium Lentzea sp. JNUCC 0626 Isolated from Jeju Gotjawal" Acta Microbiologica Hellenica 70, no. 1: 8. https://doi.org/10.3390/amh70010008

APA Style

Hyun, K.-A., Boo, K.-H., & Hyun, C.-G. (2025). Taxonomic Identification, Complete Genome Sequencing, and In Silico Genome Mining of the Actinobacterium Lentzea sp. JNUCC 0626 Isolated from Jeju Gotjawal. Acta Microbiologica Hellenica, 70(1), 8. https://doi.org/10.3390/amh70010008

Article Metrics

Back to TopTop