Next Article in Journal
In Silico Evaluation, Phylogenetic Analysis, and Structural Modeling of the Class II Hydrophobin Family from Different Fungal Phytopathogens
Next Article in Special Issue
The Genomic Characteristics of an Arthritis-Causing Salmonella pullorum
Previous Article in Journal
Real-Time and Rapid Respiratory Response of the Soil Microbiome to Moisture Shifts
Previous Article in Special Issue
Emergence and Persistent Circulation of Highly Pathogenic Avian Influenza Virus A (H5N8) in Kosovo, May 2021–May 2022
 
 
Search for Articles:
Title / Keyword
Author / Affiliation / Email
Journal
Article Type
 
 
Advanced Search
 
Section
Special Issue
Volume
Issue
Number
Page
 
Journals
Microorganisms
Volume 11
Issue 11
10.3390/microorganisms11112631
microorganisms-logo
Submit to this Journal Review for this Journal Propose a Special Issue
► Article Menu

Article Menu

share Share announcement Help format_quote Cite question_answer Discuss in SciProfiles thumb_up
...
Endorse textsms
...
Comment
first_page
settings
Order Article Reprints
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Prevalence and Molecular Characteristics of FAdV-4 from Indigenous Chicken Breeds in Yunnan Province, Southwestern China

by
Jinyu Lai
1,2,3,†,
Liangyu Yang
1,3,†,
Fashun Chen
1,3,
Xingchen He
1,3,
Rongjie Zhang
1,3,
Yong Zhao
1,3,
Gan Gao
1,3,
Weiwu Mu
1,3,
Xi Chen
1,3,
Shiyu Luo
1,3,
Tao Ren
2,* and
Bin Xiang
1,3,*
1
College of Veterinary Medicine, Yunnan Agricultural University, Kunming 650201, China
2
College of Veterinary Medicine, South China Agricultural University, Guangzhou 510642, China
3
Center for Poultry Disease Control and Prevention, Yunnan Agricultural University, Kunming 650201, China
*
Authors to whom correspondence should be addressed.
†
These authors contributed equally to this work.
Microorganisms 2023, 11(11), 2631; https://doi.org/10.3390/microorganisms11112631
Submission received: 30 September 2023 / Revised: 18 October 2023 / Accepted: 24 October 2023 / Published: 26 October 2023
(This article belongs to the Special Issue Poultry Pathogens and Poultry Diseases)
Browse Figures
Review Reports Versions Notes

Abstract

:
Fowl adenovirus-induced hepatitis–pericardial effusion syndrome outbreaks have been increasingly reported in China since 2015, resulting in substantial economic losses to the poultry industry. The genetic diversity of indigenous chicken results in different immune traits, affecting the evolution of these viruses. Although the molecular epidemiology of fowl adenovirus serotype 4 (FAdV-4) has been well studied in commercial broiler and layer chickens, the prevalence and genetic characteristics of FAdV-4 in indigenous chickens remain largely unknown. In this study, samples were collected from six indigenous chicken breeds in Yunnan province, China. FAdV-positive samples were identified in five of the six indigenous chicken populations via PCR and 10 isolates were obtained. All FAdVs belonged to serotype FAdV-4 and species FAdV-C. The hexon, fiber, and penton gene sequence comparison analysis demonstrated that the prevalence of FAdV-4 isolates in these chickens might have originated from other provinces that exported chicks and poultry products to Yunnan province. Moreover, several distinct amino acid mutations were firstly identified in the major structural proteins. Our findings highlighted the need to decrease inter-regional movements of live poultry to protect indigenous chicken genetic resources and that the immune traits of these indigenous chickens might result in new mutations of FAdV-4 strains.

1. Introduction

Fowl adenovirus (FAdV) is a DNA virus belonging to the genus Aviadenovirus in the family Adenoviridae [1]. Based on variations in the antigenic structure, FAdVs can be categorized into three groups: Group I fowl adenoviruses, which are derived from the respiratory tracts and livers of chickens, turkeys, geese, and ducks [2], Group II fowl adenoviruses, primarily isolated from the lymphocytes and livers of turkeys and known as hemorrhagic enteritis viruses (HEV) that primarily induce hemorrhagic enteritis in turkeys and marble spleen disease in pheasants [3], and Group III fowl adenoviruses, referred to as egg drop syndrome viruses (EDSV) [4]. Group I FAdV is a prevalent pathogen in fowl species and can be further divided into five subgroups: A, B, C, D, and E [5]. Additionally, it consists of 12 serotypes, ranging from FAdV-1 to FAdV-11, with FAdV-8 further divided into two types: 8a and 8b [6]. Group I FAdVs causes fowl inclusion body hepatitis (IBH), hydropericardium hepatitis syndrome (HHS), and gizzard erosion (GE), posing significant risks to the poultry sector and impeding its development [7]. Notably, FAdV-4 is the causative agent of HHS, which is distinguished by the presence of pericardial effusion and liver necrosis [8].
The coat proteins of fowl adenoviruses, namely, fiber, penton, and hexon, exhibit a significant degree of homology across all adenoviruses and play a crucial role in determining the efficacy of viral infection [9]. In the case of the group I fowl adenoviruses, the majority possess two fiber proteins, whereas FAdV-4 possesses two fiber proteins of varying lengths [10]. The interactions between viruses and hosts are mediated by fiber proteins [11], whereas viral internalization during the infection cycle is facilitated by penton proteins [12]. Hexon genes, owing to their conserved nature and the antigenicity of the proteins they encode, are utilized as efficient tools for rapid type inference [6].
Chickens of various age groups are susceptible to FAdVs, with broilers aged 3–5 weeks exhibiting the highest vulnerability. Since 2015, there has been a notable increase in reports concerning FAdVs across several provinces in China, particularly broiler-producing provinces, such as Anhui, Shandong, Guangdong, and Guangxi, as evidenced by the substantial number of clinical HHS samples isolated from these regions [13]. Although commercial vaccination against FAdV-4 has been implemented, FAdV-4 infection still occurred sporadically. In most of the previous studies on the isolation and sequencing of FAdVs from commercial broiler and layer chickens [13,14,15], no systematic epidemiological investigation and study of the molecular characteristics of FAdVs from indigenous chickens has been performed.
Indigenous chickens are an important source of genetic and phenotypic diversity. However, infectious diseases threaten the health of chickens. Previous studies have revealed that the immune responses of different kinds of indigenous chicken breeds after being infected with pathogens such as Newcastle disease virus showed significant differences [16,17]. The diversity of the MHC, which regulates specific immune responses, was confirmed in Chinese indigenous chickens [18]. Thus, these viruses might have some mutations under the different selective pressures from these indigenous chickens. Yunnan province, situated in the southwestern region of China, is renowned for its abundant animal resources and is often referred to as the “Kingdom of Animals”. The province has plenty of unique indigenous chicken breeds including the Wuliangshan black-bone chickens, La-bai high leg Chickens, Yanjin black-bone chickens, Xichou black-bone chickens, Yunlong short-foot chickens, Wuding strong chickens, Qinhua chickens, and so on. These indigenous chicken breeds have significant value as precious species resources within China. However, there is a lack of reports on the prevalence of FAdVs in indigenous chickens in this region and the molecular characteristics of these viruses have remained largely unknown. Within the scope of this study, we successfully isolated and identified FAdVs from indigenous chicken populations, thereby elucidating the epidemiological attributes of FAdV-4 in specific chicken populations in Southwest China. These findings suggest that FAdV-4 exists among indigenous chicken breeds in Yunnan province and has some new mutations.

