Myticalins: A Novel Multigenic Family of Linear, Cationic Antimicrobial Peptides from Marine Mussels (Mytilus spp.)
Abstract
1. Introduction
2. Results and Discussion
2.1. Myticalins Pertain to a Multigenic Family
2.2. Gene Structure and Interindividual Variability
2.3. Myticalins Are Taxonomically Restricted to Mytiloida
2.4. Modiocalins: Myticalin Homologs in Modiolus spp.
2.5. In Silico Evaluation of Antimicrobial Potential
2.6. In Vitro Assessment of Antimicrobial Actvity
2.7. Molecular Mode of Action of Myticalin A5
2.8. Tissue Specificity
3. Materials and Methods
3.1. Identification of Myticalin in the Mytilus Galloprovincialis Transcriptome
3.2. Identification of Additional Members of the Myticalin Gene Family
3.3. In Silico Prediction of the Antimicrobial Properties of Myticalins
3.4. Solid Phase Synthesis of Peptides
3.5. Bacterial Strains and Evaluation of the Antimicrobial Activity of Myticalins
3.6. In Vitro RNA Synthesis, Purification and Quantification
3.7. In Vitro Trasncription and Translation Assays
3.8. Evaluation of Gene Expression across Tissues
3.9. Myticalin Gene Family Evolution
4. Conclusions
Supplementary Materials
Acknowledgments
Author Contributions
Conflicts of Interest
References
- Zhang, L.; Li, L.; Guo, X.; Litman, G.W.; Dishaw, L.J.; Zhang, G. Massive expansion and functional divergence of innate immune genes in a protostome. Sci. Rep. 2015, 5, 8693. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Loker, E.S.; Adema, C.M.; Zhang, S.M.; Kepler, T.B. Invertebrate immune systems—Not homogeneous, not simple, not well understood. Immunol. Rev. 2004, 198, 10–24. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Hubert, F.; Noel, T.; Roch, P. A member of the arthropod defensin family from edible Mediterranean mussels (Mytilus galloprovincialis). Eur. J. Biochem. FEBS 1996, 240, 302–306. [Google Scholar] [CrossRef] [Scilit]
- Charlet, M.; Chernysh, S.; Philippe, H.; Hetru, C.; Hoffmann, J.A.; Bulet, P. Isolation of several cysteine-rich antimicrobial peptides from the blood of a mollusc, Mytilus edulis. J. Biol. Chem. 1996, 271, 21808–21813. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Gerdol, M.; Puillandre, N.; Moro, G.D.; Guarnaccia, C.; Lucafò, M.; Benincasa, M.; Zlatev, V.; Manfrin, C.; Torboli, V.; Giulianini, P.G.; et al. Identification and Characterization of a Novel Family of Cysteine-Rich Peptides (MgCRP-I) from Mytilus galloprovincialis. Genome Biol. Evol. 2015, 7, 2203–2219. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Gerdol, M.; De Moro, G.; Manfrin, C.; Venier, P.; Pallavicini, A. Big defensins and mytimacins, new AMP families of the Mediterranean mussel Mytilus galloprovincialis. Dev. Comp. Immunol. 2012, 36, 390–399. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Qin, C.L.; Huang, W.; Zhou, S.Q.; Wang, X.C.; Liu, H.H.; Fan, M.H.; Wang, R.X.; Gao, P.; Liao, Z. Characterization of a novel antimicrobial peptide with chiting-biding domain from Mytilus coruscus. Fish Shellfish Immunol. 2014, 41, 362–370. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Allam, B.; Pales Espinosa, E. Bivalve immunity and response to infections: Are we looking at the right place? Fish Shellfish Immunol. 2016, 53, 4–12. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Gerdol, M.; Venier, P. An updated molecular basis for mussel immunity. Fish Shellfish Immunol. 2015, 46, 17–38. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Smith, V.J.; Desbois, A.P.; Dyrynda, E.A. Conventional and Unconventional Antimicrobials from Fish, Marine Invertebrates and Micro-algae. Mar. Drugs 2010, 8, 1213–1262. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Gerdol, M. Immune-related genes in gastropods and bivalves: A comparative overview. Invertebr. Surviv. J. 2017, 14, 95–111. [Google Scholar]
