Super-Resolution Microscopy Reveals a Direct Interaction of Intracellular Mycobacterium tuberculosis with the Antimicrobial Peptide LL-37

Abstract

The antimicrobial peptide LL-37 inhibits the growth of the major human pathogen Mycobacterium tuberculosis (Mtb), but the mechanism of the peptide–pathogen interaction inside human macrophages remains unclear. Super-resolution imaging techniques provide a novel opportunity to visualize these interactions on a molecular level. Here, we adapt the super-resolution technique of stimulated emission depletion (STED) microscopy to study the uptake, intracellular localization and interaction of LL-37 with macrophages and virulent Mtb. We demonstrate that LL-37 is internalized by both uninfected and Mtb infected primary human macrophages. The peptide localizes in the membrane of early endosomes and lysosomes, the compartment in which mycobacteria reside. Functionally, LL-37 disrupts the cell wall of intra- and extracellular Mtb, resulting in the killing of the pathogen. In conclusion, we introduce STED microscopy as an innovative and informative tool for studying host–pathogen–peptide interactions, clearly extending the possibilities of conventional confocal microscopy.

1. Introduction

Despite the availability of effective antibiotic treatment of tuberculosis, the management of this devastating disease remains a major challenge. The increasing frequency of drug-resistant strains, as well as severe side effects along with lack of compliance associated with the long duration of treatment, calls for the development of alternative treatment strategies [1,2]. One intriguing possibility is the use of endogenous antimicrobial peptides (AMP), which form an integral part of the human innate immunity system. AMPs are small peptides, which show broad range of activity against human pathogens [3]. Cathelicidin is a cationic antimicrobial peptide (hCAP18) that is up-regulated in human macrophages by a vitamin D-dependent pathway [4]. It is cleaved into the active form LL-37, which is active against extra- and intracellular Mycobacterium tuberculosis (Mtb). The peptide is highly expressed in patients suffering from active pulmonary tuberculosis [5,6]. Several hypothesis have been proposed to explain the mechanism by which AMPs interact with Mtb, eventually causing cell death [7]. One major mechanism involves the disruption of the bacterial cell wall, eventually causing fatal cytoplasmic leakage. Other possibilities include the impairment of cellular processes and pore formation caused by ionic interactions of the peptide and the bacterial cell wall [3,8,9].

Mycobacteria have a complex cell envelope with limited permeability, thereby conferring resistance against conventional antimicrobial compounds [10,11]. The outer layer, called the mycomembrane, is mainly composed of proteins, glycolipids and lipoglycans [12,13,14]. Lipoarabinomannan (LAM) is a glycolipid abundantly expressed in the cell envelope and plays an important role in modulating innate and adaptive host immune response [15,16,17,18]. Inhaled Mtb are phagocytosed by macrophages and enclosed in intracellular vesicles [19]. Mtb can prevent the formation of acidic phagolysosomes and the bacteria sequestered in the phagosomes are protected from degradation. This occurs by inhibiting the recruitment of the early endosomal antigen 1 protein (EEA1) to the phagosomal membrane. EEA1 contributes to the maturation of phagosome to lysosomes [15,20,21].

For internalization of LL-37 into macrophages, clathrin-mediated or lipid-raft dependent endocytosis have been suggested [22,23,24]. In infected macrophages, LL-37 enters phagosomes where intracellular bacteria are either directly eliminated by bacterial cell wall degradation or indirectly by inducing the cellular process of degradation with lysosomal fusion [10]. Hence, there are several different models under debate for the interaction of LL-37, macrophages and Mtb.