2. Materials and Methods

2.1. Sample Collection and Processing

To investigate the prevalence of FAdVs in the indigenous chickens in Yunnan province, a total of 478 swab samples including oropharyngeal and cloacal swabs of the same chicken from clinically healthy indigenous chickens and 28 tissue samples from suspected FAdVs infections were collected to detect FAdVs from January 2022 to June 2023. The tissue and swab samples were collected and treated as previously described [19,20]. The samples were obtained by adding tissue to a PBS buffer containing penicillin and streptomycin, followed by grinding in liquid nitrogen, subjecting to three freeze–thaw cycles, and subsequently centrifuging at 4 °C and 8000× g to obtain the supernatant. Similarly, the collected swabs underwent three freeze–thaw cycles and were then centrifuged to obtain the supernatant. The supernatant derived from the samples was further filtered through a 0.22 µm filter and stored at a temperature of −80 °C. The specific details of the sample collection are presented in Table 1.

2.2. Virus Isolation

The presence of FAdVs was confirmed via polymerase chain reaction (PCR), as described previously [21]. All positive samples were inoculated into LHM cells, according to a previous method [22]. The LMH cells were cultivated in F12 (Gibco, Grand Island, NE, USA) medium supplemented with 10% FBS (Gibco, Grand Island, NE, USA) for the purpose of passaging. Upon reaching 80% confluence, the filtered supernatant derived from the diseased material was diluted by a factor of 5 and subsequently introduced into the LMH cells. Following a 2 hours incubation period, the adsorption process was substituted with F12 medium containing 2% FBS to sustain cell proliferation. The cells were then cultured in 5% CO2, 37 °C incubators for a duration of 3 to 5 days. The cells were be monitored daily for signs of swelling, rounding, and aggregation into grape-bunch-like structures. If these characteristics were observed in the majority of cells, the cultured cells and supernatant were collected. After three cycles of freeze–thawing, these samples were filtered using a 0.22 μm filter and then inoculated into LMH cells following the previously described method. After three passages, the cultured cells and supernatant were collected and stored at −80 °C.

2.3. DNA Extraction and PCR

Genomic DNA was isolated from the culture supernatants using an Accurate Biology Viral Genomic DNA/RNA Extraction Kit (Accurate Biology, Changsha, China). The samples were analyzed by PCR using specific primers (Supplementary Table S1). Analyses were conducted using 1% agarose gel electrophoresis to determine the presence of positive samples. Amplification of the hexon, fiber1, fiber2, and penton genes was performed on these positive samples using the specific primers listed in Supplementary Table S1. The target amplification products were purified by 1% agarose gel electrophoresis, and the desired bands were excised. A gel extraction kit (Omega, Norcross, GA, USA) was used to purify the positive products, which were then cloned into a Blunt-zero plasmid vector (Vazyme, Nanjing, China). Subsequently, these clones were transformed into E. coli DH5α receptor cells (AlpalifeBio, Shenzhen, China), and the positive clones were selected and sent to Sango Biotech (Shanghai, China) for sequencing.

2.4. Sequence Comparison and Phylogenetic Analysis

The nucleotide sequences of hexon, penton, fiber1, and fiber2 were aligned with publicly available reference sequences obtained from the National Library of Medicine (NCBI) using the MegAlign program, which is part of the DNAStar software suite version 5.01 (DNAStar, Madison, WI, USA). Supplementary Table S2 provides detailed information on the reference sequences. Phylogenetic trees for the hexon, penton, fiber1, and fiber2 genes were constructed using the neighbor-joining method implemented in MEGA version 11.0.

3. Results

3.1. Virus Identification and Isolation

The chickens suspected to be infected with FAdVs showed obvious lesions on necropsy, with obviously enlarged livers, hemorrhage, and pericardial effusion. The positive rate of swabs and tissue samples were 0.84% (4/478) and 21.43% (6/28), respectively (Table 1). Notably, of the six indigenous chicken flocks in Yunnan province involved in this investigation, we detected the presence of FAdV-4 in five of them. Ten FAdVs were successfully isolated from cultured LMH cells and designated as YNBL-8/2023, YNBL47/2023, YNFD/2022, YNJC/2022, YNLP/2022, YNNC-1/2022, YNNJ/2022, YNXJ/2022, YNBJ-5/2023, and YNYL/2022. The nucleotide sequence information of these FAdVs has been uploaded to NCBI, and the accession number information is shown in Table 2. Notably, four FAdV-4 strains were isolated from the oropharyngeal and cloacal swabs of clinically healthy chickens, indicating an inapparent infection with FAdV-4 in indigenous chicken flocks in Yunnan.

3.2. Phylogenetic Analysis of FAdVs Isolated from Indigenous Chickens in Yunnan Province

To investigate the phylogenetic characteristics of FAdVs circulating in indigenous chickens in Yunnan province, the hexon, fiber, and penton genes of the 10 FAdVs were sequenced and submitted to GenBank. Phylogenetic analysis of the hexon, fiber1, fiber2, and penton genes of these 10 FAdVs clustered them into the same branch, which belonged to the FAdV-4/C group (Figure 1, Figure 2 and Figure 3).
The hexon genes of the 10 FAdV-4 strains in this study were compared with the sequences published in the NCBI, and a table of homology between the Yunnan isolates and other isolates was compiled (Supplementary Table S3). The hexon genes of all 10 Yunnan isolates were highly homologous to the GDMZ virus isolated from Guangdong province and the SCDY virus isolated from Sichuan province. YNBL-7/2023, YNFD/2022, YNLP/2022, YNNC-1/2022, YNNJ/2022, YNXJ/2022, and YNYL/2022 were also most closely related to AH712 isolated from Anhui province. YNBJ-5/2023, YNBL-7/2023, YNLP/2022, YNNJ/2022, YNXJ/2022, and YNYL/2022 also shared high homology with viruses isolated from Heilongjiang province. YNBL-8/2023 and YNJC/2022 shared 97.72% and 100% identity with GX-1 and GX2017-01, respectively, which were isolated from Guangxi province. High similarity was also observed between YNBL-8/2023, YNFD/2022, and YNYL/2022 and viruses isolated from Shandong province. YNBL-8/2023 and YNXJ/2022 were also the most closely related to the He-Bei/0914/2021 isolate from pigeons.
The fiber1 genes of YNYL/2022, YNXJ/2022, and YNBL-8/2023 were closely related to the isolates from Shandong, Henan, Heilongjiang, and Guangxi. The other strains shared genetic similarities with isolates from the Shandong, Anhui, and Guangdong provinces.
For the fiber 2 gene, YNLP/2022 shared the highest genetic relationship with the Guangxi isolate. The other strains shared genetic similarities with isolates from Shandong, Anhui, and Guangdong provinces in China.
For the penton gene, YNBL-8/2023, YNBL-7/2023, and YNYL/2022 shared the highest genetic relationships with the Henan, Heilongjiang, and Anhui isolates. YNNC-1/2022 and YNXJ/2022 shared the highest genetic relationships with the Shandong isolates. YNJC/2022, YNFD/2022, YNLP/2022, YNBJ-5/2023, and YNNJ/2022 shared the highest genetic relationships with the Henan isolates.