- Seo, J.K.; Go, H.J.; Kim, C.H.; Nam, B.H.; Park, N.G. Antimicrobial peptide, hdMolluscidin, purified from the gill of the abalone, Haliotis discus. Fish Shellfish Immunol. 2016, 52, 289–297. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Seo, J.K.; Lee, M.J.; Nam, B.H.; Park, N.G. cgMolluscidin, a novel dibasic residue repeat rich antimicrobial peptide, purified from the gill of the Pacific oyster, Crassostrea gigas. Fish Shellfish Immunol. 2013, 35, 480–488. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Takeuchi, T.; Kawashima, T.; Koyanagi, R.; Gyoja, F.; Tanaka, M.; Ikuta, T.; Shoguchi, E.; Fujiwara, M.; Shinzato, C.; Hisata, K.; et al. Draft genome of the pearl oyster Pinctada fucata: A platform for understanding bivalve biology. DNA Res. Int. J. Rapid Publ. Rep. Genes Genomes 2012, 19, 117–130. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Simakov, O.; Marletaz, F.; Cho, S.J.; Edsinger Gonzales, E.; Havlak, P.; Hellsten, U.; Kuo, D.H.; Larsson, T.; Lv, J.; Arendt, D.; et al. Insights into bilaterian evolution from three spiralian genomes. Nature 2013, 493, 526–531. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Gueguen, Y.; Bernard, R.; Julie, F.; Paulina, S.; Delphine, D.G.; Franck, V.; Philippe, B.; Evelyne, B. Oyster hemocytes express a proline-rich peptide displaying synergistic antimicrobial activity with a defensin. Mol. Immunol. 2009, 46, 516–522. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Dolashka, P.; Moshtanska, V.; Borisova, V.; Dolashki, A.; Stevanovic, S.; Dimanov, T.; Voelter, W. Antimicrobial proline-rich peptides from the hemolymph of marine snail Rapana venosa. Peptides 2011, 32, 1477–1483. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Stensvåg, K.; Haug, T.; Sperstad, S.V.; Rekdal, O.; Indrevoll, B.; Styrvold, O.B. Arasin 1, a proline-arginine-rich antimicrobial peptide isolated from the spider crab, Hyas araneus. Dev. Comp. Immunol. 2008, 32, 275–285. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Sperstad, S.V.; Haug, T.; Vasskog, T.; Stensvåg, K. Hyastatin, a glycine-rich multi-domain antimicrobial peptide isolated from the spider crab (Hyas araneus) hemocytes. Mol. Immunol. 2009, 46, 2604–2612. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Cuthbertson, B.J.; Deterding, L.J.; Williams, J.G.; Tomer, K.B.; Etienne, K.; Blackshear, P.J.; Büllesbach, E.E.; Gross, P.S. Diversity in penaeidin antimicrobial peptide form and function. Dev. Comp. Immunol. 2008, 32, 167–181. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Destoumieux, D.; Bulet, P.; Loew, D.; Van Dorsselaer, A.; Rodriguez, J.; Bachère, E. Penaeidins, a new family of antimicrobial peptides isolated from the shrimp Penaeus vannamei (Decapoda). J. Biol. Chem. 1997, 272, 28398–28406. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Chernysh, S.; Cociancich, S.; Briand, J.P.; Hetru, C.; Bulet, P. The inducible antibacterial peptides of the Hemipteran insect Palomena prasina: Identification of a unique family of prolinerich peptides and of a novel insect defensin. J. Insect Physiol. 1996, 42, 81–89. [Google Scholar] [CrossRef] [Scilit]