A variety of methods have been used to study Mtb, LL-37 and their interaction with macrophages, including biochemistry [25,26], molecular biology [27] and modeling [28]. Several imaging approaches have also been developed, each having specific advantages [29,30,31]. In particular, fluorescence microscopy, which employs specific fluorescent labelling of cellular and molecular targets to co-label different proteins and to localize them to specific cellular compartments. However, diffraction limits the achievable resolution for optical wavelengths to about ~250 nm laterally (in the x-y plane) and ~600 nm in the axial direction (along the optical z-direction). This makes it difficult to visualize defined structures or distinguish between two distinct labelled points positioned closer than the diffraction limit with conventional optical microscopy. Electron microscopy allows sub-nanometer resolution, but has several drawbacks such as the limited number of targets that can be labelled simultaneously [32]. A solution to this problem is provided by the development of super-resolution (SR) optical imaging techniques, which can bypass the diffraction-limit, offering a (close to) molecular level resolution, while maintaining the benefits of the established immunolabelling approach of fluorescent microscopy. Several different SR approaches have been developed including the confocal-based stimulated-emission depletion (STED) microscopy, single-molecule localization microscopy (SMLM), and saturated-structured illumination microscopy (SSIM) [33,34,35,36,37]. Like in confocal microscopy, STED utilizes a focused laser beam, which is scanned across the sample to excite fluorescence. However, the diffraction limit of light is subverted by superimposing the excitation with an additional donut-shaped depletion beam, with an intensity minimum in the center (donut-hole). Thus, the fluorescence signal is spatially confined by stimulated emission depletion. While theoretically, the resolution in STED is not limited, practically considering the phototoxicity tolerance of the biological sample and the laser power available, an axial resolution of ~35 nm and laterally of ~90 nm can be achieved [38]. With the advent of easier sample preparation and the availability of commercial STED microscopes, STED microscopy is an emerging option for investigating questions in biomedical research, including host–pathogen and AMP–pathogen interactions [39,40,41]. In this study, we evaluated the suitability of innovative STED microscopy as a tool for directly observing host–pathogen interaction using, as an example, LL-37, primary human macrophages and virulent Mtb.

2. Results

2.1. Detection of Lipoarabinomannan by STED Microscopy and Confocal Microscopy

Lipoarabinomannan (LAM) is a major component of the mycobacterial cell wall and a potential target for antimicrobial peptides. To detect LAM and visualize the mycobacterial cell wall, we compared confocal- and STED microscopy (Figure 1A). In the confocal microscopy images, it is not possible to define the spatial localization of LAM within the bacterium. In contrast, in STED imaging performed with the same instrument as used for confocal microscopy, the identical bacterium shows a distinct labelling of the cell surface but very little labelling of the cytoplasm. This can also be quantified by taking a cross-section across the bacterium (Supplementary Figure S1). While in the STED image, the maximum of the intensity is at the cell periphery, in confocal imaging, it appears as if the brightest spot is at the cell interior. In addition, a scan along the axial direction (xz-scan) on the identical bacterium shows an intensity minimum at the cell interior in STED microscopy, while a maximum is observed in confocal microscopy (Figure 1B). Thus, the superior resolution of STED imaging allows a more precise interpretation of the immunofluorescent labelling and definition of the localization of the target structure (LAM).

To investigate whether STED microscopy is also suitable for analyzing the interaction between Mtb and antimicrobial peptides, we labelled extracellular Mtb with an Atto647N conjugated NHS-ester, which non-specifically binds to amino-bonds. Labelled bacilli were exposed to LL-37 peptide, which is directly conjugated to a fluorescent dye (TAMRA) for 5 min. Sections acquired with confocal microscopy showed bacterial cells with a spatially overlapping signal in both channels (Figure 1C). In the STED image, the LL-37 signal, which for this imaging condition appears patchy, is clearly distinguishable from the labelling of the cell wall. Note that for this image, in contrast to the image shown in Figure 1a, the focus was adjusted not to the cell interior but to the cell surface, such that labelling is visible throughout. This example illustrates a major advantage of STED over confocal microscopy. While a common pitfall of confocal laser microscopy is an artificial overlap of closely localized molecules, STED microscopy offers a superior spatial resolution range and therefore allows for clear distinction of most cellular components.