3.3. Molecular Characteristics of FAdV-4 Isolated from Southwest China

A thorough examination was undertaken to analyze the amino acid mutations in the sequencing data of the hexon, penton, fiber1, and fiber2 proteins. The investigation revealed the existence of multilocus amino acid mutations, particularly in the hexon protein of the FAdV-4 strain examined in this study. Furthermore, additional amino acid mutations were observed in the penton, fiber1, and fiber2 proteins.
The FAdV-4 hexon protein plays a pivotal role in determining its virulence [23]. Amino acid residue R188 was observed in the hexon proteins of the 10 FAdV-4 isolates, indicating that these viruses are possible highly pathogenic FAdV-4 [24]. Meanwhile, the mutations Y17H in YNBL-7/2023; W97R in YNBL-8/2023; N147D and V816A in YNYL/2022; S164F in YNNJ/2022; R193Q, Q195E, and R290G in YNLP/2022 and YNFD/2022T; 199I, T414I and S429N in YNBL-7/2023; T254S and V914A in YNBL-8/2023; T465A and M707T in YNBJ-5/2023; D588G in YNLP/2022; D588G in YNFD/2022; and G747D in YNXJ/2022 were also identified (Table 3). Notably, the substitutions Q193E and Q195E in YNFD/2022 and YNLP/2022 occurred in the non-pathogenic strain ON1 isolated from Canada and the pathogenic strain MX-SHP95 isolated from Mexico.
The penton base exhibits toxin-like activity that causes cytopathic effects (CPE) in host cells [25]. The penton proteins in our study displayed several mutations, specifically V175E, I193V, T246A, I271V, G402R, V426I, A447T, T486S, T497A, and K509E (Table 4). Notably, the I193V, V426I, and T486S mutations were observed in the avirulent strain ON1 from Canada and the virulent strain MX-SHP95 from Mexico.
The fiber1 protein has been implicated in viral invasion. Prior research has demonstrated that chick embryo lethal orphan (CELO) viruses, specifically FAdV-1, can interact with coxsackieviruses and adenovirus receptors (CARs) through fiber1 when initiating para-infection through fiber 2 proteins [26]. However, the key amino acid sites in fiber1 have not been identified. Compared with ON1 from Canada and MX-SHP95 from Mexico, the isolate from southwest China had a deletion of 428 amino acid sites in fiber1, which was consistent with FAdV-4 isolated from other regions of China. The mutation sites in the fiber1 protein included S25P, T46A, N63S, K165R, T217A, and L255F (Table 5). Among these, aa46 was identical to the strains ON1 from Canada and MX-SHP95 from Mexico.
Previous studies have identified many conserved amino acid mutations in fiber2 proteins, such as G219D, P307A, V319I, and A380T, which are found in all highly virulent FAdV-4 strains, some of which may be associated with virulence [27]. These mutations were also found in isolates from the indigenous chicken breeds of Yunnan province. Five amino acid insertions at aa11–15 was observed in these isolated FAdV-4 strains when compared with the ON1 and MX-SHP95 strains, consistent with the other FAdV-4 strains isolated in China. The fiber2 protein of these viruses also showed some mutations, including E136G, D142G, P384S, S413R, and A475T (Table 6). It is worth noting that the sites D219, Q232, T261, T300, A305, A307, I319, and T380 of the fiber2 protein of theses FAdV-4 strains were identical to the highly virulent MX-SHP95 strain but differed from the ON1 strain.
Amino acid mutations, when combined with breed preference analyses, have revealed that mutations in the hexon protein vary among different chicken breeds. Specifically, strains isolated from Yanjing black-bone and Rongmao chickens harbored R193Q, Q195E, R290G, and D588G mutations. Strains isolated from Wulingshan black-bone chickens harbored the N147D and V816A mutations. Strains isolated from Yanjing black-bone chickens harbored the S164F mutation, which differed between domestic and foreign isolates. Additionally, strains isolated from Xichou black-bone chickens displayed Y17H, W97R, T199I, T254S, S429N, T465A, N601D, W637R, M707T, T735I, and V914A mutations.

