25-Hydroxycholesterol-Conjugated EK1 Peptide with Potent and Broad-Spectrum Inhibitory Activity against SARS-CoV-2, Its Variants of Concern, and Other Human Coronaviruses
Abstract
:1. Introduction
2. Results
2.1. The Combination of 25-HC and EK1 Peptide Showed the Synergistic Antiviral Effect
2.2. Construction and Evaluation of 25-HC Conjugated EK1-Based Lipopeptides with Different Linkers
2.3. EK1P4HC Potently Inhibited Infection by SARS-CoV-2 and Its Variants
2.4. EK1P4HC Exhibited a Potent Inhibitory Activity against Infection by Authentic HCoV-229E and HCoV-OC43, as Well as Pseudotyped SARS-CoV and MERS-CoV
2.5. EK1P4HC Protected Newborn Mice from Lethal HCoV-OC43 Infection
3. Discussion
4. Materials and Methods
4.1. Cells, Viruses, Peptides, and Plasmids
4.2. Package of Coronavirus Pseudoviruses
4.3. Authentic Virus Inhibition Assay
4.4. PsV Inhibition Assay
4.5. Measurement of 25-HC Inhibitory Activity against HCoVs
4.6. Measurement of Combinatorial Inhibitory Activity of 25-HC and EK1 against HCoVs
4.7. Cytotoxicity Assay
4.8. Assessment of In Vivo Protective Efficacy of EK1P4HC against HCoV-OC43 in Newborn Mice
4.9. Statistical Analysis
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
References
- Zhou, W.; Wang, W. Fast-spreading SARS-CoV-2 variants: Challenges to and new design strategies of COVID-19 vaccines. Signal Transduct. Target. Ther. 2021, 6, 226. [Google Scholar] [CrossRef]
- Chen, B.; Tian, E.K.; He, B.; Tian, L.; Han, R.; Wang, S.; Xiang, Q.; Zhang, S.; El Arnaout, T.; Cheng, W. Overview of lethal human coronaviruses. Signal Transduct. Target. Ther. 2020, 5, 89. [Google Scholar] [CrossRef] [PubMed]
- Lu, L.; Su, S.; Yang, H.; Jiang, S. Antivirals with common targets against highly pathogenic viruses. Cell 2021, 184, 1604–1620. [Google Scholar] [CrossRef] [PubMed]
- Zhang, A.R.; Shi, W.Q.; Liu, K.; Li, X.L.; Liu, M.J.; Zhang, W.H.; Zhao, G.P.; Chen, J.J.; Zhang, X.A.; Miao, D.; et al. Epidemiology and evolution of Middle East respiratory syndrome coronavirus, 2012–2020. Infect. Dis. Poverty 2021, 10, 66. [Google Scholar] [CrossRef]
- Jiang, S.; Du, L. Effect of Low-Pathogenic Human Coronavirus-Specific Antibodies on SARS-CoV-2. Trends Immunol. 2020, 41, 853–854. [Google Scholar] [CrossRef] [PubMed]
- Cao, M.; Su, X.; Jiang, S. Broad-Spectrum Anti-coronavirus Vaccines and Therapeutics to Combat the Current COVID-19 Pandemic and Future Coronavirus Disease Outbreaks. Stem Cell Rep. 2021, 16, 398–411. [Google Scholar] [CrossRef]
- Du, L.; He, Y.; Zhou, Y.; Liu, S.; Zheng, B.J.; Jiang, S. The spike protein of SARS-CoV—A target for vaccine and therapeutic development. Nat. Rev. Microbiol 2009, 7, 226–236. [Google Scholar] [CrossRef] [PubMed]
- Xia, S.; Zhu, Y.; Liu, M.; Lan, Q.; Xu, W.; Wu, Y.; Ying, T.; Liu, S.; Shi, Z.; Jiang, S.; et al. Fusion mechanism of 2019-nCoV and fusion inhibitors targeting HR1 domain in spike protein. Cell Mol. Immunol. 2020, 17, 765–767. [Google Scholar] [CrossRef]