2.2. Effect of LL-37 on Extracellular Mtb Visualized by STED Microscopy

Prior to investigating the effect of LL-37 on the morphology of the mycobacterial cell wall by STED microscopy, we ascertained that TAMRA-labelling (required for immune-detection of LL-37) does not affect the antimicrobial activity. By measuring the incorporation of ³H-labelled uracil by LL-37 TAMRA (11 µM)-treated Mtb, we show that LL-37-TAMRA retains antimicrobial activity (Figure 2A). Next, we visualized the effect of LL-37 on Mtb after 5 and 30 min of incubation by STED microscopy. To understand the mechanism of action, we had to reduce the LL-37-TAMRA concentration, since the active concentration was too bright to apply to STED microscopy. After 5 min, LL-37 localized to the cell periphery whereas the cytoplasm remained un-stained (Figure 2B), indicating a fairly homogenous distribution of the peptide to the bacterial cell wall. As for the case of LAM labelling, the interior of the cell showed negligible intensity when imaged using STED microscopy both in the lateral as well as in the axial direction. After 30 min, the cell wall appeared disrupted with few peptide clusters discernible. Additionally, LL-37 clusters are visible in the vicinity of the bacterial cell, suggesting rupture of the cell wall. After extension of the incubation period to 60 min, no rod-shaped bacteria were detectable anymore, indicating that cells had completely disintegrated. Taken together, our results demonstrate that LL-37 rapidly localizes to the mycobacterial cell wall, subsequently causing disruption of the bacilli. Interestingly, while it was easily possible to label the cell wall of untreated bacteria with anti-LAM antibody, similar labelling could not be visualized in cells treated with LL-37. There was no indication that LL-37 is internalized into the mycobacterial cytoplasm, supporting the concept that rupture is directly or indirectly triggered by the interaction of LL-37 molecules with the bacterial cell wall.

2.3. LL-37 Is Taken Up by Macrophages and Colocalizes with Early Endosomes

Since Mtb is an intracellular pathogen residing primarily within macrophages, we investigated whether LL-37 is taken up by the mycobacterial host cells. Macrophages were incubated with LL-37-TAMRA and the uptake and intracellular localization was determined after 30 min by confocal- and STED microscopy. Both imaging techniques clearly revealed an efficient uptake of LL-37 in macrophages (Figure 3). Uptake of LL-37 is likely an active process rather than passive diffusion because a significant reduction in intracellular peptide was observed when cultures were incubated at 4 °C, as determined by flow cytometry (Supplementary Figure S2). Confocal images demonstrate punctate but homogenous labelling within macrophages, indicating that LL-37 is internalized (Figure 3A). STED microscopy not only revealed the uptake of LL-37, but also distinct clusters of LL-37 in donut-like formations (Figure 3B), again demonstrating the superiority of STED microscopy to identify distinct subcellular structures.

The donut-shaped staining pattern suggested that LL-37 accumulates in the membrane of cellular vesicles, e.g., endosomes of different maturation stages and/or lysosomes. To test this hypothesis, we labelled early endosomes of LL-37-treated macrophages with EEA1 antibodies. Dual color STED microscopy images showed a striking colocalization of the early endosomal marker (EEA1) with LL-37 (Figure 3B). Virtually all detectable LL-37 was located in the endosomal membrane. Accordingly, co-labelling of LL-37-TAMRA with lysosomal-associated membrane protein 1 (LAMP1) showed no significant colocalization (Supplementary Figure S3). Both the EEA1 and LL-37 form donut shape structures, indicating that both are localized in the endosomal membrane. The donut-like shape is unlikely to be an artifact, since molecules that are located inside endosomal vesicles appear as punctate objects inside the lumen of the endosomes in STED images [42]. To check the successful internalization of Mtb in macrophages under our experimental conditions, we performed a LAM-staining on intracellular Mtb and a microtubule staining for the macrophages (Supplementary Figure S4).

2.4. LL-37 Localizes in Endosomes and Lysosomes of Infected Macrophages

To exert antimicrobial activity, LL-37 is likely not only taken up by the microbial host cell, but also co-localizes with the intracellular pathogen. We tested this possibility by incubating Mtb-infected macrophages with LL-37-TAMRA overnight and staining for early (EEA-1)- or late (LAMP-1)- endosomes. As already demonstrated for uninfected cells, LL-37 also co-localized with early endosomes in Mtb-infected macrophages. (Figure 4A). In addition, LL-37 co-localized with LAMP-1-positive vesicles (Figure 4B), which was not observed in un-infected macrophages. In infected, but not in un-infected macrophages, LL-37 labelled vesicles showed an elongated morphology (Figure 4A, arrowhead). The shape of the structures resembled the mycobacterial rod-like shape. Quantitative analysis of the perimeter confirmed that these vesicles are elongated as compared to the LL-37-positive vesicles in un-infected macrophages (Figure 4C), possibly reflecting association with intracellular Mtb. In control samples infected with Mtb but not exposed to LL-37, we did not observe the formation of a phagolysosome-like structure labelled with EEA1 or LAMP-1 (Supplementary Figure S5).