4. Discussion

FAdVs, especially FAdV-4, can induce high mortality rates in chickens and can be transmitted via horizontal and vertical transmission, posing a great threat to the safety of indigenous chickens. Before 2015, IBH and HHS associated with FAdVs infections, including FAdV-4, FAdV-8a, FAdV-8b, and FAdV-11, were sporadically reported in poultry in China, with low mortality rates [28]. However, since 2015, outbreaks of HHS, mainly associated with FAdV-4, have occurred in broiler-producing provinces such as Shandong, Henan, Jiangsu, Guangdong, Guangxi, and Anhui [29]. Subsequently, the FAdV-4 strain has spread rapidly throughout the country and among layer chickens, resulting in huge economic losses to the poultry industry. FAdV-4 is the dominant serotype, but FAdV-8a, FAdV-8b, and FAdV-11 also are noted in China [22,30]. Indigenous chicken breeds are valuable genetic resources for breeding. Yunnan province, located in southwest China, hosts multiple types of indigenous chickens. In this study, we showed that five of six indigenous chicken populations tested positive for FAdVs. Moreover, all FAdVs detected in this study were identified as FAdV-4. Thus, our results confirmed the prevalence of FAdV-4 but not FAdV-8a, FAdV-8b, or FAdV-11 in indigenous chicken breeds in Yunnan province.
Zhang et al. demonstrated that FAdV-4 strains isolated from central China exhibit clustering with viruses isolated from India, as determined by the hexon sequence, suggesting the potential origin of these viruses as India [31]. However, upon analyzing the genome sequence of three FAdV-4 strains isolated in 2015, it was observed that these strains displayed the highest nucleotide similarity with early Chinese strains. This finding suggests the potential origin of these viruses as early FAdV-4 strains in China [32]. A prior investigation similarly discovered that FAdV-N22 obtained from a live Newcastle disease vaccine, exhibited a substantial degree of sequence similarity with JSJ13, which was isolated from birds affected by infectious bursal disease in China during the period 2012–2013 [33]. This suggests that the contamination of live vaccines may have a significant impact on the occurrence of HHS outbreaks in Chinese poultry. Numerous studies have documented that the viral excretion of FAdV-4 through the respiratory and digestive systems can persist for a duration of two weeks [34,35]. Furthermore, it has been observed that FAdV-4 can be effectively disseminated among fowl populations through aerosol transmission [33]. Recent investigations have identified the presence of FAdV-4 in Taizhou geese [36], Cherry Valley ducks [37], mandarin ducks [38], and Muscovy ducks [38], with a high degree of genetic similarity to viruses isolated from chickens. These findings suggest the potential occurrence of the cross-species transmission of FAdV-4.
The hexon, fiber, and penton gene sequence comparison analysis in this study demonstrated that all 10 FAdV-4 strains isolated from indigenous chickens in Yunnan province had the highest nucleotide similarity with viruses previously reported in other provinces, such as Guangdong, Sichuan, Anhui, Heilongjiang, Shandong, Guangxi, and Henan, indicating that the prevalence of FAdV-4 isolates in these indigenous chickens might have originated from other provinces in China. Although Yunnan province hosts multiple types of indigenous chickens, the productive performance of these indigenous chickens is relatively poorer than that of hybrids of commercial broiler chickens. Thus, most of the chicks were imported into Yunnan province from other provinces, such as Guangdong, Guangxi, Henan, and Shandong. Moreover, poultry products from these developed poultry provinces were brought into Yunnan province to satisfy the consumption needs of the people. This might have resulted in the introduction of FAdV-4 into Yunnan province. It suggests that the scale of broiler breeding in Yunnan province should be expanded to meet the demand of meat and eggs in Yunnan province as much as possible, so as to reduce the demand for live poultry transported from other provinces.
The identification of four essential FAdV-4 genes, specifically hexon, penton, fiber1, and fiber2, has been documented [39,40,41]. Of these genes, hexon and fiber2 are of particular significance in determining the virulence of FAdV-4 and are strongly related to the emergence of highly pathogenic FAdVs [42,43]. The discovery of FAdV-4 in Southwest China implies that FAdV-4 is transmitted between different chicken breeds. The different adaptations of FAdV-4 in indigenous flocks of different breeds have resulted in numerous amino acid mutations in the isolates from Southwest China. Many of the mutations were previously unreported and were concentrated in the hexon and fiber genes. Previous research suggests that the hexon protein is crucial to determining the virulence of FAdV-4. The substitution of the amino acid isoleucine (I) with arginine (R) at position 188 of the hexon protein is anticipated to greatly enhance the virulence of FAdV-4 [44]. In the hexon protein, several mutations have been reported, including I188R, Q193R, and E195Q [45]. However, some mutations, including Y17H, W97R, N147D, T199I, T254S, R290G, N389D, T414I, S429N, T465A, D599G, N601D, W637R, M707T, T735I, G747D, V816A, and V914A, have not been previously reported. Furthermore, the hexon protein from the indigenous chicken isolate displayed mutations at aa193 and aa195, which were identical to those observed in the avirulent strain ON1 from Canada and the virulent strain MX-SHP95 from Mexico. Amino acid mutations also occurred in the fiber1 protein, including the previously unreported mutations S25P, A46T, N63S, K165R, and L255F. In the fiber2 protein, the mutations G219D, P307A, V319I, and A380T were observed in these isolates, which were consistent with previously reported amino acid mutations that may be closely related to virulence [27]. However, the mutations E136G, D142G, E232Q, P384S, S413R, and A475T, which have not been previously reported, were also identified. Notably, the aa46 and aa255 mutations in the fiber1 protein were consistent with strains isolated from other countries and the aa430 mutation was consistent with the virulent Mexican strain MX-SHP95. Previous studies have demonstrated that the MHC system, which plays important roles in immune response, shows high genetic diversity in Chinese indigenous chickens, indicating that the immune traits of these indigenous chickens might have large differences [46]. Recent studies have confirmed that FAdV-4 can induce cellular pathways in chickens to produce interferon and antigen presenting molecules (MHCI/II) [47]. Thus, the different immune traits of these indigenous chickens might have resulted in the mutations in the FAdV-4 strains isolated in our study. However, further research is required to determine the biological significance of these mutations in recombinant chimeric viruses.
In summary, our results reveal the existence of FAdV-4 in indigenous chickens in Yunnan province. Moreover, several mutations in the major structural proteins of FAdV-4 were identified, indicating that FAdV-4 may have undergone evolutionary adaptation to suit the indigenous chicken breeds. Thus, it is imperative to conduct further investigations to ascertain the potential impact of these mutations on viral virulence. More importantly, to protect indigenous chicken breeds in Yunnan province the monitoring and vaccination against FAdVs should be strengthened.

Supplementary Materials

The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/microorganisms11112631/s1, Table S1: Primers used in study; Table S2: Details of fowl adenovirus isolates for sequence alignment and phylogenetic analysis; Table S3: Information on strains with the highest homology to the FAdV-4 strains isolated in our study. Reference [48] is cited in the supplementary materials.

Author Contributions

J.L. was responsible for experimental design, data analysis, and manuscript writing. B.X. designed the experiments and revised the manuscript. F.C., R.Z., Y.Z., G.G., X.C., S.L. and W.M. collected samples. X.H. was responsible for data processing. L.Y. and T.R. reviewed and edited the manuscript. All authors have read and agreed to the published version of the manuscript.

Funding

This research was funded by the Academician (Expert) Workstation of Yunnan Province Program (202305AF150127), Yunnan Ten Thousand Talents Plan Leading Talents of Industrial Technology Project of China (YNWR-CYJS-2019-020), National Key Research and Development Program of China (2022YFD1601900), and Yunnan Fundamental Research Projects (202301AT070488).

Institutional Review Board Statement

This study was performed in accordance with the regulations and recommendations of the Ministry of Science and Technology of the People’s Republic of China, “The Care and Use of Laboratory Animals”, and was approved by the Animal Welfare Ethics Committee of Yunnan Agricultural University (permit number: 202203056).

Data Availability Statement

The genomic data presented in this study are available from GenBank (accession numbers: OR480649-OR480688).