- Bulet, P.; Dimarcq, J.L.; Hetru, C.; Lagueux, M.; Charlet, M.; Hegy, G.; Van Dorsselaer, A.; Hoffmann, J.A. A novel inducible antibacterial peptide of Drosophila carries an O-glycosylated substitution. J. Biol. Chem. 1993, 268, 14893–14897. [Google Scholar] [PubMed]
- Levashina, E.A.; Ohresser, S.; Bulet, P.; Reichhart, J.M.; Hetru, C.; Hoffmann, J.A. Metchnikowin, a novel immune-inducible proline-rich peptide from Drosophila with antibacterial and antifungal properties. Eur. J. Biochem. 1995, 233, 694–700. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Mackintosh, J.A.; Veal, D.A.; Beattie, A.J.; Gooley, A.A. Isolation from an ant Myrmecia gulosa of two inducible O-glycosylated proline-rich antibacterial peptides. J. Biol. Chem. 1998, 273, 6139–6143. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Taniguchi, M.; Ochiai, A.; Kondo, H.; Fukuda, S.; Ishiyama, Y.; Saitoh, E.; Kato, T.; Tanaka, T. Pyrrhocoricin, a proline-rich antimicrobial peptide derived from insect, inhibits the translation process in the cell-free Escherichia coli protein synthesis system. J. Biosci. Bioeng. 2016, 121, 591–598. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Knappe, D.; Piantavigna, S.; Hansen, A.; Mechler, A.; Binas, A.; Nolte, O.; Martin, L.L.; Hoffmann, R. Oncocin (VDKPPYLPRPRPPRRIYNR-NH2): A novel antibacterial peptide optimized against gram-negative human pathogens. J. Med. Chem. 2010, 53, 5240–5247. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Chowdhury, S.; Taniai, K.; Hara, S.; Kadono-Okuda, K.; Kato, Y.; Yamamoto, M.; Xu, J.; Choi, S.K.; Debnath, N.C.; Choi, H.K. cDNA cloning and gene expression of lebocin, a novel member of antibacterial peptides from the silkworm, Bombyx mori. Biochem. Biophys. Res. Commun. 1995, 214, 271–278. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Shi, X.Z.; Zhao, X.F.; Wang, J.X. A new type antimicrobial peptide astacidin functions in antibacterial immune response in red swamp crayfish Procambarus clarkii. Dev. Comp. Immunol. 2014, 43, 121–128. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Li, W.F.; Ma, G.X.; Zhou, X.X. Apidaecin-type peptides: Biodiversity, structure-function relationships and mode of action. Peptides 2006, 27, 2350–2359. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Morrison, G.M.; Semple, C.A.M.; Kilanowski, F.M.; Hill, R.E.; Dorin, J.R. Signal sequence conservation and mature peptide divergence within subgroups of the murine β-defensin gene family. Mol. Biol. Evol. 2003, 20, 460–470. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Vanhoye, D.; Bruston, F.; Nicolas, P.; Amiche, M. Antimicrobial peptides from hylid and ranin frogs originated from a 150-million-year-old ancestral precursor with a conserved signal peptide but a hypermutable antimicrobial domain. Eur. J. Biochem. 2003, 270, 2068–2081. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Tessera, V.; Guida, F.; Juretić, D.; Tossi, A. Identification of antimicrobial peptides from teleosts and anurans in expressed sequence tag databases using conserved signal sequences. FEBS J. 2012, 279, 724–736. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Robinson, S.D.; Norton, R.S. Conotoxin gene superfamilies. Mar. Drugs 2014, 12, 6058–6101. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Pineda, S.S.; Sollod, B.L.; Wilson, D.; Darling, A.; Sunagar, K.; Undheim, E.A.B.; Kely, L.; Antunes, A.; Fry, B.G.; King, G.F. Diversification of a single ancestral gene into a successful toxin superfamily in highly venomous Australian funnel-web spiders. BMC Genom. 2014, 15, 177. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Wang, G. Post-translational modifications of natural antimicrobial peptides and strategies for peptide engineering. Curr. Biotechnol. 2012, 1, 72–79. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Murgarella, M.; Puiu, D.; Novoa, B.; Figueras, A.; Posada, D.; Canchaya, C. A First Insight into the Genome of the Filter-Feeder Mussel Mytilus galloprovincialis. PLoS ONE 2016, 11, e0151561. [Google Scholar] [CrossRef] [Scilit]