- Xia, S.; Liu, M.; Wang, C.; Xu, W.; Lan, Q.; Feng, S.; Qi, F.; Bao, L.; Du, L.; Liu, S.; et al. Inhibition of SARS-CoV-2 (previously 2019-nCoV) infection by a highly potent pan-coronavirus fusion inhibitor targeting its spike protein that harbors a high capacity to mediate membrane fusion. Cell Res. 2020, 30, 343–355. [Google Scholar] [CrossRef] [Green Version]
- Cyster, J.G.; Dang, E.V.; Reboldi, A.; Yi, T. 25-Hydroxycholesterols in innate and adaptive immunity. Nat. Rev. Immunol. 2014, 14, 731–743. [Google Scholar] [CrossRef]
- Liu, S.Y.; Aliyari, R.; Chikere, K.; Li, G.; Marsden, M.D.; Smith, J.K.; Pernet, O.; Guo, H.; Nusbaum, R.; Zack, J.A.; et al. Interferon-inducible cholesterol-25-hydroxylase broadly inhibits viral entry by production of 25-hydroxycholesterol. Immunity 2013, 38, 92–105. [Google Scholar] [CrossRef] [Green Version]
- Zang, R.; Case, J.B.; Yutuc, E.; Ma, X.; Shen, S.; Gomez Castro, M.F.; Liu, Z.; Zeng, Q.; Zhao, H.; Son, J.; et al. Cholesterol 25-hydroxylase suppresses SARS-CoV-2 replication by blocking membrane fusion. Proc. Natl. Acad Sci. USA 2020, 117, 32105–32113. [Google Scholar] [CrossRef] [PubMed]
- Wang, S.; Li, W.; Hui, H.; Tiwari, S.K.; Zhang, Q.; Croker, B.A.; Rawlings, S.; Smith, D.; Carlin, A.F.; Rana, T.M. Cholesterol 25-Hydroxylase inhibits SARS-CoV-2 and other coronaviruses by depleting membrane cholesterol. EMBO J. 2020, 39, e106057. [Google Scholar] [CrossRef] [PubMed]
- Xia, S.; Yan, L.; Xu, W.; Agrawal, A.S.; Algaissi, A.; Tseng, C.K.; Wang, Q.; Du, L.; Tan, W.; Wilson, I.A.; et al. A pan-coronavirus fusion inhibitor targeting the HR1 domain of human coronavirus spike. Sci. Adv. 2019, 5, eaav4580. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Gunst, J.D.; Staerke, N.B.; Pahus, M.H.; Kristensen, L.H.; Bodilsen, J.; Lohse, N.; Dalgaard, L.S.; Bronnum, D.; Frobert, O.; Honge, B.; et al. Efficacy of the TMPRSS2 inhibitor camostat mesilate in patients hospitalized with COVID-19-a double-blind randomized controlled trial. EClinicalMedicine 2021, 35, 100849. [Google Scholar] [CrossRef]
- Simonis, A.; Theobald, S.J.; Fatkenheuer, G.; Rybniker, J.; Malin, J.J. A comparative analysis of remdesivir and other repurposed antivirals against SARS-CoV-2. EMBO Mol. Med. 2021, 13, e13105. [Google Scholar] [CrossRef]
- Chen, P.; Nirula, A.; Heller, B.; Gottlieb, R.L.; Boscia, J.; Morris, J.; Huhn, G.; Cardona, J.; Mocherla, B.; Stosor, V.; et al. SARS-CoV-2 Neutralizing Antibody LY-CoV555 in Outpatients with COVID-19. N. Engl. J. Med. 2021, 384, 229–237. [Google Scholar] [CrossRef]
- ACTIV-3/TICO LY-CoV555 Study Group. A Neutralizing Monoclonal Antibody for Hospitalized Patients with COVID-19. N. Engl. J. Med. 2021, 384, 905–914. [Google Scholar] [CrossRef] [PubMed]