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Benko, M.; Aoki, K.; Arnberg, N.; Davison, A.J.; Echavarria, M.; Hess, M.; Jones, M.S.; Kajan, G.L.; Kajon, A.E.; Mittal, S.K.; et al. ICTV Virus Taxonomy Profile: Adenoviridae 2022. J. Gen. Virol. 2022, 103, 001721. [Google Scholar] [CrossRef]
  2. Asthana, M.; Chandra, R.; Kumar, R. Hydropericardium syndrome: Current state and future developments. Arch. Virol. 2013, 158, 921–931. [Google Scholar] [CrossRef]
  3. Lobova, D.; Celer, V. Expression and serological reactivity of hemorrhagic enteritis virus hexon protein. Folia Microbiol. (Praha) 2016, 61, 227–232. [Google Scholar] [CrossRef] [PubMed]
  4. Cha, S.Y.; Kang, M.; Park, C.K.; Choi, K.S.; Jang, H.K. Epidemiology of egg drop syndrome virus in ducks from South Korea. Poult. Sci. 2013, 92, 1783–1789. [Google Scholar] [CrossRef] [PubMed]
  5. Mockett, A.P.; Cook, J.K. The use of an enzyme-linked immunosorbent assay to detect IgG antibodies to serotype-specific and group-specific antigens of fowl adenovirus serotypes 2, 3 and 4. J. Virol. Methods 1983, 7, 327–335. [Google Scholar] [CrossRef]
  6. Hess, M. Detection and differentiation of avian adenoviruses: A review. Avian Pathol. 2000, 29, 195–206. [Google Scholar] [CrossRef] [PubMed]
  7. Schachner, A.; Matos, M.; Grafl, B.; Hess, M. Fowl adenovirus-induced diseases and strategies for their control—A review on the current global situation. Avian Pathol. 2018, 47, 111–126. [Google Scholar] [CrossRef]
  8. Abe, T.; Nakamura, K.; Tojo, H.; Mase, M.; Shibahara, T.; Yamaguchi, S.; Yuasa, N. Histology, immunohistochemistry, and ultrastructure of hydropericardium syndrome in adult broiler breeders and broiler chicks. Avian Dis. 1998, 42, 606–612. [Google Scholar] [CrossRef]
  9. Davison, A.J.; Benko, M.; Harrach, B. Genetic content and evolution of adenoviruses. J. Gen. Virol. 2003, 84, 2895–2908. [Google Scholar] [CrossRef]
  10. Park, H.S.; Lim, I.S.; Kim, S.K.; Kim, T.K.; Park, C.K.; Yeo, S.G. Molecular analysis of the hexon, penton base, and fiber-2 genes of Korean fowl adenovirus serotype 4 isolates from hydropericardium syndrome-affected chickens. Virus Genes 2017, 53, 111–116. [Google Scholar] [CrossRef]
  11. Rux, J.J.; Kuser, P.R.; Burnett, R.M. Structural and phylogenetic analysis of adenovirus hexons by use of high-resolution X-ray crystallographic, molecular modeling, and sequence-based methods. J. Virol. 2003, 77, 9553–9566. [Google Scholar] [CrossRef] [PubMed]
  12. Suresh, M.; St Cyr, S.; Sharma, J.M. Molecular cloning and sequence analysis of the penton base genes of type II avian adenoviruses. Virus Res. 1995, 39, 289–297. [Google Scholar] [CrossRef] [PubMed]
  13. Chen, L.; Yin, L.; Zhou, Q.; Peng, P.; Du, Y.; Liu, L.; Zhang, Y.; Xue, C.; Cao, Y. Epidemiological investigation of fowl adenovirus infections in poultry in China during 2015-2018. BMC Vet. Res. 2019, 15, 271. [Google Scholar] [CrossRef] [PubMed]
  14. Li, H.; Wang, J.; Qiu, L.; Han, Z.; Liu, S. Fowl adenovirus species C serotype 4 is attributed to the emergence of hepatitis-hydropericardium syndrome in chickens in China. Infect. Genet. Evol. 2016, 45, 230–241. [Google Scholar] [CrossRef] [PubMed]
  15. Wang, T.; Meng, F.; Chen, C.; Shen, Y.; Li, P.; Xu, J.; Feng, Z.; Qu, X.; Wang, F.; Li, B.; et al. Pathogenicity and epidemiological survey of fowl adenovirus in Shandong Province from 2021 to 2022. Front. Microbiol. 2023, 14, 1166078. [Google Scholar] [CrossRef]
  16. Walugembe, M.; Mushi, J.R.; Amuzu-Aweh, E.N.; Chiwanga, G.H.; Msoffe, P.L.; Wang, Y.; Saelao, P.; Kelly, T.; Gallardo, R.A.; Zhou, H.; et al. Genetic Analyses of Tanzanian Local Chicken Ecotypes Challenged with Newcastle Disease Virus. Genes 2019, 10, 546. [Google Scholar] [CrossRef]
  17. Walugembe, M.; Naazie, A.; Mushi, J.R.; Akwoviah, G.A.; Mollel, E.; Mang’enya, J.A.; Wang, Y.; Chouicha, N.; Kelly, T.; Msoffe, P.L.M.; et al. Genetic Analyses of Response of Local Ghanaian Tanzanian Chicken Ecotypes to a Natural Challenge with Velogenic Newcastle Disease Virus. Animals 2022, 12, 2755. [Google Scholar] [CrossRef]
  18. Manjula, P.; Kim, M.; Cho, S.; Seo, D.; Lee, J.H. High Levels of Genetic Variation in MHC-Linked Microsatellite Markers from Native Chicken Breeds. Genes 2021, 12, 240. [Google Scholar] [CrossRef]
  19. Xiang, B.; Liang, J.; You, R.; Han, L.; Mei, K.; Chen, L.; Chen, R.; Zhang, Y.; Dai, X.; Gao, P.; et al. Pathogenicity and transmissibility of a highly pathogenic avian influenza virus H5N6 isolated from a domestic goose in Southern China. Vet. Microbiol. 2017, 212, 16–21. [Google Scholar] [CrossRef]
  20. Shen, Z.; Xiang, B.; Li, S.; Ren, X.; Hong, Y.; Liao, J.; Yu, D.; Ren, T.; Liao, M.; Xu, C. Genetic characterization of fowl adenovirus serotype 4 isolates in Southern China reveals potential cross-species transmission. Infect. Genet. Evol. 2019, 75, 103928. [Google Scholar] [CrossRef]
  21. Li, P.H.; Zheng, P.P.; Zhang, T.F.; Wen, G.Y.; Shao, H.B.; Luo, Q.P. Fowl adenovirus serotype 4: Epidemiology, pathogenesis, diagnostic detection, and vaccine strategies. Poult. Sci. 2017, 96, 2630–2640. [Google Scholar] [CrossRef] [PubMed]
  22. Li, S.; Zhao, R.; Yang, Q.; Wu, M.; Ma, J.; Wei, Y.; Pang, Z.; Wu, C.; Liu, Y.; Gu, Y.; et al. Phylogenetic and pathogenic characterization of current fowl adenoviruses in China. Infect. Genet. Evol. 2022, 105, 105366. [Google Scholar] [CrossRef] [PubMed]