- Douglas, S.E.; Patrzykat, A.; Pytyck, J.; Gallant, J.W. Identification, structure and differential expression of novel pleurocidins clustered on the genome of the winter flounder, Pseudopleuronectes americanus (Walbaum). Eur. J. Biochem. 2003, 270, 3720–3730. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Costa, M.M.; Dios, S.; Alonso-Gutierrez, J.; Romero, A.; Novoa, B.; Figueras, A. Evidence of high individual diversity on myticin C in mussel (Mytilus galloprovincialis). Dev. Comp. Immunol. 2009, 33, 162–170. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Fraïsse, C.; Belkhir, K.; Welch, J.J.; Bierne, N. Local interspecies introgression is the main cause of extreme levels of intraspecific differentiation in mussels. Mol. Ecol. 2015. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Rosa, R.D.; Alonso, P.; Santini, A.; Vergnes, A.; Bachère, E. High polymorphism in big defensin gene expression reveals presence-absence gene variability (PAV) in the oyster Crassostrea gigas. Dev. Comp. Immunol. 2015, 49, 231–238. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Zhang, G.; Fang, X.; Guo, X.; Li, L.; Luo, R.; Xu, F.; Yang, P.; Zhang, L.; Wang, X.; Qi, H.; Xiong, Z.; et al. The oyster genome reveals stress adaptation and complexity of shell formation. Nature 2012, 490, 49–54. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Wang, S.; Zhang, J.; Jiao, W.; Li, J.; Xun, X.; Sun, Y.; Guo, X.; Huan, P.; Dong, B.; Zhang, L.; et al. Scallop genome provides insights into evolution of bilaterian karyotype and development. Nat. Ecol. Evol. 2017, 1, 0120. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Gerdol, M.; Fujii, Y.; Hasan, I.; Koike, T.; Shimojo, S.; Spazzali, F.; Yamamoto, K.; Ozeki, Y.; Pallavicini, A.; Fujita, H. The purplish bifurcate mussel Mytilisepta virgata gene expression atlas reveals a remarkable tissue functional specialization. BMC Genom. 2017, 18, 590. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Sun, J.; Zhang, Y.; Xu, T.; Zhang, Y.; Mu, H.; Zhang, Y.; Lan, Y.; Fields, C.J.; Hui, J.H.L.; Zhang, W.; et al. Adaptation to deep-sea chemosynthetic environments as revealed by mussel genomes. Nat. Ecol. Evol. 2017, 1, 0121. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Waghu, F.H.; Barai, R.S.; Gurung, P.; Idicula Thomas, S. CAMPR3: A database on sequences, structures and signatures of antimicrobial peptides. Nucleic Acids Res. 2016, 44, D1094–D1097. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Xiao, X.; Wang, P.; Lin, W.Z.; Jia, J.H.; Chou, K.C. iAMP-2L: A two-level multi-label classifier for identifying antimicrobial peptides and their functional types. Anal. Biochem. 2013, 436, 168–177. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Lata, S.; Mishra, N.K.; Raghava, G.P. AntiBP2: Improved version of antibacterial peptide prediction. BMC Bioinform. 2010, 11, S19. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Torrent, M.; Di Tommaso, P.; Pulido, D.; Nogués, M.V.; Notredame, C.; Boix, E.; Andreu, D. AMPA: An automated web server for prediction of protein antimicrobial regions. Bioinformatics 2012, 28, 130–131. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Vishnepolsky, B.; Pirtskhalava, M. Prediction of linear cationic antimicrobial peptides based on characteristics responsible for their interaction with the membranes. J. Chem. Inf. Model. 2014, 54, 1512–1523. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Joseph, S.; Karnik, S.; Nilawe, P.; Jayaraman, V.K.; Idicula-Thomas, S. ClassAMP: A prediction tool for classification of antimicrobial peptides. IEEE/ACM Trans. Comput. Biol. Bioinform. 2012, 9, 1535–1538. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Wang, G.; Li, X.; Wang, Z. APD3: The antimicrobial peptide database as a tool for research and education. Nucleic Acids Res. 2016, 44, D1087–D1093. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Szabo, D.; Ostorhazi, E.; Binas, A.; Rozgonyi, F.; Kocsis, B.; Cassone, M.; Wade, J.D.; Nolte, O.; Otvos, L. The designer proline-rich antibacterial peptide A3-APO is effective against systemic Escherichia coli infections in different mouse models. Int. J. Antimicrob. Agents 2010, 35, 357–361. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Holani, R.; Shah, C.; Haji, Q.; Inglis, G.D.; Uwiera, R.R.E.; Cobo, E.R. Proline-arginine rich (PR-39) cathelicidin: Structure, expression and functional implication in intestinal health. Comp. Immunol. Microbiol. Infect. Dis. 2016, 49, 95–101. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Bagella, L.; Scocchi, M.; Zanetti, M. cDNA sequences of three sheep myeloid cathelicidins. FEBS Lett. 1995, 376, 225–228. [Google Scholar] [CrossRef] [Scilit]
- Thakur, N.; Qureshi, A.; Kumar, M. AVPpred: Collection and prediction of highly effective antiviral peptides. Nucleic Acids Res. 2012, 40, W199–W204. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Sharma, A.; Gupta, P.; Kumar, R.; Bhardwaj, A. dPABBs: A Novel in silico approach for predicting and designing anti-biofilm peptides. Sci. Rep. 2016, 6, 21839. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Gautam, A.; Chaudhary, K.; Kumar, R.; Sharma, A.; Kapoor, P.; Tyagi, A.; Raghava, G.P.S. In silico approaches for designing highly effective cell penetrating peptides. J. Transl. Med. 2013, 11, 74. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Scocchi, M.; Tossi, A.; Gennaro, R. Proline-rich antimicrobial peptides: Converging to a non-lytic mechanism of action. Cell. Mol. Life Sci. CMLS 2011, 68, 2317–2330. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Benincasa, M.; Scocchi, M.; Podda, E.; Skerlavaj, B.; Dolzani, L.; Gennaro, R. Antimicrobial activity of Bac7 fragments against drug-resistant clinical isolates. Peptides 2004, 25, 2055–2061. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Bluhm, M.E.C.; Schneider, V.A.F.; Schäfer, I.; Piantavigna, S.; Goldbach, T.; Knappe, D.; Seibel, P.; Martin, L.L.; Veldhuizen, E.J.A.; Hoffmann, R. N-terminal Ile-Orn- and Trp-Orn-motif repeats enhance membrane interaction and increase the antimicrobial activity of apidaecins against pseudomonas aeruginosa. Front. Cell Dev. Biol. 2016, 4. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Runti, G.; Benincasa, M.; Giuffrida, G.; Devescovi, G.; Venturi, V.; Gennaro, R.; Scocchi, M. The mechanism of killing by the proline-rich peptide Bac7 (1-35) against clinical strains of pseudomonas aeruginosa differs from that against other gram-negative bacteria. Antimicrob. Agents Chemother. 2017, 61. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Destoumieux-Garzón, D.; Duperthuy, M.; Vanhove, A.S.; Schmitt, P.; Wai, S.N. Resistance to antimicrobial peptides in vibrios. Antibiotics 2014, 3, 540–563. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Krizsan, A.; Volke, D.; Weinert, S.; Sträter, N.; Knappe, D.; Hoffmann, R. Insect-derived proline-rich antimicrobial peptides kill bacteria by inhibiting bacterial protein translation at the 70S ribosome. Angew. Chem. Int. Ed Engl. 2014, 53, 12236–12239. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Mardirossian, M.; Grzela, R.; Giglione, C.; Meinnel, T.; Gennaro, R.; Mergaert, P.; Scocchi, M. The host antimicrobial peptide Bac71-35 binds to bacterial ribosomal proteins and inhibits protein synthesis. Chem. Biol. 2014, 21, 1639–1647. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Seefeldt, A.C.; Graf, M.; Pérébaskine, N.; Nguyen, F.; Arenz, S.; Mardirossian, M.; Scocchi, M.; Wilson, D.N.; Innis, C.A. Structure of the mammalian antimicrobial peptide Bac7 (1-16) bound within the exit tunnel of a bacterial ribosome. Nucleic Acids Res. 2016, 44, 2429–2438. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Seefeldt, A.C.; Nguyen, F.; Antunes, S.; Pérébaskine, N.; Graf, M.; Arenz, S.; Inampudi, K.K.; Douat, C.; Guichard, G.; Wilson, D.N.; et al. The proline-rich antimicrobial peptide Onc112 inhibits translation by blocking and destabilizing the initiation complex. Nat. Struct. Mol. Biol. 2015, 22, 470–475. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Duperron, S.; Nadalig, T.; Caprais, J.C.; Sibuet, M.; Fiala-Médioni, A.; Amann, R.; Dubilier, N. Dual symbiosis in a Bathymodiolus sp. mussel from a methane seep on the Gabon continental margin (Southeast Atlantic): 16S rRNA phylogeny and distribution of the symbionts in gills. Appl. Environ. Microbiol. 2005, 71, 1694–1700. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Distel, D.L.; Roberts, S.J. Bacterial endosymbionts in the gills of the deep-sea wood-boring bivalves Xylophaga atlantica and Xylophaga washingtona. Biol. Bull. 1997, 192, 253–261. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Venier, P.; Varotto, L.; Rosani, U.; Millino, C.; Celegato, B.; Bernante, F.; Lanfranchi, G.; Novoa, B.; Roch, P.; Figueras, A.; et al. Insights into the innate immunity of the Mediterranean mussel Mytilus galloprovincialis. BMC Genom. 2011, 12, 69. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Gerdol, M.; Moro, G.D.; Manfrin, C.; Milandri, A.; Riccardi, E.; Beran, A.; Venier, P.; Pallavicini, A. RNA sequencing and de novo assembly of the digestive gland transcriptome in Mytilus galloprovincialis fed with toxinogenic and non-toxic strains of Alexandrium minutum. BMC Res. Notes 2014, 7, 722. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Li, H.; Parisi, M.G.; Parrinello, N.; Cammarata, M.; Roch, P. Molluscan antimicrobial peptides, a review from activity-based evidences to computer-assisted sequences. Invertebr. Surviv. J. 2011, 8, 85–97. [Google Scholar]
- Bendtsen, J.D.; Nielsen, H.; von Heijne, G.; Brunak, S. Improved prediction of signal peptides: SignalP 3.0. J. Mol. Biol. 2004, 340, 783–795. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Duckert, P.; Brunak, S.; Blom, N. Prediction of proprotein convertase cleavage sites. Protein Eng. Des. Sel. PEDS 2004, 17, 107–112. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Altschul, S.F.; Gish, W.; Miller, W.; Myers, E.W.; Lipman, D.J. Basic local alignment search tool. J. Mol. Biol. 1990, 215, 403–410. [Google Scholar] [CrossRef]