2.5. Antimicrobial Activity of LL-37 against Intracellular Mtb

These findings indicated an interaction between Mtb and LL-37 in macrophages. To assess the functional implication of this observation, we infected primary human macrophages with virulent Mtb and treated them with (unlabelled) LL-37. After 4 days, the viability of intracellular bacteria was determined by plating cell lysates and determining the number of CFU. LL-37 decreased the viability of Mtb in all six donors investigated (Figure 5A), confirming previous results by us and others [4,43,44]. To investigate whether the antimicrobial effect of LL-37 correlated with morphological alterations of the bacteria, we employed the STED microscopy technique we had previously established for extracellular bacilli (Figure 1). The images demonstrate that LL-37 co-localizes with the intracellular mycobacteria (detected by LAM-labelling) and show severe fragmentation of the bacterial cell wall (Figure 5B).

In summary, our results establish STED super-resolution microscopy as a powerful tool to detect and characterize the interaction of antimicrobial peptides and intracellular pathogens. Refinement of STED microscopy by including additional wavelengths and live cell imaging will provide a unique opportunity to understand the molecular mechanism and lay the basis for the functional optimization of antimicrobial peptides.

3. Discussion

The major aim of this study was to establish super-resolution optical microscopy as a novel tool to gain mechanistic insight into the interaction of bacterial pathogens and antimicrobial peptides. Using a relevant model of human macrophages, virulent Mtb and the well characterized antimicrobial peptide LL-37, our results demonstrate the advantage of using STED microscopy for imaging intracellular structures as compared to confocal imaging. The nanometer-level resolution allowed us to distinguish between membrane embedded and internalized molecules in cell organelles. Specifically, we established the membrane association of LL-37 in bacteria and endosomes. When analyzing confocal microscopy images, “yellow” overlap in dual colored images (with red and green channels) is often misinterpreted as colocalization. When the same region is visualized with STED microscopy, more details are resolved and colocalization observed by confocal imaging is often proven to be misleading. The high spatial resolution of the STED technique thus demonstrated the colocalization of Mtb and LL-37 in macrophage compartments, greatly reducing the pitfalls of ‘false co-localization’ seen in diffraction-limited optical microcopy. Therefore, we provide evidence that STED microscopy is a feasible technique for biological imaging studies that by far exceeds the resolution of confocal microscopy and hence allows for sub-compartimental localization. It has, however, to be noted that the maximum resolution offered by this technique is ~35 nm, so co-localization errors can occur with distances smaller than the resolution limit.

In this study, we used STED microscopy to localize LL-37 on extracellular Mtb. The peptide initially located to the bacterial cell wall where it presumably interacts with the glycolipid LAM. Over time, we observed a disruption of the mycobacterial cell wall correlating with reduced viability of the bacilli. We detected a similar morphology in Mtb-infected macrophages, where LL-37 is internalized, colocalizes with Mtb in vesicular organelles and induces partial killing of the bacilli. Several studies support such a direct activity of antimicrobial peptides against Mtb [45,46].

For these experiments, a higher multiplicity of infection (MOI) was necessary to reduce the time to locate infected macrophages by STED microscopy. Prolonged examination of the slides results in fading of the fluorescence. In addition, the incubation times had to be adjusted according to the objective of the experiments. For example, LL-37 shows a reduction in intracellular bacteria after 72 h (Figure 5A). Therefore, earlier time points had to be investigated to understand the uptake mechanism and the LL-37–macrophages interaction, which occurs prior to killing (Figure 3). For example, a disruption of the Mtb cell wall when treated with LL-37 and other synthetic peptides has been reported [47]. Peptides with an α-helical structure, like LL-37, often show a flexible configuration in solution but fold into amphipathic, often alpha-helical, structures upon contact with membranes, allowing their insertion into the hydrophobic interior of the bilayer [3,27]. However, whether the deleterious effect is mediated by permeabilization or pore-formation is a means to reach an internal target, e.g., DNA, remains unclear. Pore-formation in model lipid bilayer membrane by lipid–protein interactions has been observed previously using STED microscopy [48]. Our results suggest that peptides bind to the bacterial cell wall, causing dis-integration and rapid rupture within minutes.

Labelling of LAM in LL-37-treated extracellular Mtb was not feasible (data not shown), indicating a possible interaction of the peptide with LAM, as proposed previously [44]. Further support for this hypothesis comes from our observation that LL-37 induces cell wall rupture in intracellular Mtb detected by LAM (Figure 5). The glycolipid LAM has been proposed to prevent the fusion of phagosomes with lysosomes [16]. Further, stimulation of LAM triggers the production of LL-37 [10,47]. It is tempting to speculate that the targeted disruption of the virulence factor LAM is a potential mechanism by which LL-37 exerts antimicrobial activity.

Our results showed that LL-37 is internalized by macrophages and localizes within the membrane of early endosomal labelled with EEA1. In Mtb-infected cells, a proportion of LL-37 and EEA1 co-labelled vesicles showed an elongated morphology with increased size. These structures likely correspond to phagosomes, since, apart from their larger size and shape, phagosomes share similar membrane morphology and luminal composition with an early endosome and hence are also labelled with the anti-EEA1 antibody [20,49]. Phagosomes are cytoplasmic vesicles which internalize foreign particles and fuse to form phagolysosomes. Ingested particles are exposed to the hostile acidic environment and are eventually degraded by autophagy [43,50]. This defense mechanism is normally suppressed by almost all virulent Mtb [51], but this inhibition may be counteracted by LL-37.

The phagosome maturation process requires the recruitment of several membrane proteins. One of the early steps involves recruitment of EEA1 to the phagosome membrane either by fusion with endosome vesicles or directly from the cytosol. In the phagosomal membrane, EEA1 acts as a regulator of vesicular protein trafficking and the presence of EEA1 is vital to trigger fusion with lysosomes [21]. However, the mycobacterial phagosomes exclude EEA1 protein and this is one of the contributing factors in autophagy evasion [52]. The glycosylated form of LAM, termed mannose LAM, is one of the key Mtb-derived molecules interfering with EEA1 recruitment. Mannose LAM inhibits phosphadtidylinositol-3-kinase (PI3K), which is essential for mediating EEA1 acquisition to the phagosomes [15]. However, the presence of EEA1 observed in the STED images reported here, points to an efficient blocking of LAM by LL-37 in the mycobacterial phagosome membrane of the LL-37-treated macrophages. This could point to the initiation of autophagy in the presence of LL-37; whether autophagy is also stimulated by the presence of LL-37, as proposed earlier [10], cannot be tested by our experiments.

Antimicrobial peptides are promising candidates to complement conventional drug therapy in tuberculosis and show consistent activity against multi-drug resistant strains [9]. However, our knowledge on the cellular and molecular mode of action remains incomplete. Innovative imaging technologies offer exciting opportunities to address these questions from a different angle. Our results establish STED microscopy as an innovative and informative tool for studying interactions between antimicrobial peptides, host cells and the pathogen.

4. Materials and Methods

4.1. Bacteria

Mycobacterium tuberculosis H37Rv (ATCC 27294, Manassas, VA, USA) was grown in suspension with constant gentle rotation in roller bottles (Corning, Corning, NY, USA) containing Middlebrook 7H9 broth (BD Biosciences, Franklin Lakes, NJ, USA) supplemented with 1% glycerol (Roth, Karlsruhe, Germany), 0.05% Tween 80 (Sigma-Aldrich, Steinheim, Germany), and 10% Middlebrook oleic acid, albumin, dextrose, and catalase enrichment (BD Biosciences, OADC) adjusted to pH 7.2–7.4. Aliquots from logarithmically growing cultures were kept frozen at −80 °C in 7H9 broth with 20% glycerol, and representative vials were thawed and enumerated for viable CFU on Middlebrook 7H11 plates (BD Biosciences, Franklin Lakes, NJ, USA). Staining of bacterial suspensions with fluorochromic substrates differentiating between live and dead bacteria (BacLight, Invitrogen, Carlsbad, CA, USA) revealed a viability of the bacteria >90% and confirmed the absence of large bacterial aggregates. Thawed bacterial stock aliquots were sonicated for 10 min at 40 kHz and 110 W in a Transsonic digital S (Elma, Wetzikon, Switzerland) before use.

4.2. Generation of Human Monocyte-Derived Macrophages

Human peripheral blood mononuclear cells (PBMC) were isolated by density gradient centrifugation (Ficoll-Paque Plus; GE Healthcare, Chicago, IL, USA) of buffy coat preparations from anonymous donors (Institute of Transfusion Medicine, Ulm University). Monocytes were selected from PBMCs by adherence on plastic. Monocyte-derived macrophages (referred to as “macrophages”) were generated by treatment with GM-CSF (10 ng/mL; Miltenyi Biotec, Bergisch Gladbach, Germany) in RPMI 1640 (Life Technologies, Carlsbad, CA, USA) cell culture medium supplemented with L-glutamine (2 mM; PAN Biotech, Aidenbach, Germany), HEPES (10 mM; Biochrom, Berlin, Germany), Penicillin/Streptomycin (100 µg/mL; Biochrom, Berlin, Germany) and 5% heat-inactivated human serum (Lonza, Basel, Switzerland) for 6 d. After culture, macrophages were detached with EDTA (1 mM; Sigma-Aldrich, Steinheim, Germany). Phenotypic characterization by flow cytometry demonstrated that macrophages expressed CD68 (anti–CD68-FITC, clone Y1/82A; BD Biosciences, Franklin Lakes, NJ, USA) and MHCII (anti–HLA-DR-PerCP, clone L243; BD Biosciences, Franklin Lakes, NJ, USA) as described [53].

4.3. Quantification of Intracellular Mycobacterial Growth

A quantity of 5 × 10⁶ Macrophages were bulk-infected in 6-well plates with single-cell suspensions of M. tuberculosis (multiplicity of infection (MOI = 5)) in RPMI 1640 (Life technologies, Carlsbad, CA, USA), L-glutamine (2 mM; PAN biotech, Aidenbach, Germany), HEPES (10 mM; Biochrom, Berlin, Germany), Penicillin (60 µg/mL; Biochrom, Berlin, Germany), (Amphotericin B 5.6 µg/mL; Sigma-Aldrich, Steinheim, Germany) and 10% non-heat-inactivated human serum (Lonza, Basel, Switzerland). After 2 h, macrophages were washed thoroughly to remove extracellular Mtb and harvested using EDTA (1 mM; Sigma-Aldrich, Steinheim, Germany). The efficacy of infection and cell viability was determined using Auramine-Rhodamine (Merck, Darmstadt, Germany) and Annexin V staining (BD, Franklin Lakes, NJ, USA), as previously described [53]. Then, 2 × 10⁵ infected macrophages were seeded in 24-well plates and incubated with LL-37 (11 µM) for 4 d. To enumerate the number of viable bacilli, infected macrophages were lysed with 0.3% saponin (Sigma-Aldrich, Steinheim, Germany). Cell lysates were vigorously resuspended, transferred in screw cap tubes and sonicated for 10 min at 40 kHz and 110 W. Afterwards, serial dilutions (1:10; 1:100, 1:1000) of the sonicates were plated on 7H11 agar plates (BD, Franklin Lakes, NJ, USA) and incubated for 14 d before counting the CFU.

4.4. ³H-Uracil Proliferation Assay

As a correlate of mycobacterial metabolism (and by inference viability), we measured the rate of RNA synthesis by Mtb. For this, we determined the uptake of radioactively-(³H)-labelled Uracil. To do this, 2 × 10⁶ sonicated Mtb were incubated with LL-37 (11 µM) in a 96 well plate (Thermo Fisher, Waltham, MA, USA) in Middlebrook 7H9 broth supplemented with OADC, 1% glycerol and 0.05% Tween 80. The final volume was 100 µL and all samples were set up in triplicates. After 3 days 5,6-³H-Uracil (ART-0282, Biotrend, 0.3 µCi, Cologne, Germany) was added and cultures were incubated for additional 18 h. Mtb were inactivated by adding paraformaldehyde (PFA, Sigma-Aldrich, 4% final concentration, Steinheim, Germany) for 20 min. Bacteria were transferred to glass fiber filters (Printed Filtermat A, PerkinElmer, Waltham, MA, USA) using a 96 well- cell harvester (Inotech, Nabburg, Germany). The filtermat was sealed with wax plate containing the scintillation liquid (MeltiLex, Perkin Elmer, Waltham, MA, USA) at 75 °C. Incorporation of ³H Uracil by the bacilli was measured using a ß-counter (Sense Beta, Hidex, Turku, Finland). The mean counts per minute of each sample were normalized to the untreated control and expressed as antimicrobial activity.

4.5. Treatment of Extracellular Mtb with LL-37-TAMRA

For investigating the interaction of LL-37 with Mtb, LL-37 conjugated to the fluorescence dye 5-TAMRA ([LL-37, 37 aa]; Innovagen, Lund, Sweden) peptide was used. Extracellular Mtb (2 × 10⁷) were seeded in a 12-well plate (Sarstedt, Nümbrecht, Germany) containing a high precision glass coverslip (Carl Roth, Karlsruhe, Germany; 170 µm thickness) coated with poly-L-lysine (Sigma-Aldrich, Steinheim, Germany). Afterwards, LL-37-TAMRA (22 nM) was added and incubated as indicated. Excess peptide was removed by rinsing of the wells carefully. For control experiments, bacteria (2 × 10⁷) were labelled with anti-LAM antibodies (mouse monoclonal, clone CS-35, 1:500 dilution of hybridoma supernatant) for 2 h, without LL-37 treatment. Finally, Atto647-conjugated goat anti-mouse (1:1000; Sigma-Aldrich, Steinheim, Germany) was added for 60 min. The coverslips were fixed with PFA, transferred from the well onto a microscope slide and immersed in mounting medium (2,2′-thiodiethanol; Sigma-Aldrich, Steinheim, Germany). The samples were then analysed by confocal- or STED microscopy.

4.6. Imaging of the LL-37 and Mtb in Macrophages

A quantity of 5 × 10⁶ Macrophages were bulk-infected with Mtb (MOI 50). Infected macrophages were harvested and given into a 12-well plate containing glass coverslips. LL-37-TAMRA (11 µM) was added overnight. Cells were then fixed with 4% paraformaldehyde, followed by permeabilization and blocking for 2 h in 0.3% Triton-X and 3% BSA (all Sigma-Aldrich, Steinheim, Germany). Next, Mtb was labelled by LAM antibodies (mouse monoclonal, clone CS-35, 1:500 dilution of hybridoma supernatant) for 2 h. Finally, Atto647-conjugated goat anti-mouse (1:1000) was added for 60 min. The coverslips were mounted onto a microscope slide and analysed by STED microscopy.

4.7. Treatment of Succinimidyl Ester Labelled Mycobacteria with LL-37

First, 1 × 10⁹ Mycobacteria were washed twice with staining buffer (PBS, 0.5% Tween 80 (Roth, Karlsruhe, Germany), 0.2M sodium bicarbonate (Roth, Karlsruhe, Germany); pH of 8.8). Bacteria were then incubated with staining buffer containing the succinimidyl ester Atto647N (1 µg/mL, Sigma-Aldrich, Steinheim, Germany) for 1 h at 37 °C. Afterwards, bacteria were washed three times and resuspended in the appropriate medium. Bacterial viability after Atto647N labelling was ca. 80% in comparison to unlabelled Mtb, as determined by ³H-Uracil proliferation assay. For STED imaging, labelled bacteria were seeded on a poly-l-lysine coated high precision glass coverslip and exposed to LL-37-TAMRA for 5 min before being fixed with PFA, as detailed previously.

4.8. Detection of Microtubule, EEA-1 and LAMP-1 in Macrophages

A total of 5 × 10⁶ Macrophages were infected with Mtb (MOI = 50). Infected macrophages were harvested, given into a 12-well plate containing glass coverslips and incubated with LL-37-TAMRA (11 µM) overnight. Cells were fixed with 4% PFA, followed by permeabilization and blocking for 2 h in 0.3% Triton-X and 3% BSA. Cells were incubated with antibodies directed against α-tubulin (rabbit recombinant anti α-tubulin EP1332Y, 1:500; Abcam, Cambridge, United Kingdom) or early endosomes (rabbit polyclonal anti EEA1; 1:500; Sigma-Aldrich, Steinheim, Germany) or lysosomes (rabbit polyclonal anti LAMP1, 1:500; Sigma-Aldrich, Steinheim, Germany) for 2 h at room temperature. Afterwards, cells were washed and incubated with Atto594- or Atto647-conjugated goat anti-rabbit antibodies (1:800; Sigma-Aldrich, Steinheim, Germany) for 2 h. Subsequently, coverslips were mounted onto microscope slides and analysed by STED microscopy.

4.9. STED Setup and Imaging

The STED measurements were performed on a custom build dual-color setup, as described previously [38]. Briefly, a super-continuum laser source (SC-450-PP-HE, Fianium, United Kingdom) with a broad spectral range was used for both, dual color excitation (568 nm and 633 nm) as well as dual color depletion (~720 nm and ~750 nm); beams which were guided onto the back aperture of a high numerical aperture objective (HCX PL APO 100×/1.40–0.70 oil CS, Leica Microsystems, Mannheim, Germany). A piezo stage (733.2DD, Physik Instrumente, Karlsruhe, Germany) was used for scanning the sample and emission was recorded by two avalanche photodiodes (SPCMAQRH-13/14-FC, Perkin-Elmer, Waltham, MA, USA) separately for each channel. The acquisition mode on the same microscope setup could be switched between confocal (diffraction limited resolution, excitation lasers only) or STED (with the depletion beam additionally switched on). Images were first acquired in confocal mode with a pixel size of 100 nm, followed by STED imaging with a pixel size of 20 nm; both with a pixel dwell time of 300 μs. Though a large variety of dye molecules are compatible with the STED technique, the dyes Atto594 and Atto647N were chosen as they have a high fluorescence efficiency and enhanced photostability [54]. Moreover, the fact that both the dyes were chosen from the red-edge of the spectrum resulted in low background from cellular autofluorescence, normally visible in the green and blue spectral bands.

4.10. Flow Cytometry

For investigation of cellular uptake of LL-37, 1 × 10⁶ macrophages were seeded in a 24-well plate and incubated with LL-37-TAMRA (11 µM) for 30 min at 4 °C or room temperature, respectively. Afterwards, cells were harvested using EDTA (1 mM, Sigma-Aldrich, Steinheim, Germany) and transferred into FACS tubes (Falcon, Corning, Corning, NY, USA). Followed by centrifugation at 1300 rpm for 10 min, cells were subsequently washed once with FACS buffer (PBS, 10% sodium azide, 10% FCS). Samples were then measured using a FACS Calibur (BD Biosciences, Franklin Lakes, NJ, USA) and analyzed with FlowJo v10.4.1 (BD, Franklin Lakes, NJ, USA).

4.11. Image Processing and Analysis

Image processing was performed using ImageJ software (v 1.52c). All images displayed in this study are processed for brightness/contrast and then displayed with a Gaussian blur of 0.8 to filter out background noise. Images acquired in confocal mode were imaged with a larger pixel size (100 nm) to correlate with the maximum resolution of the confocal technique. The confocal images displayed in this study were resized to 20 nm pixel size in ImageJ, without any filtering, to match the visualization of STED images.

For determining the perimeter of vesicular structures, image analysis was performed in ImageJ using a custom written macro. Raw images were background subtracted (rolling ball method with a radius of 50 pixel) to remove noise and then smoothed. A region of interest (ROI) was manually selected enclosing only one cell (Supplementary Figure S6). Next, binary masks were created for all EEA1 labelled vesicles by automatic thresholding within the ROI [55]. Perimeters of all detected masks were determined by using the ‘Analyze Particles’ tool in ImageJ. In order to reduce noise, objects with an area smaller 10000 nm² were discarded in accordance with an expected minimal endosomal size of r > 50 nm.

4.12. Statistical Analysis

All statistical analyses as detailed in the legends were performed using GraphPad Prism v8.2.1 (GraphPad Software, La Jolla, CA, USA). A difference in results giving a p-value < 0.05 was determined as significant.