  23. Li, W.; You, G.; Haiyilati, A.; Wang, H.; Jiao, H.; Wang, Y.; Gao, L.; Cao, H.; Li, X.; Zheng, S.J. Critical Role of Viral Protein Hexon in Hypervirulent Fowl Adenovirus Serotype-4-Induced Autophagy by Interaction with BAG3 and Promotion of Viral Replication in LMH Cells. J. Virol. 2023, 97, e0028423. [Google Scholar] [CrossRef] [PubMed]
  24. Zhang, Y.; Liu, A.; Wang, Y.; Cui, H.; Gao, Y.; Qi, X.; Liu, C.; Zhang, Y.; Li, K.; Gao, L.; et al. A Single Amino Acid at Residue 188 of the Hexon Protein Is Responsible for the Pathogenicity of the Emerging Novel Virus Fowl Adenovirus 4. J. Virol. 2021, 95, e0060321. [Google Scholar] [CrossRef]
  25. Madisch, I.; Hofmayer, S.; Moritz, C.; Grintzalis, A.; Hainmueller, J.; Pring-Akerblom, P.; Heim, A. Phylogenetic analysis and structural predictions of human adenovirus penton proteins as a basis for tissue-specific adenovirus vector design. J. Virol. 2007, 81, 8270–8281. [Google Scholar] [CrossRef]
  26. Tan, P.K.; Michou, A.I.; Bergelson, J.M.; Cotten, M. Defining CAR as a cellular receptor for the avian adenovirus CELO using a genetic analysis of the two viral fibre proteins. J. Gen. Virol. 2001, 82, 1465–1472. [Google Scholar] [CrossRef]
  27. Wang, Z.; Zhao, J. Pathogenesis of Hypervirulent Fowl Adenovirus Serotype 4: The Contributions of Viral and Host Factors. Viruses 2019, 11, 741. [Google Scholar] [CrossRef]
  28. Changjing, L.; Haiying, L.; Dongdong, W.; Jingjing, W.; Youming, W.; Shouchun, W.; Jida, L.; Ping, L.; Jianlin, W.; Shouzhen, X.; et al. Characterization of fowl adenoviruses isolated between 2007 and 2014 in China. Vet. Microbiol. 2016, 197, 62–67. [Google Scholar] [CrossRef]
  29. Liu, Y.; Wan, W.; Gao, D.; Li, Y.; Yang, X.; Liu, H.; Yao, H.; Chen, L.; Wang, C.; Zhao, J. Genetic characterization of novel fowl aviadenovirus 4 isolates from outbreaks of hepatitis-hydropericardium syndrome in broiler chickens in China. Emerg. Microbes Infect. 2016, 5, e117. [Google Scholar] [CrossRef]
  30. Schachner, A.; Gonzalez, G.; Endler, L.; Ito, K.; Hess, M. Fowl Adenovirus (FAdV) Recombination with Intertypic Crossovers in Genomes of FAdV-D and FAdV-E, Displaying Hybrid Serological Phenotypes. Viruses 2019, 11, 1094. [Google Scholar] [CrossRef]
  31. Zhang, T.; Jin, Q.; Ding, P.; Wang, Y.; Chai, Y.; Li, Y.; Liu, X.; Luo, J.; Zhang, G. Molecular epidemiology of hydropericardium syndrome outbreak-associated serotype 4 fowl adenovirus isolates in central China. Virol. J. 2016, 13, 188. [Google Scholar] [CrossRef] [PubMed]
  32. Jiang, Z.; Liu, M.; Wang, C.; Zhou, X.; Li, F.; Song, J.; Pu, J.; Sun, Y.; Wang, M.; Shahid, M.; et al. Characterization of fowl adenovirus serotype 4 circulating in chickens in China. Vet. Microbiol. 2019, 238, 108427. [Google Scholar] [CrossRef]
  33. Li, Y.; Fu, J.; Chang, S.; Fang, L.; Cui, S.; Wang, Y.; Cui, Z.; Zhao, P. Isolation, identification, and hexon gene characterization of fowl adenoviruses from a contaminated live Newcastle disease virus vaccine. Poult. Sci. 2017, 96, 1094–1099. [Google Scholar] [CrossRef] [PubMed]
  34. Wang, L.; Zheng, L.; Jiang, S.; Li, X.; Lu, C.; Zhang, L.; Ren, W.; Li, C.; Tian, X.; Li, F.; et al. Isolation, identification and genetic characterization analysis of a fowl aviadenovirus serotype 4 strain from Tianjin, China. Infect. Genet. Evol. 2021, 96, 105078. [Google Scholar] [CrossRef]
  35. Li, G.; Yu, G.; Niu, Y.; Cai, Y.; Liu, S. Airborne Transmission of a Serotype 4 Fowl Adenovirus in Chickens. Viruses 2019, 11, 262. [Google Scholar] [CrossRef]
  36. Wei, Z.; Liu, H.; Diao, Y.; Li, X.; Zhang, S.; Gao, B.; Tang, Y.; Hu, J.; Diao, Y. Pathogenicity of fowl adenovirus (FAdV) serotype 4 strain SDJN in Taizhou geese. Avian Pathol. 2019, 48, 477–485. [Google Scholar] [CrossRef] [PubMed]
  37. Wu, B.; Yang, B.; He, D.; Tang, Y.; Diao, Y. Genetic evolution of fowl adenovirus serotype 4 and its pathogenicity to Cherry Valley ducks in China. Vet. Microbiol. 2022, 274, 109578. [Google Scholar] [CrossRef]
  38. Yu, X.; Wang, Z.; Chen, H.; Niu, X.; Dou, Y.; Yang, J.; Tang, Y.; Diao, Y. Serological and Pathogenic Analyses of Fowl Adenovirus Serotype 4 (FAdV-4) Strain in Muscovy Ducks. Front. Microbiol. 2018, 9, 1163. [Google Scholar] [CrossRef]
  39. Xu, L.; Benson, S.D.; Burnett, R.M. Nanoporous crystals of chicken embryo lethal orphan (CELO) adenovirus major coat protein, hexon. J. Struct. Biol. 2007, 157, 424–431. [Google Scholar] [CrossRef]
  40. Gelderblom, H.; Maichle-Lauppe, I. The fibers of fowl adenoviruses. Arch. Virol. 1982, 72, 289–298. [Google Scholar] [CrossRef]
  41. Zhang, Y.; Liu, R.; Tian, K.; Wang, Z.; Yang, X.; Gao, D.; Zhang, Y.; Fu, J.; Wang, H.; Zhao, J. Fiber2 and hexon genes are closely associated with the virulence of the emerging and highly pathogenic fowl adenovirus 4. Emerg. Microbes Infect. 2018, 7, 199. [Google Scholar] [CrossRef] [PubMed]
  42. Xie, Q.; Wang, W.; Li, L.; Kan, Q.; Fu, H.; Geng, T.; Li, T.; Wan, Z.; Gao, W.; Shao, H.; et al. Domain in Fiber-2 interacted with KPNA3/4 significantly affects the replication and pathogenicity of the highly pathogenic FAdV-4. Virulence 2021, 12, 754–765. [Google Scholar] [CrossRef] [PubMed]
  43. Niu, D.; Feng, J.; Duan, B.; Shi, Q.; Li, Y.; Chen, Z.; Ma, L.; Liu, H.; Wang, Y. Epidemiological survey of avian adenovirus in China from 2015 to 2021 and the genetic variability of highly pathogenic Fadv-4 isolates. Infect. Genet. Evol. 2022, 101, 105277. [Google Scholar] [CrossRef]