- Reese, M.G.; Eeckman, F.H.; Kulp, D.; Haussler, D. Improved splice site detection in Genie. J. Comput. Biol. J. Comput. Mol. Cell Biol. 1997, 4, 311–323. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Gerdol, M.; De Moro, G.; Venier, P.; Pallavicini, A. Analysis of synonymous codon usage patterns in sixty-four different bivalve species. PeerJ 2015, 3, e1520. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Mun, S.; Kim, Y.J.; Markkandan, K.; Shin, W.; Oh, S.; Woo, J.; Yoo, J.; An, H.; Han, K. The Whole-Genome and Transcriptome of the Manila Clam (Ruditapes philippinarum). Genome Biol. Evol. 2017, 9, 1487–1498. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Da Silva, M.U.; Dondero, F.; Otto, T.; Costa, I.; Lima, N.C.; Americo, J.A.; Mazzoni, C.; Prosdocimi, F.; Rebelo, M.F. A hybrid-hierarchical genome assembly strategy to sequence the invasive golden mussel Limnoperna fortunei. PeerJ Preprints 2017, 5, e2995v1. [Google Scholar]
- Edgar, R.C. MUSCLE: Multiple sequence alignment with high accuracy and high-throughput. Nucleic Acids Res. 2004, 32, 1792–1797. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Finn, R.D.; Clements, J.; Eddy, S.R. HMMER web server: Interactive sequence similarity searching. Nucleic Acids Res. 2011, 39, W29–W37. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Parikesit, A.A.; Steiner, L.; Stadler, P.F.; Prohaska, S.J. Pitfalls of ascertainment biases in genome annotations—Computing comparable protein domain distributions in eukarya. Malays. J. Fundam. Appl. Sci. 2014, 10. [Google Scholar] [CrossRef] [Scilit]
- Ul-Hasan, S.; Burgess, D.M.; Gajewiak, J.; Li, Q.; Hu, H.; Yandell, M.; Olivera, B.M.; Bandyopadhyay, P.K. Characterization of the peptidylglycine α-amidating monooxygenase (PAM) from the venom ducts of neogastropods, Conus bullatus and Conus geographus. Toxicon 2013, 74, 215–224. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Fan, X.; Nagle, G.T. Molecular cloning of Aplysia neuronal cDNAs that encode carboxypeptidases related to mammalian prohormone processing enzymes. DNA Cell Biol. 1996, 15, 937–945. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Pollastri, G.; McLysaght, A. Porter: A new, accurate server for protein secondary structure prediction. Bioinform. Oxf. Engl. 2005, 21, 1719–1720. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Balouiri, M.; Sadiki, M.; Ibnsouda, S.K. Methods for in vitro evaluating antimicrobial activity: A review. J. Pharm. Anal. 2016, 6, 71–79. [Google Scholar] [CrossRef] [Scilit]
- Gerdol, M.; Manfrin, C.; De Moro, G.; Figueras, A.; Novoa, B.; Venier, P.; Pallavicini, A. The C1q domain containing proteins of the Mediterranean mussel Mytilus galloprovincialis: A widespread and diverse family of immune-related molecules. Dev. Comp. Immunol. 2011, 35, 635–643. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Huelsenbeck, J.P.; Ronquist, F. MRBAYES: Bayesian inference of phylogenetic trees. Bioinform. Oxf. Engl. 2001, 17, 754–755. [Google Scholar] [CrossRef] [Scilit]
- Rambaut, A.; Suchard, M.A.; Xie, D.; Drummond, A.J. Tracer v1.6. 2014. Available online: http://tree.bio.ed.ac.uk/software/tracer (accessed 27 July 2017).
- Blunt, J.W.; Copp, B.R.; Munro, M.H.G.; Northcote, P.T.; Prinsep, M.R. Marine natural products. Nat. Prod. Rep. 2003, 20, 1–48. [Google Scholar] [CrossRef] [Scilit] [PubMed]
- Prasasty, V.D.; Tambunan, U.S.F.; Siahaan, T.J. Homology modeling and molecular dynamics studies of EC1 domain of VE-cadherin to elucidate docking interaction with cadherin-derived peptide. OnLine J. Biol. Sci. 2014, 14, 155–162. [Google Scholar] [CrossRef] [Scilit]
- Parikesit, A.A.; Kinanty, K.; Tambunan, U.S.F. Screening of commercial cyclic peptides as inhibitor envelope protein dengue virus (DENV) through molecular docking and molecular dynamics. Pak. J. Biol. Sci. PJBS 2013, 16, 1836–1848. [Google Scholar] [PubMed]







| Gene | Genomic Scaffold | Predicted Mature Peptide Sequence |
|---|---|---|
| Myticalin A3 | 8059-668075 | YGWPRMPRIPRKPRYPRYPRYPRWPRHPTIYA-NH2 |
| Myticalin A4 | 11814-355 | YSWPRMPRIPRLPRYPRYPRYPRYPRWPRHPTIYA-NH2 |
| Myticalin A5 | 371709-C71912861-576740 | YSWPRMPRIPRLPRYPRYPRYPRWPRWPRQPTIYA-NH2 |
| Myticalin C10 | 281970-C72301332 | GRRRRYRYWRRGYRSWRRGVTIQERSKSSTLNTED |
| Myticalin C-PG | 410031 | RRRRRYRYWRRGLTI*GRSKSLPLNTGD 1 |
| Myticalin D-PG1 | 8059 | WGRRWRV*IPSPPRIRPWPP*TWPRPKWPRSATINID 1 |
| Myticalin D-PG2 | 266177 | WGRRLRIRIPSPPRPRPWPRPYPGPWPRSATINTDQ 2 |
| Bacterial Species and Strain | Myticalin (μM) | ||||||
|---|---|---|---|---|---|---|---|
| A5 | A8 | B1 | C6 | C9 | D2 | D5 | |
| Escherichia coli ATCC 25922 | 2 | 1 | 8–16 | 4 | 4 | 4 | >32 |
| Pseudomonas aeruginosa ATCC 27853 | 4–8 | 8 | >32 | 32 | 8 | 4 | >32 |
| Acinetobcter baumannii ATCC 19606 | 4 | 1 | 8 | 2 | 2 | 2 | >32 |
| Vibrio anguillarum ATCC 43305 | >32 | >32 | >32 | >32 | >32 | >32 | >32 |
| Staphylococcus aureus ATCC 25923 | 8–16 | 16 | >32 | 8 | 2 | 16–32 | >32 |
| Bacillus subtilis ATCC 6051 | 4 | 4 | 32 | 32 | 4 | 2 | >32 |
| Sequence Name | Forward Primer (5′ → 3′) | Reverse Primer (5′ → 3′) |
|---|---|---|
| Myticalin A3/A4/A5/A8/A10 | MGAATGCCACGGATACCAAG | TYATTCGTARMATCATCATTCA |
| Myticalin B1 | GGAAGAAAACGAGCCACT | TCAATCCCGTCTCGCTCA |
| Myticalin D3/D4/D5 | GGCRTTCTTTTGYTGTCAATG | GATCGTCGCCATGTTGGY |
| Myticalin D1/D2 | TTTTYTTTGCWCTTTGTATGATGG | CGTCGTTCAAWATCGCTCG |
| Myticalin C2 | GGCGACGAGGACTTACCATA | GCTCGTCGATATCGTCCATTA |
| Myticalin C8 | AAGCCACAGATTGCCAAAAT | TCATCCATAACGTCCCCATT |
| Myticalin C6 | GACGAAGGAGGCGAAGATTT | TCGTTCATCCKAAATGTCCKTC |
| Myticalin C5 | TGAAAGGGTTTGTTTTGATGC | CAGTTCCTCTCTTTTGCGATG |
© 2017 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
Share and Cite
Leoni, G.; De Poli, A.; Mardirossian, M.; Gambato, S.; Florian, F.; Venier, P.; Wilson, D.N.; Tossi, A.; Pallavicini, A.; Gerdol, M. Myticalins: A Novel Multigenic Family of Linear, Cationic Antimicrobial Peptides from Marine Mussels (Mytilus spp.). Mar. Drugs 2017, 15, 261. https://doi.org/10.3390/md15080261
Leoni G, De Poli A, Mardirossian M, Gambato S, Florian F, Venier P, Wilson DN, Tossi A, Pallavicini A, Gerdol M. Myticalins: A Novel Multigenic Family of Linear, Cationic Antimicrobial Peptides from Marine Mussels (Mytilus spp.). Marine Drugs. 2017; 15(8):261. https://doi.org/10.3390/md15080261
Chicago/Turabian StyleLeoni, Gabriele, Andrea De Poli, Mario Mardirossian, Stefano Gambato, Fiorella Florian, Paola Venier, Daniel N Wilson, Alessandro Tossi, Alberto Pallavicini, and Marco Gerdol. 2017. "Myticalins: A Novel Multigenic Family of Linear, Cationic Antimicrobial Peptides from Marine Mussels (Mytilus spp.)" Marine Drugs 15, no. 8: 261. https://doi.org/10.3390/md15080261
APA StyleLeoni, G., De Poli, A., Mardirossian, M., Gambato, S., Florian, F., Venier, P., Wilson, D. N., Tossi, A., Pallavicini, A., & Gerdol, M. (2017). Myticalins: A Novel Multigenic Family of Linear, Cationic Antimicrobial Peptides from Marine Mussels (Mytilus spp.). Marine Drugs, 15(8), 261. https://doi.org/10.3390/md15080261