- Hoffmann, M.; Arora, P.; Gross, R.; Seidel, A.; Hornich, B.F.; Hahn, A.S.; Kruger, N.; Graichen, L.; Hofmann-Winkler, H.; Kempf, A.; et al. SARS-CoV-2 variants B.1.351 and P.1 escape from neutralizing antibodies. Cell 2021, 184, 2384–2393.e2312. [Google Scholar] [CrossRef]
- Planas, D.; Veyer, D.; Baidaliuk, A.; Staropoli, I.; Guivel-Benhassine, F.; Rajah, M.M.; Planchais, C.; Porrot, F.; Robillard, N.; Puech, J.; et al. Reduced sensitivity of SARS-CoV-2 variant Delta to antibody neutralization. Nature 2021, 596, 276–280. [Google Scholar] [CrossRef]
- Xia, S.; Lan, Q.; Zhu, Y.; Wang, C.; Xu, W.; Li, Y.; Wang, L.; Jiao, F.; Zhou, J.; Hua, C.; et al. Structural and functional basis for pan-CoV fusion inhibitors against SARS-CoV-2 and its variants with preclinical evaluation. Signal Transduct. Target. Ther. 2021, 6, 288. [Google Scholar] [CrossRef] [PubMed]
- Wang, C.; Zhao, L.; Xia, S.; Zhang, T.; Cao, R.; Liang, G.; Li, Y.; Meng, G.; Wang, W.; Shi, W.; et al. De Novo Design of α-Helical Lipopeptides Targeting Viral Fusion Proteins: A Promising Strategy for Relatively Broad-Spectrum Antiviral Drug Discovery. J. Med. Chem. 2018, 61, 8734–8745. [Google Scholar] [CrossRef] [PubMed]
- Chou, T.C. Theoretical basis, experimental design, and computerized simulation of synergism and antagonism in drug combination studies. Pharmacol. Rev. 2006, 58, 621–681. [Google Scholar] [CrossRef]
Name | Sequence | MW |
---|---|---|
EK1P4HC | SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG-PEG4-25-HC | 5453 |
EK1P8HC | SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG-PEG8-25-HC | 5689 |
EK1P12HC | SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG-PEG12-25-HC | 5865 |
EK1P24HC | SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKELGSGSG-PEG24-25-HC | 6393 |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2021 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Lan, Q.; Wang, C.; Zhou, J.; Wang, L.; Jiao, F.; Zhang, Y.; Cai, Y.; Lu, L.; Xia, S.; Jiang, S. 25-Hydroxycholesterol-Conjugated EK1 Peptide with Potent and Broad-Spectrum Inhibitory Activity against SARS-CoV-2, Its Variants of Concern, and Other Human Coronaviruses. Int. J. Mol. Sci. 2021, 22, 11869. https://doi.org/10.3390/ijms222111869
Lan Q, Wang C, Zhou J, Wang L, Jiao F, Zhang Y, Cai Y, Lu L, Xia S, Jiang S. 25-Hydroxycholesterol-Conjugated EK1 Peptide with Potent and Broad-Spectrum Inhibitory Activity against SARS-CoV-2, Its Variants of Concern, and Other Human Coronaviruses. International Journal of Molecular Sciences. 2021; 22(21):11869. https://doi.org/10.3390/ijms222111869
Chicago/Turabian StyleLan, Qiaoshuai, Chao Wang, Jie Zhou, Lijue Wang, Fanke Jiao, Yanbo Zhang, Yanxing Cai, Lu Lu, Shuai Xia, and Shibo Jiang. 2021. "25-Hydroxycholesterol-Conjugated EK1 Peptide with Potent and Broad-Spectrum Inhibitory Activity against SARS-CoV-2, Its Variants of Concern, and Other Human Coronaviruses" International Journal of Molecular Sciences 22, no. 21: 11869. https://doi.org/10.3390/ijms222111869