  44. Wang, B.; Song, C.; Yang, P.; Song, M.; Zhao, S.; Qiao, Q.; Wang, Z.; Zhao, J. The Role of Hexon Amino Acid 188 Varies in Fowl Adenovirus Serotype 4 Strains with Different Virulence. Microbiol. Spectr. 2022, 10, e0149322. [Google Scholar] [CrossRef] [PubMed]
  45. Rashid, F.; Xie, Z.; Zhang, L.; Luan, Y.; Luo, S.; Deng, X.; Xie, L.; Xie, Z.; Fan, Q. Genetic characterization of fowl aviadenovirus 4 isolates from Guangxi, China, during 2017–2019. Poult. Sci. 2020, 99, 4166–4173. [Google Scholar] [CrossRef] [PubMed]
  46. Yuan, Y.; Zhang, H.; Yi, G.; You, Z.; Zhao, C.; Yuan, H.; Wang, K.; Li, J.; Yang, N.; Lian, L. Genetic Diversity of MHC B-F/B-L Region in 21 Chicken Populations. Front. Genet. 2021, 12, 710770. [Google Scholar] [CrossRef] [PubMed]
  47. Li, M.; Raheem, M.A.; Han, C.; Yu, F.; Dai, Y.; Imran, M.; Hong, Q.; Zhang, J.; Tan, Y.; Zha, L.; et al. The fowl adenovirus serotype 4 (FAdV-4) induce cellular pathway in chickens to produce interferon and antigen-presented molecules (MHCI/II). Poult. Sci. 2021, 100, 101406. [Google Scholar] [CrossRef]
  48. Marek, A.; Nolte, V.; Schachner, A.; Berger, E.; Schlötterer, C.; Hess, M. Two fiber genes of nearly equal lengths are a common and distinctive feature of Fowl adenovirus C members. Vet. Microbiol. 2012, 156, 411–417. [Google Scholar] [CrossRef]
Microorganisms 11 02631 g001
Figure 1. Phylogenetic analysis of the entire hexon gene. Phylogenetic tree for the hexon genes of 10 isolated strains and 41 reference strains created using MEGA 11.0 software using the neighbor-joining method and 1000 bootstrap replicates. The black triangle indicates the isolated strains in this study.
Figure 1. Phylogenetic analysis of the entire hexon gene. Phylogenetic tree for the hexon genes of 10 isolated strains and 41 reference strains created using MEGA 11.0 software using the neighbor-joining method and 1000 bootstrap replicates. The black triangle indicates the isolated strains in this study.
Microorganisms 11 02631 g001
Microorganisms 11 02631 g002
Figure 2. Phylogenetic analysis of the fiber genes. (A) Phylogenetic tree for the fiber1 genes of 10 isolated strains and 27 reference strains created using MEGA 11.0 software using the neighbor joining method. (B) Phylogenetic tree for fiber2 genes of 10 isolated strains and 18 reference strains created using MEGA 11.0 software using the neighbor-joining method. The black triangle indicates isolated strains in this study.
Figure 2. Phylogenetic analysis of the fiber genes. (A) Phylogenetic tree for the fiber1 genes of 10 isolated strains and 27 reference strains created using MEGA 11.0 software using the neighbor joining method. (B) Phylogenetic tree for fiber2 genes of 10 isolated strains and 18 reference strains created using MEGA 11.0 software using the neighbor-joining method. The black triangle indicates isolated strains in this study.
Microorganisms 11 02631 g002
Microorganisms 11 02631 g003
Figure 3. Phylogenetic analysis of the entire penton gene. Phylogenetic tree for penton genes of 10 isolated strains and 28 reference strains created using MEGA 11.0 software using the neighbor-joining method. The black triangle indicates isolated strains in this study.
Figure 3. Phylogenetic analysis of the entire penton gene. Phylogenetic tree for penton genes of 10 isolated strains and 28 reference strains created using MEGA 11.0 software using the neighbor-joining method. The black triangle indicates isolated strains in this study.
Microorganisms 11 02631 g003
Table 1. Surveillance statistics for FAdVs in indigenous chickens in Yunnan province, Southwest China from 2022 to 2023.
Table 1. Surveillance statistics for FAdVs in indigenous chickens in Yunnan province, Southwest China from 2022 to 2023.
LocationHostType of SamplesSymptomsPositive RateIsolatesViral
Species
WenshanXichou black-bone chickenLiver, pericardium, kidneysLoss of appetite, depression, loose stools22.22%
(4/18)		Xichou black-bone chicken/Yunnan/YNBL-8/2023, Xichou black-bone chicken/Yunnan/YNBJ-5/2023
Xichou black-bone chicken/Yunnan/YNBL-7/2023, Xichou black-bone chicken/Yunnan/YNXJ/2022		FAdV-4
DaliWuliangshan black-bone chickenMixture of oropharyngeal and cloacal swabsclinically healthy0.94%
(2/212)		Wuliangshan black-bone chicken/Yunnan/YN-NC1/2022, Wuliangshan black-bone chicken/Yunnan/YNYL/2022FAdV-4
Qinhua chickenMixture of oropharyngeal and cloacal swabsclinically healthy0.78%
(1/115)		Qinhua chicken/Yunnan/YNJC/2022FAdV-4
NujiangLanping rongmao chickenMixture of oropharyngeal and cloacal swabsclinically healthy3.57%
(1/28)		Lanping Rongmao chicken/Yunnan/YNLP/2022FAdV-4
LijiangLa-Bai high leg chickenMixture of oropharyngeal and cloacal swabsclinically healthy0.00%
(0/123)		/
ZhaotongYanjing black-bone chickenLiver, pericardium Liver, pericardiumLoss of appetite, depression and diarrhea20%
(2/10)		Yanjing black-bone chicken/Yunnan/YNNJ/2022,
Yanjing black-bone chicken/Yunnan/YNFD/2022		FAdV-4
Table 2. Accession numbers of all FAdV-4 isolates in this study.
Table 2. Accession numbers of all FAdV-4 isolates in this study.
IsolatesAbbreviationsGene
HexonPentonFiber1Fiber2
Xichou black-bone chicken/Yunnan/YNBL-8/2023YNBL-8/2023OR480649OR480676OR480658OR480667
Xichou black-bone chicken/Yunnan/YNBJ-5/2023YNBJ-5/2023OR480685OR480686OR480687OR480688
Xichou black-bone chicken/Yunnan/YNBL-7/2023YNBL-7/2023OR480650OR480677OR480659OR480668
Yanjing black-bone chicken/Yunnan/YNFD/2022YNFD/2022OR480653OR480680OR480662OR480671
Qinhua chicken/Yunnan/YNJC/2022YNJC/2022OR480656OR480683OR480665OR480674
Lanping Rongmao chicken/Yunnan/YNLP/2022YNLP/2022OR480657OR480684OR480666OR480675
Wuliangshan black-bone chicken/Yunnan/YN-NC1/2022YNNC-1/2022OR480654OR480681OR480663OR480672
Yanjing black-bone chicken/Yunnan/YNNJ/2022YNNJ/2022OR480652OR480679OR480661OR480670
Xichou black-bone chicken/Yunnan/YNXJ/2022YNXJ/2022OR480651OR480678OR480660OR480669
Wuliangshan black-bone chicken/Yunnan/YNYL/2022YNYL/2022OR480655OR480682OR480664OR480673
Table 3. Amino acid variations in the hexon proteins of the FAdV-4 strains identified in this study.
Table 3. Amino acid variations in the hexon proteins of the FAdV-4 strains identified in this study.
IsolateAmino Acids at Position
1797147164188193195199238240243254263264290389402410414429465574588601637707735747797816846914
YNBJ-5/2023YWNSRRQTDTNTIVRNAATSAIDNWTIGPVAV
YNBL-8/2023YRNSRRQTDTNSIVRDAATSTIDNRMTGPVAA
YNBL-7/2023H aWNSRRQIDTNTIVRNAAINTIDDWMTGPVAV
YNFD/2022YWNSRQETDTNTIVGNAATSTIGNWMTGPVAV
YNLP/2022YWNSRQETDTNTIVGNAATSTIGNWMTGPVAV
YNNC-1/2022YWNSRRQTDTNTIVRNAATSTIDNWMTGPVAV
YNYL/2022YWDSRRQTDTNTIVRNAATSTIDNWMTGPAAV
YNNJ/2022YWNFRRQTDTNTIVRNAATSTIDNWMTGPVAV
YNJC/2022YWNSRRQTDTNTIVRNAATSTIDNWMTGPVAV
YNXJ/2022YWNSRRQTDTNTIVRNAATSTIDNWMTDPVAV
PB0505YWNSRRQTDTNTIVRNAATSTIDNWMTGPVAV
HLJFAd15YWNSRRQTDTNTIVRNAATSTIDNWMTGPVAV
ON1YWNTIQETNAETMIRNATTSTVDNWMTGAVGV
MX-SHP95YWNTRQETNAETMIRNQTTSTVDNWMTGAVGV
a Bold-type letters indicate the mutations when compared with the other FAdV-4 strains isolated in this study or ON1 and MX-AHP5.
Table 4. Amino acid variation in the penton proteins of the FAdV-4 strains identified in this study.
Table 4. Amino acid variation in the penton proteins of the FAdV-4 strains identified in this study.
IsolateAmino Acids at Position
4245175193246271356370402426447486497509
YNBJ-5/2023PDVITIVPGIASTK
YNBL-8/2023PDE  aITIVPGVTTTK
YNBL-7/2023PDVITIVPRVATAE
YNFD/2022PDVITVVPGIASTK
YNLP/2022PDVVTIVPGIASTK
YNNC-1/2022PDVITIVPGVATTK
YNYL/2022PDVIAIVPGVATTK
YNNJ/2022PDVITIVPGIASTK
YNJC/2022PDVITIVPGIASTK
YNXJ/2022PDVITIVPGVATTK
PB0505PDVITIVPGVATTK
HLJFAd15PDVITIVPGVATTK
ON1SGVVTIAQGIASTK
MX-SHP95PGVVTIAQGIASTK
a Bold-type letters indicate the mutations when compared with the other FAdV-4 strains isolated in this study or ON1 and MX-AHP5.
Table 5. Amino acid variation in the fiber1 proteins of the FAdV-4 strains identified in this study.
Table 5. Amino acid variation in the fiber1 proteins of the FAdV-4 strains identified in this study.
IsolateAmino Acids at Position
1425284446636970119126153165186196204217251255262263428430
YNBJ-5/2023ASSRTNGSNARKDVGTLLHD-G
YNBL-8/2023ASSRASGSNARRDVGTLFHD-G
YNBL-7/2023ASSRANGSNARKDVGTLLHD-G
YNFD/2022ASSRANGSNARKDVGTLFHD-G
YNLP/2022ASSRANGSNARKDVGTLFHD-G
YNNC-1/2022ASSRANGSNARKDVGTLFHD-G
YNYL/2022AP aSRANGSNARKDVGTLFHD-G
YNNJ/2022ASSRANGSNARKDVGTLLHD-G
YNJC/2022ASSRANGSNARKDVGTLLHD-G
YNXJ/2022ASSRANGSNARKDVGALFHD-G
PB0505ASSRTNGSNARKDVGTLLHD-G
HLJFAd15ASSRTNGSNARKDVGTLLHD-G
ON1VSIPANSGDVHKNTGTILQEHS
MX-SHP95VSIPANSGDVHKNVATILQENG
a Bold-type letters indicate the mutations when compared with the other FAdV-4 strains isolated in this study or ON1 and MX-AHP5.
Table 6. Amino acid variation in the fiber2 proteins of the FAdV-4 strains identified in this study.
Table 6. Amino acid variation in the fiber2 proteins of the FAdV-4 strains identified in this study.
IsolateAmino Acids at Position
11–152229114136142144219232261300305–307319380384413475478
YNBJ-5/2023ENGKPSADEDSDQTTANAITPSAL
YNBL-8/2023ENGKPSADEDSDQTTANAITPSAL
YNBL-7/2023ENGKPSADEDSDQTTANAITPSAL
YNFD/2022ENGKPSADEDSDQTTANAITPSAL
YNLP/2022ENGKPSADEDSDQTTANAITPSAL
YNNC-1/2022ENGKPSADEDSDQTTANAITPRTL
YNYL/2022ENGKPSADG aGSDQTTANAITSSAL
YNNJ/2022ENGKPSADEDSDQTTANAITPSAL
YNJC/2022ENGKPSADEDSDQTTANAITPSAL
YNXJ/2022ENGKPSADEDSDQTTANAITPSAL
PB0505ENGKPSADEDSDQTTANAITPSAL
HLJFAd15ENGKPSADEDSDQTTANAITPSAL
ON1-SPDEDSGESISHPVAPTAV
MX-SHP95-YPAEDADQNTAHAITPTAV
a Bold-type letters indicate the mutations when compared with the other FAdV-4 strains isolated in this study or ON1 and MX-AHP5.
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Lai, J.; Yang, L.; Chen, F.; He, X.; Zhang, R.; Zhao, Y.; Gao, G.; Mu, W.; Chen, X.; Luo, S.; et al. Prevalence and Molecular Characteristics of FAdV-4 from Indigenous Chicken Breeds in Yunnan Province, Southwestern China. Microorganisms 2023, 11, 2631. https://doi.org/10.3390/microorganisms11112631

AMA Style

Lai J, Yang L, Chen F, He X, Zhang R, Zhao Y, Gao G, Mu W, Chen X, Luo S, et al. Prevalence and Molecular Characteristics of FAdV-4 from Indigenous Chicken Breeds in Yunnan Province, Southwestern China. Microorganisms. 2023; 11(11):2631. https://doi.org/10.3390/microorganisms11112631

Chicago/Turabian Style

Lai, Jinyu, Liangyu Yang, Fashun Chen, Xingchen He, Rongjie Zhang, Yong Zhao, Gan Gao, Weiwu Mu, Xi Chen, Shiyu Luo, and et al. 2023. "Prevalence and Molecular Characteristics of FAdV-4 from Indigenous Chicken Breeds in Yunnan Province, Southwestern China" Microorganisms 11, no. 11: 2631. https://doi.org/10.3390/microorganisms11112631

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop