Genome-Wide Identification, Characterisation, and Evolution of the Transcription Factor WRKY in Grapevine (Vitis vinifera): New View and Update
Abstract
:1. Introduction
2. Results
2.1. The Phylogeny of Grape WRKY Genes
2.2. The Characteristics of 62 WRKY Classes in Grapes
2.3. Unified Systematics of Grape WRKY Genes
3. Discussion
3.1. Grapevine WRKY Numbering
3.2. Grape WRKY Diversity in Cultivars
3.3. WRKY Domains in Grapevine
3.4. WRKY Groups and Evolution Clades
3.5. Chimeric WRKY
3.6. Grapevine WRKY Evolution
4. Materials and Methods
4.1. Genome Data
4.2. Genome-Wide Analyses and Identification of WRKY
4.3. Phylogenetic Analyses
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
References
- Joshi, R.; Wani, S.H.; Singh, B.; Bohra, A.; Dar, Z.A.; Lone, A.A.; Pareek, A.; Singla-Pareek, S.L. Transcription Factors and Plants Response to Drought Stress: Current Understanding and Future Directions. Front. Plant Sci. 2016, 7, 1029. [Google Scholar]
- Joshi, R.; Anwar, K.; Das, P.; Singla-Pareek, S.; Pareek, A. Overview of Methods for Assessing Salinity and Drought Tolerance of Transgenic Wheat Lines. Methods Mol. Biol. 2017, 1679, 83–95. [Google Scholar] [CrossRef]
- Takahashi, F.; Shinozaki, K. Long-Distance Signaling in Plant Stress Response. Curr. Opin. Plant Biol. 2019, 47, 106–111. [Google Scholar] [CrossRef]
- Bakshi, M.; Oelmüller, R. WRKY Transcription Factors. Plant Signal. Behav. 2014, 9, e27700. [Google Scholar] [CrossRef]
- Cai, R.; Zhao, Y.; Wang, Y.; Lin, Y.; Peng, X.; Li, Q.; Chang, Y.; Jiang, H.; Xiang, Y.; Cheng, B. Overexpression of a Maize WRKY58 Gene Enhances Drought and Salt Tolerance in Transgenic Rice. Plant Cell Tissue Organ Cult. (PCTOC) 2014, 119, 565–577. [Google Scholar] [CrossRef]
- He, G.-H.; Xu, J.-Y.; Wang, Y.-X.; Liu, J.-M.; Li, P.-S.; Chen, M.; Ma, Y.-Z.; Xu, Z.-S. Drought-Responsive WRKY Transcription Factor Genes TaWRKY1 and TaWRKY33 from Wheat Confer Drought and/or Heat Resistance in Arabidopsis. BMC Plant Biol. 2016, 16, 1–16. [Google Scholar] [CrossRef]
- Zhu, D.; Ma, Q.; Hao, J.; Liu, X. Function Exploration of Grape WRKY Family Proteins Under Abiotic Stresses. Biotechnol. Bull. 2016, 32, 77–83. [Google Scholar] [CrossRef]
- Gao, H.; Wang, Y.; Xu, P.; Zhang, Z. Overexpression of a WRKY Transcription Factor TaWRKY2 Enhances Drought Stress Tolerance in Transgenic Wheat. Front. Plant Sci. 2018, 9, 997. [Google Scholar] [CrossRef]
- Wang, C.-T.; Ru, J.-N.; Liu, Y.-W.; Yang, J.-F.; Li, M.; Xu, Z.-S.; Fu, J.-D. The Maize WRKY Transcription Factor ZmWRKY40 Confers Drought Resistance in Transgenic Arabidopsis. Int. J. Mol. Sci. 2018, 19, 2580. [Google Scholar] [CrossRef]
- Wang, F.-P.; Zhao, P.-P.; Zhang, L.; Zhai, H.; Du, Y.-P. Functional Characterization of WRKY46 in Grape and Its Putative Role in the Interaction between Grape and Phylloxera (Daktulosphaira vitifoliae). Hortic. Res. 2019, 6, 102. [Google Scholar] [CrossRef]
- Goyal, P.; Manzoor, M.M.; Vishwakarma, R.A.; Sharma, D.; Dhar, M.K.; Gupta, S. A Comprehensive Transcriptome-Wide Identification and Screening of WRKY Gene Family Engaged in Abiotic Stress in Glycyrrhiza Glabra. Sci. Rep. 2020, 10, 373. [Google Scholar] [CrossRef]
- Huang, Y.; Chen, F.; Chai, M.; Xi, X.; Zhu, W.; Qi, J.; Liu, K.; Ma, S.; Su, H.; Tian, Y. Ectopic Overexpression of Pineapple Transcription Factor AcWRKY31 Reduces Drought and Salt Tolerance in Rice and Arabidopsis. Int. J. Mol. Sci. 2022, 23, 6269. [Google Scholar] [CrossRef]
- Wang, Y.; Dong, B.; Wang, N.; Zheng, Z.; Yang, L.; Zhong, S.; Fang, Q.; Xiao, Z.; Zhao, H. A WRKY Transcription Factor PmWRKY57 from Prunus Mume Improves Cold Tolerance in Arabidopsis Thaliana. Mol. Biotechnol. 2023, 65, 1359–1368. [Google Scholar] [CrossRef]
- Wani, S.H.; Anand, S.; Singh, B.; Bohra, A.; Joshi, R. WRKY Transcription Factors and Plant Defense Responses: Latest Discoveries and Future Prospects. Plant Cell Rep. 2021, 40, 1071–1085. [Google Scholar] [CrossRef]
- Khoso, M.A.; Hussain, A.; Ritonga, F.N.; Ali, Q.; Channa, M.M.; Alshegaihi, R.M.; Meng, Q.; Ali, M.; Zaman, W.; Brohi, R.D. WRKY Transcription Factors (TFs): Molecular Switches to Regulate Drought, Temperature, and Salinity Stresses in Plants. Front. Plant Sci. 2022, 13, 1039329. [Google Scholar] [CrossRef]
- Goyal, P.; Devi, R.; Verma, B.; Hussain, S.; Arora, P.; Tabassum, R.; Gupta, S. WRKY Transcription Factors: Evolution, Regulation, and Functional Diversity in Plants. Protoplasma 2023, 260, 331–348. [Google Scholar] [CrossRef]
- Rushton, P.J.; Torres, J.T.; Parniske, M.; Wernert, P.; Hahlbrock, K.; Somssich, I.E. Interaction of Elicitor-Induced DNA-Binding Proteins with Elicitor Response Elements in the Promoters of Parsley PR1 Genes. EMBO J. 1996, 15, 5690–5700. [Google Scholar] [CrossRef]
- Zhang, Y.; Wang, L. The WRKY Transcription Factor Superfamily: Its Origin in Eukaryotes and Expansion in Plants. BMC Evol. Biol. 2005, 5, 1–12. [Google Scholar] [CrossRef]
- Eulgem, T.; Rushton, P.J.; Robatzek, S.; Somssich, I.E. The WRKY Superfamily of Plant Transcription Factors. Trends Plant Sci. 2000, 5, 199–206. [Google Scholar] [CrossRef]
- Xie, Z.; Zhang, Z.-L.; Zou, X.; Huang, J.; Ruas, P.; Thompson, D.; Shen, Q.J. Annotations and Functional Analyses of the RiceWRKYGene Superfamily Reveal Positive and Negative Regulators of Abscisic Acid Signaling in Aleurone Cells. Plant Physiol. 2005, 137, 176–189. [Google Scholar] [CrossRef]
- Zhang, T.; Tan, D.; Zhang, L.; Zhang, X.; Han, Z. Phylogenetic Analysis and Drought-Responsive Expression Profiles of the WRKY Transcription Factor Family in Maize. Agric. Gene 2017, 3, 99–108. [Google Scholar] [CrossRef]
- Goel, R.; Pandey, A.; Trivedi, P.K.; Asif, M.H. Genome-Wide Analysis of the Musa WRKY Gene Family: Evolution and Differential Expression during Development and Stress. Front. Plant Sci. 2016, 7, 299. [Google Scholar]
- Zhou, Q.; Tian, A.; Zou, H.; Xie, Z.; Lei, G.; Huang, J.; Wang, C.; Wang, H.; Zhang, J.; Chen, S. Soybean WRKY-type Transcription Factor Genes, GmWRKY13, GmWRKY21, AndGmWRKY54, Confer Differential Tolerance to Abiotic Stresses in TransgenicArabidopsisplants. Plant Biotechnol. J. 2008, 6, 486–503. [Google Scholar] [CrossRef]
- Xu, H.; Watanabe, K.A.; Zhang, L.; Shen, Q.J. WRKY Transcription Factor Genes in Wild Rice Oryza Nivara. DNA Res. 2016, 23, 311–323. [Google Scholar] [CrossRef]
- Yang, B.; Jiang, Y.; Rahman, M.H.; Deyholos, M.K.; Kav, N.N. Identification and Expression Analysis of WRKY Transcription Factor Genes in Canola (Brassica napus L.) in Response to Fungal Pathogens and Hormone Treatments. BMC Plant Biol. 2009, 9, 68. [Google Scholar] [CrossRef]
- He, Y.; Mao, S.; Gao, Y.; Zhu, L.; Wu, D.; Cui, Y.; Li, J.; Qian, W. Genome-Wide Identification and Expression Analysis of WRKY Transcription Factors under Multiple Stresses in Brassica Napus. PLoS ONE 2016, 11, e0157558. [Google Scholar] [CrossRef]
- Chen, H.; Wang, Y.; Liu, J.; Zhao, T.; Yang, C.; Ding, Q.; Zhang, Y.; Mu, J.; Wang, D. Identification of WRKY Transcription Factors Responding to Abiotic Stresses in Brassica napus L. Planta 2022, 255, 3. [Google Scholar] [CrossRef]
- Jiang, J.; Ma, S.; Ye, N.; Jiang, M.; Cao, J.; Zhang, J. WRKY Transcription Factors in Plant Responses to Stresses. J. Integr. Plant Biol. 2017, 59, 86–101. [Google Scholar] [CrossRef]
- Wu, J.; Chen, J.; Wang, L.; Wang, S. Genome-Wide Investigation of WRKY Transcription Factors Involved in Terminal Drought Stress Response in Common Bean. Front. Plant Sci. 2017, 8, 380. [Google Scholar] [CrossRef]
- Chanwala, J.; Satpati, S.; Dixit, A.; Parida, A.; Giri, M.K.; Dey, N. Genome-Wide Identification and Expression Analysis of WRKY Transcription Factors in Pearl Millet (Pennisetum Glaucum) under Dehydration and Salinity Stress. BMC Genom. 2020, 21, 231. [Google Scholar] [CrossRef]
- Song, Y.; Cui, H.; Shi, Y.; Xue, J.; Ji, C.; Zhang, C.; Yuan, L.; Li, R. Genome-Wide Identification and Functional Characterization of the Camelina Sativa WRKY Gene Family in Response to Abiotic Stress. BMC Genom. 2020, 21, 786. [Google Scholar] [CrossRef]
- Du, Z.; You, S.; Zhao, X.; Xiong, L.; Li, J. Genome-Wide Identification of WRKY Genes and Their Responses to Chilling Stress in Kandelia Obovata. Front. Genet. 2022, 13, 875316. [Google Scholar] [CrossRef]
- Rai, G.K.; Mishra, S.; Chouhan, R.; Mushtaq, M.; Chowdhary, A.A.; Rai, P.K.; Kumar, R.R.; Kumar, P.; Perez-Alfocea, F.; Colla, G. Plant Salinity Stress, Sensing, and Its Mitigation through WRKY. Front. Plant Sci. 2023, 14, 1238507. [Google Scholar] [CrossRef]
- Qiu, Y.; Yu, D. Over-Expression of the Stress-Induced OsWRKY45 Enhances Disease Resistance and Drought Tolerance in Arabidopsis. Environ. Exp. Bot. 2009, 65, 35–47. [Google Scholar] [CrossRef]
- Zhang, J.; Peng, Y.; Guo, Z. Constitutive Expression of Pathogen-Inducible OsWRKY31 Enhances Disease Resistance and Affects Root Growth and Auxin Response in Transgenic Rice Plants. Cell Res. 2008, 18, 508–521. [Google Scholar] [CrossRef]
- Shahzad, R.; Harlina, P.; Cong-Hua, X.; Ewas, M.; Nishawy, E.; Zhenyuan, P.; Foly, M. Overexpression of Potato Transcription Factor (StWRKY1) Conferred Resistance to Phytophthora Infestans and Improved Tolerance to Water Stress. Plant Omics 2016, 9, 149–158. [Google Scholar] [CrossRef]
- Wang, M.; Vannozzi, A.; Wang, G.; Liang, Y.-H.; Tornielli, G.B.; Zenoni, S.; Cavallini, E.; Pezzotti, M.; Cheng, Z.-M. Genome and Transcriptome Analysis of the Grapevine (Vitis vinifera L.) WRKY Gene Family. Hortic. Res. 2014, 1, 14016. [Google Scholar] [CrossRef]
- Alston, J.M.; Sambucci, O. Grapes in the World Economy. In Grape Genome; Springer: Cham, Switzerland, 2019; pp. 1–24. [Google Scholar] [CrossRef]
- Naulleau, A.; Gary, C.; Prévot, L.; Hossard, L. Evaluating Strategies for Adaptation to Climate Change in Grapevine Production–A Systematic Review. Front. Plant Sci. 2021, 11, 607859. [Google Scholar] [CrossRef]
- Jones, G.V.; White, M.A.; Cooper, O.R.; Storchmann, K. Climate Change and Global Wine Quality. Clim. Chang. 2005, 73, 319–343. [Google Scholar] [CrossRef]
- Schultz, H.R. Climate Change and Viticulture: Research Needs for Facing the Future. J. Wine Res. 2010, 21, 113–116. [Google Scholar] [CrossRef]
- Medrano, H.; Tomás, M.; Martorell, S.; Escalona, J.-M.; Pou, A.; Fuentes, S.; Flexas, J.; Bota, J. Improving Water Use Efficiency of Vineyards in Semi-Arid Regions. A Review. Agron. Sustain. Dev. 2015, 35, 499–517. [Google Scholar] [CrossRef]
- Mosedale, J.R.; Abernethy, K.E.; Smart, R.E.; Wilson, R.J.; Maclean, I.M.D. Climate Change Impacts and Adaptive Strategies: Lessons from the Grapevine. Glob. Chang. Biol. 2016, 22, 3814–3828. [Google Scholar] [CrossRef]
- Wang, L.; Zhu, W.; Fang, L.; Sun, X.; Su, L.; Liang, Z.; Wang, N.; Londo, J.P.; Li, S.; Xin, H. Genome-Wide Identification of WRKY Family Genes and Their Response to Cold Stress in Vitis vinifera. BMC Plant Biol. 2014, 14, 103. [Google Scholar] [CrossRef] [PubMed]
- Guo, C.; Guo, R.; Xu, X.; Gao, M.; Li, X.; Song, J.; Zheng, Y.; Wang, X. Evolution and Expression Analysis of the Grape (Vitis vinifera L.) WRKY Gene Family. J. Exp. Bot. 2014, 65, 1513–1528. [Google Scholar] [CrossRef]
- Huang, T.; Yang, J.; Yu, D.; Han, X.; Wang, X. Bioinformatics Analysis of WRKY Transcription Factors in Grape and Their Potential Roles Prediction in Sugar and Abscisic Acid Signaling Pathway. J. Plant Biochem. Biotechnol. 2021, 30, 67–80. [Google Scholar] [CrossRef]
- Zhang, Y.; Feng, J. Identification and Characterization of the Grape WRKY Family. BioMed Res. Int. 2014, 2014, 787680. [Google Scholar] [CrossRef] [PubMed]
- Agudelo-Romero, A.-P.; Erban, A.; Rego, C.; Carbonell-Bejerano, P.; Nascimento, T.; Sousa, L.; Martínez-Zapater, J.M.; Kopka, J.; Fortes, A.M. Transcriptome and Metabolome Reprogramming in Vitis vinifera Cv. Trincadeira Berries upon Infection with Botrytis Cinerea. J. Exp. Bot. 2015, 66, 1769–1785. [Google Scholar] [CrossRef] [PubMed]
- Wu, W.; Fu, P.; Lu, J. Grapevine WRKY Transcription Factors. Fruit Res. 2022, 2, 1–8. [Google Scholar] [CrossRef]
- Hao, J.; Ma, Q.; Hou, L.; Zhao, F.; Xin, L. VvWRKY13 Enhances ABA Biosynthesis in Vitis vinifera. Acta Soc. Bot. Pol. 2017, 86, 3546. [Google Scholar] [CrossRef]
- Zhao, J.; Zhang, X.; Guo, R.; Wang, Y.; Guo, C.; Li, Z.; Chen, Z.; Gao, H.; Wang, X. Over-Expression of a Grape WRKY Transcription Factor Gene, VlWRKY48, in Arabidopsis Thaliana Increases Disease Resistance and Drought Stress Tolerance. Plant Cell Tissue Organ Cult. (PCTOC) 2018, 132, 359–370. [Google Scholar] [CrossRef]
- Guo, R.; Qiao, H.; Zhao, J.; Wang, X.; Tu, M.; Guo, C.; Wan, R.; Li, Z.; Wang, X. The Grape VlWRKY3 Gene Promotes Abiotic and Biotic Stress Tolerance in Transgenic Arabidopsis thaliana. Front. Plant Sci. 2018, 9, 545. [Google Scholar] [CrossRef]
- Zhu, D.; Hou, L.; Xiao, P.; Guo, Y.; Deyholos, M.K.; Liu, X. VvWRKY30, a Grape WRKY Transcription Factor, Plays a Positive Regulatory Role under Salinity Stress. Plant Sci. 2019, 280, 132–142. [Google Scholar] [CrossRef]
- Hou, L.; Fan, X.; Hao, J.; Liu, G.; Zhang, Z.; Liu, X. Negative Regulation by Transcription Factor VvWRKY13 in Drought Stress of Vitis vinifera L. Plant Physiol. Biochem. 2020, 148, 114–121. [Google Scholar] [CrossRef]
- Liu, W.; Liang, X.; Cai, W.; Wang, H.; Liu, X.; Cheng, L.; Song, P.; Luo, G.; Han, D. Isolation and Functional Analysis of VvWRKY28, a Vitis vinifera WRKY Transcription Factor Gene, with Functions in Tolerance to Cold and Salt Stress in Transgenic Arabidopsis thaliana. Int. J. Mol. Sci. 2022, 23, 13418. [Google Scholar] [CrossRef]
- Amato, A.; Cavallini, E.; Zenoni, S.; Finezzo, L.; Begheldo, M.; Ruperti, B.; Tornielli, G.B. A Grapevine TTG2-Like WRKY Transcription Factor Is Involved in Regulating Vacuolar Transport and Flavonoid Biosynthesis. Front. Plant Sci. 2017, 7, 1979. [Google Scholar]
- Merz, P.R.; Moser, T.; Höll, J.; Kortekamp, A.; Buchholz, G.; Zyprian, E.; Bogs, J. The Transcription Factor VvWRKY33 Is Involved in the Regulation of Grapevine (Vitis vinifera) Defense against the Oomycete Pathogen Plasmopara Viticola. Physiol. Plant. 2015, 153, 365–380. [Google Scholar] [CrossRef]
- Ma, Q.; Zhang, G.; Hou, L.; Wang, W.; Hao, J.; Liu, X. Vitis vinifera VvWRKY13 Is an Ethylene Biosynthesis-Related Transcription Factor. Plant Cell Rep. 2015, 34, 1593–1603. [Google Scholar] [CrossRef]
- Liu, H.; Yang, W.; Liu, D.; Han, Y.; Zhang, A.; Li, S. Ectopic Expression of a Grapevine Transcription Factor VvWRKY11 Contributes to Osmotic Stress Tolerance in Arabidopsis. Mol. Biol. Rep. 2011, 38, 417–427. [Google Scholar] [CrossRef]
- Guillaumie, S.; Mzid, R.; Méchin, V.; Léon, C.; Hichri, I.; Destrac-Irvine, A.; Trossat-Magnin, C.; Delrot, S.; Lauvergeat, V. The Grapevine Transcription Factor WRKY2 Influences the Lignin Pathway and Xylem Development in Tobacco. Plant Mol. Biol. 2010, 72, 215–234. [Google Scholar] [CrossRef]
- Marchive, C.; Mzid, R.; Deluc, L.G.; Barrieu, F.; Pirrello, J.; Gauthier, A.; Corio-Costet, M.-F.; Regad, F.; Cailleteau, B.; Hamdi, S.; et al. Isolation and Characterization of a Vitis vinifera Transcription Factor, VvWRKY1, and Its Effect on Responses to Fungal Pathogens in Transgenic Tobacco Plants. J. Exp. Bot. 2007, 58, 1999–2010. [Google Scholar] [CrossRef]
- Yongmei, C.; Zhen, Z.; Dan, Z.; Jie, H.; Lixia, H.; Xin, L. VvWRKY13 from Vitis vinifera Negatively Modulates Salinity Tolerance. Plant Cell Tissue Organ Cult. (PCTOC) 2019, 139, 455–465. [Google Scholar] [CrossRef]
- Mzid, R.; Zorrig, W.; Ben Ayed, R.; Ben Hamed, K.; Ayadi, M.; Damak, Y.; Lauvergeat, V.; Hanana, M. The Grapevine VvWRKY2 Gene Enhances Salt and Osmotic Stress Tolerance in Transgenic Nicotiana Tabacum. 3 Biotech 2018, 8, 2777. [Google Scholar] [CrossRef]
- Marchive, C.; Léon, C.; Kappel, C.; Coutos-Thévenot, P.; Corio-Costet, M.-F.; Delrot, S.; Lauvergeat, V. Over-Expression of VvWRKY1 in Grapevines Induces Expression of Jasmonic Acid Pathway-Related Genes and Confers Higher Tolerance to the Downy Mildew. PLoS ONE 2013, 8, e54185. [Google Scholar] [CrossRef]
- Amato, A.; Cavallini, E.; Walker, A.R.; Pezzotti, M.; Bliek, M.; Quattrocchio, F.; Koes, R.; Ruperti, B.; Bertini, E.; Zenoni, S.; et al. The MYB5-Driven MBW Complex Recruits a WRKY Factor to Enhance the Expression of Targets Involved in Vacuolar Hyper-Acidification and Trafficking in Grapevine. Plant J. 2019, 99, 1220–1241. [Google Scholar] [CrossRef]
- Jiang, J.; Xi, H.; Dai, Z.; Lecourieux, F.; Yuan, L.; Liu, X.; Patra, B.; Wei, Y.; Li, S.; Wang, L. VvWRKY8 Represses Stilbene Synthase Genes through Direct Interaction with VvMYB14 to Control Resveratrol Biosynthesis in Grapevine. J. Exp. Bot. 2019, 70, 715–729. [Google Scholar] [CrossRef]
- Zhang, Z.; Jiang, C.; Chen, C.; Su, K.; Lin, H.; Zhao, Y.; Guo, Y. VvWRKY5 Enhances White Rot Resistance in Grape by Promoting the Jasmonic Acid Pathway. Hortic. Res. 2023, 10, uhad172. [Google Scholar] [CrossRef]
- Wang, F.-P.; Zhao, P.-P.; Zhang, L.; Zhai, H.; Abid, M.; Du, Y.-P. The VvWRKY37 Regulates Bud Break in Grape Vine through ABA-Mediated Signaling Pathways. Front. Plant Sci. 2022, 13, 929892. [Google Scholar] [CrossRef]
- Wei, Y.; Meng, N.; Wang, Y.; Cheng, J.; Duan, C.; Pan, Q. Transcription Factor VvWRKY70 Inhibits Both Norisoprenoid and Flavonol Biosynthesis in Grape. Plant Physiol. 2023, 193, 2055–2070. [Google Scholar] [CrossRef]
- Wu, K.-L.; Guo, Z.-J.; Wang, H.-H.; Li, J. The WRKY Family of Transcription Factors in Rice and Arabidopsis and Their Origins. DNA Res. 2005, 12, 9–26. [Google Scholar] [CrossRef]
- Ramiro, D.; Jalloul, A.; Petitot, A.-S.; Grossi De Sá, M.F.; Maluf, M.P.; Fernandez, D. Identification of Coffee WRKY Transcription Factor Genes and Expression Profiling in Resistance Responses to Pathogens. Tree Genet. Genomes 2010, 6, 767–781. [Google Scholar] [CrossRef]
- Karkute, S.G.; Gujjar, R.S.; Rai, A.; Akhtar, M.; Singh, M.; Singh, B. Genome Wide Expression Analysis of WRKY Genes in Tomato (Solanum lycopersicum) under Drought Stress. Plant Gene 2018, 13, 8–17. [Google Scholar] [CrossRef]
- Chen, C.; Chen, X.; Han, J.; Lu, W.; Ren, Z. Genome-Wide Analysis of the WRKY Gene Family in the Cucumber Genome and Transcriptome-Wide Identification of WRKY Transcription Factors That Respond to Biotic and Abiotic Stresses. BMC Plant Biol. 2020, 20, 443. [Google Scholar] [CrossRef] [PubMed]
- The French–Italian Public Consortium for Grapevine Genome Characterization. The Grapevine Genome Sequence Suggests Ancestral Hexaploidization in Major Angiosperm Phyla. Nature 2007, 449, 463–467. [Google Scholar] [CrossRef] [PubMed]
- Shi, X.; Cao, S.; Wang, X.; Huang, S.; Wang, Y.; Liu, Z.; Liu, W.; Leng, X.; Peng, Y.; Wang, N. The Complete Reference Genome for Grapevine (Vitis viniferaL.) Genetics and Breeding. Hortic. Res. 2023, 10, uhad061. [Google Scholar] [CrossRef] [PubMed]
- Velt, A.; Frommer, B.; Blanc, S.; Holtgräwe, D.; Duchêne, É.; Dumas, V.; Grimplet, J.; Hugueney, P.; Kim, C.; Lahaye, M. An Improved Reference of the Grapevine Genome Reasserts the Origin of the PN40024 Highly Homozygous Genotype. G3: Genes Genomes Genet. 2023, 13, jkad067. [Google Scholar] [PubMed]
- Jakoby, M.; Weisshaar, B.; Dröge-Laser, W.; Vicente-Carbajosa, J.; Tiedemann, J.; Kroj, T.; Parcy, F. BZIP Transcription Factors in Arabidopsis. Trends Plant Sci. 2002, 7, 106–111. [Google Scholar] [CrossRef] [PubMed]
- Mzid, R.; Marchive, C.; Blancard, D.; Deluc, L.; Barrieu, F.; Corio-Costet, M.; Drira, N.; Hamdi, S.; Lauvergeat, V. Overexpression of VvWRKY2 in Tobacco Enhances Broad Resistance to Necrotrophic Fungal Pathogens. Physiol. Plant. 2007, 131, 434–447. [Google Scholar] [CrossRef] [PubMed]
- Vannozzi, A.; Wong, D.C.J.; Höll, J.; Hmmam, I.; Matus, J.T.; Bogs, J.; Ziegler, T.; Dry, I.; Barcaccia, G.; Lucchin, M. Combinatorial Regulation of Stilbene Synthase Genes by WRKY and MYB Transcription Factors in Grapevine (Vitis vinifera L.). Plant Cell Physiol. 2018, 59, 1043–1059. [Google Scholar] [CrossRef] [PubMed]
- Wang, X.; Tu, M.; Wang, D.; Liu, J.; Li, Y.; Li, Z.; Wang, Y.; Wang, X. CRISPR/Cas9-mediated Efficient Targeted Mutagenesis in Grape in the First Generation. Plant Biotechnol. J. 2018, 16, 844–855. [Google Scholar] [CrossRef]
- Ma, T.; Chen, S.; Liu, J.; Fu, P.; Wu, W.; Song, S.; Gao, Y.; Ye, W.; Lu, J. Plasmopara Viticola Effector PvRXLR111 Stabilizes VvWRKY40 to Promote Virulence. Mol. Plant Pathol. 2021, 22, 231–242. [Google Scholar] [CrossRef]
- Yue, M.; Jiang, L.; Zhang, N.; Zhang, L.; Liu, Y.; Wang, Y.; Li, M.; Lin, Y.; Zhang, Y.; Zhang, Y.; et al. Importance of FaWRKY71 in Strawberry (Fragaria × Ananassa) Fruit Ripening. Int. J. Mol. Sci. 2022, 23, 12483. [Google Scholar] [CrossRef] [PubMed]
- Hou, L.; Wang, W.-J.; Guo, X.-P.; Peining, F.; Xinye, L. Gene Cloning and Expression Analysis of Three WRKYs in Vitis vinifera L. Plant Physiol. J. 2013, 49, 289–296. [Google Scholar]
- Feng, J.; Zhang, W.; Wang, W.; Nieuwenhuizen, N.J.; Atkinson, R.G.; Gao, L.; Hu, H.; Zhao, W.; Ma, R.; Zheng, H.; et al. Integrated Transcriptomic and Proteomic Analysis Identifies Novel Regulatory Genes Associated with Plant Growth Regulator-Induced Astringency in Grape Berries. J. Agric. Food Chem. 2024, 72, 4433–4447. [Google Scholar] [CrossRef] [PubMed]
- Kim, M.; Xi, H.; Park, J. Genome-Wide Comparative Analyses of GATA Transcription Factors among 19 Arabidopsis Ecotype Genomes: Intraspecific Characteristics of GATA Transcription Factors. PLoS ONE 2021, 16, e0252181. [Google Scholar] [CrossRef] [PubMed]
- Kan, J.; Gao, G.; He, Q.; Gao, Q.; Jiang, C.; Ahmar, S.; Liu, J.; Zhang, J.; Yang, P. Genome-Wide Characterization of WRKY Transcription Factors Revealed Gene Duplication and Diversification in Populations of Wild to Domesticated Barley. Int. J. Mol. Sci. 2021, 22, 5354. [Google Scholar] [CrossRef] [PubMed]
- Maeo, K.; Hayashi, S.; Kojima-Suzuki, H.; Morikami, A.; Nakamura, K. Role of Conserved Residues of the WRKY Domain in the DNA-Binding of Tobacco WRKY Family Proteins. Biosci. Biotechnol. Biochem. 2001, 65, 2428–2436. [Google Scholar] [CrossRef]
- Duan, M.-R.; Nan, J.; Liang, Y.-H.; Mao, P.; Lu, L.; Li, L.; Wei, C.; Lai, L.; Li, Y.; Su, X.-D. DNA Binding Mechanism Revealed by High Resolution Crystal Structure of Arabidopsis Thaliana WRKY1 Protein. Nucleic Acids Res. 2007, 35, 1145–1154. [Google Scholar] [CrossRef] [PubMed]
- Ciolkowski, I.; Wanke, D.; Birkenbihl, R.P.; Somssich, I.E. Studies on DNA-Binding Selectivity of WRKY Transcription Factors Lend Structural Clues into WRKY-Domain Function. Plant Mol. Biol. 2008, 68, 81–92. [Google Scholar] [CrossRef]
- Mohanta, T.K.; Park, Y.-H.; Bae, H. Novel Genomic and Evolutionary Insight of WRKY Transcription Factors in Plant Lineage. Sci. Rep. 2016, 6, 37309. [Google Scholar] [CrossRef]
- Chen, X.; Li, C.; Wang, H.; Guo, Z. WRKY Transcription Factors: Evolution, Binding, and Action. Phytopathol. Res. 2019, 1, 13. [Google Scholar] [CrossRef]
- van Verk, M.C.; Pappaioannou, D.; Neeleman, L.; Bol, J.F.; Linthorst, H.J.M. A Novel WRKY Transcription Factor Is Required for Induction of PR-1a Gene Expression by Salicylic Acid and Bacterial Elicitors. Plant Physiol. 2008, 146, 1983–1995. [Google Scholar] [CrossRef] [PubMed]
- Zheng, J.; Liu, F.; Zhu, C.; Li, X.; Dai, X.; Yang, B.; Zou, X.; Ma, Y. Identification, Expression, Alternative Splicing and Functional Analysis of Pepper WRKY Gene Family in Response to Biotic and Abiotic Stresses. PLoS ONE 2019, 14, e0219775. [Google Scholar] [CrossRef] [PubMed]
- Ling, J.; Jiang, W.; Zhang, Y.; Yu, H.; Mao, Z.; Gu, X.; Huang, S.; Xie, B. Genome-Wide Analysis of WRKY Gene Family in Cucumis Sativus. BMC Genom. 2011, 12, 471. [Google Scholar] [CrossRef] [PubMed]
- Jimmy, J.L.; Babu, S. Variations in the Structure and Evolution of Rice WRKY Genes in Indica and Japonica Genotypes and Their Co-Expression Network in Mediating Disease Resistance. Evol. Bioinform Online 2019, 15, 117693431985772. [Google Scholar] [CrossRef] [PubMed]
- Khuman, A.; Arora, S.; Makkar, H.; Patel, A.; Chaudhary, B. Extensive Intragenic Divergences amongst Ancient WRKY Transcription Factor Gene Family Is Largely Associated with Their Functional Diversity in Plants. Plant Gene 2020, 22, 100222. [Google Scholar] [CrossRef]
- Rinerson, C.I.; Rabara, R.C.; Tripathi, P.; Shen, Q.J.; Rushton, P.J. The Evolution of WRKY Transcription Factors. BMC Plant Biol. 2015, 15, 66. [Google Scholar] [CrossRef] [PubMed]
- Phukan, U.J.; Jeena, G.S.; Shukla, R.K. WRKY Transcription Factors: Molecular Regulation and Stress Responses in Plants. Front. Plant Sci. 2016, 7, 760. [Google Scholar]
- Shende, R.; Shinde, R.; Damse, D.; Dande, P. Exploring Biotic and Abiotic Responses in Plants: A Systems Biology Perspective on the Role of WRKY Transcription Factors. Pharma Innov. J. 2023, 12, 2102–2112. [Google Scholar]
- Johanson, U.; West, J.; Lister, C.; Michaels, S.; Amasino, R.; Dean, C. Molecular Analysis of FRIGIDA, a Major Determinant of Natural Variation in Arabidopsis Flowering Time. Science 2000, 290, 344–347. [Google Scholar] [CrossRef]
- Zhang, L.; Chen, L.; Yu, D. Transcription Factor WRKY75 Interacts with DELLA Proteins to Affect Flowering. Plant Physiol. 2018, 176, 790–803. [Google Scholar] [CrossRef]
- Hori, K.; Maruyama, F.; Fujisawa, T.; Togashi, T.; Yamamoto, N.; Seo, M.; Sato, S.; Yamada, T.; Mori, H.; Tajima, N. Klebsormidium Flaccidum Genome Reveals Primary Factors for Plant Terrestrial Adaptation. Nat. Commun. 2014, 5, 3978. [Google Scholar] [CrossRef] [PubMed]
- Cannon, S.; Mitra, A.; Baumgarten, A.; Young, N.; May, G. The Roles of Segmental and Tandem Gene Duplication in the Evolution of Large Gene Families in Arabidopsis Thaliana. BMC Plant Biol. 2004, 4, 10. [Google Scholar] [CrossRef] [PubMed]
- Wang, Y.; Wang, X.; Paterson, A.H. Genome and Gene Duplications and Gene Expression Divergence: A View from Plants. Ann. N. Y. Acad. Sci. 2012, 1256, 1–14. [Google Scholar] [CrossRef] [PubMed]
- Hellsten, U.; Aspden, J.L.; Rio, D.C.; Rokhsar, D.S. A Segmental Genomic Duplication Generates a Functional Intron. Nat. Commun. 2011, 2, 454. [Google Scholar] [CrossRef] [PubMed]
- Lin, H.; Zhu, W.; Silva, J.C.; Gu, X.; Buell, C.R. Intron Gain and Loss in Segmentally Duplicated Genes in Rice. Genome Biol. 2006, 7, 1–11. [Google Scholar] [CrossRef] [PubMed]
- Wolf, Y.I.; Koonin, E.V. Genome Reduction as the Dominant Mode of Evolution. BioEssays 2013, 35, 829–837. [Google Scholar] [CrossRef] [PubMed]
- O’Malley, M.A.; Wideman, J.G.; Ruiz-Trillo, I. Losing Complexity: The Role of Simplification in Macroevolution. Trends Ecol. Evol. 2016, 31, 608–621. [Google Scholar] [CrossRef] [PubMed]
- Domazet-Lošo, M.; Široki, T.; Šimičević, K.; Domazet-Lošo, T. Macroevolutionary Dynamics of Gene Family Gain and Loss along Multicellular Eukaryotic Lineages. Nat. Commun. 2024, 15, 2663. [Google Scholar] [CrossRef]
- Minio, A.; Cochetel, N.; Vondras, A.M.; Massonnet, M.; Cantu, D. Assembly of Complete Diploid-Phased Chromosomes from Draft Genome Sequences. G3 Gene Genomes Genet. 2022, 12, jkac143. [Google Scholar]
- Jones, P.; Binns, D.; Chang, H.-Y.; Fraser, M.; Li, W.; McAnulla, C.; McWilliam, H.; Maslen, J.; Mitchell, A.; Nuka, G. InterProScan 5: Genome-Scale Protein Function Classification. Bioinformatics 2014, 30, 1236–1240. [Google Scholar] [CrossRef]
- Mistry, J.; Chuguransky, S.; Williams, L.; Qureshi, M.; Salazar, G.A.; Sonnhammer, E.L.L.; Tosatto, S.C.E.; Paladin, L.; Raj, S.; Richardson, L.J. Pfam: The Protein Families Database in 2021. Nucleic Acids Res. 2021, 49, D412–D419. [Google Scholar] [CrossRef] [PubMed]
- Pearl, F.M.G.; Bennett, C.F.; Bray, J.E.; Harrison, A.P.; Martin, N.; Shepherd, A.; Sillitoe, I.; Thornton, J.; Orengo, C.A. The CATH Database: An Extended Protein Family Resource for Structural and Functional Genomics. Nucleic Acids Res. 2003, 31, 452–455. [Google Scholar] [CrossRef] [PubMed]
- Hunter, S.; Apweiler, R.; Attwood, T.K.; Bairoch, A.; Bateman, A.; Binns, D.; Bork, P.; Das, U.; Daugherty, L.; Duquenne, L. InterPro: The Integrative Protein Signature Database. Nucleic Acids Res. 2009, 37, D211–D215. [Google Scholar] [CrossRef] [PubMed]
- Stecher, G.; Tamura, K.; Kumar, S. Molecular Evolutionary Genetics Analysis (MEGA) for MacOS. Mol. Biol. Evol. 2020, 37, 1237–1239. [Google Scholar] [CrossRef] [PubMed]
- Tamura, K.; Stecher, G.; Kumar, S. MEGA11: Molecular Evolutionary Genetics Analysis Version 11. Mol. Biol. Evol. 2021, 38, 3022–3027. [Google Scholar] [CrossRef] [PubMed]
- Zuckerkandl, E.; Pauling, L. Evolutionary Divergence and Convergence in Proteins. In Evolving Genes and Proteins; Bryson, V., Vogel, H.J., Eds.; Academic Press: Cambridge, MA, USA, 1965; pp. 97–166. [Google Scholar] [CrossRef]
- Ye, J.; McGinnis, S.; Madden, T.L. BLAST: Improvements for Better Sequence Analysis. Nucleic Acids Res. 2006, 34, W6–W9. [Google Scholar] [CrossRef] [PubMed]
- Pruitt, K.D.; Tatusova, T.; Brown, G.R.; Maglott, D.R. NCBI Reference Sequences (RefSeq): Current Status, New Features and Genome Annotation Policy. Nucleic Acids Res. 2012, 40, D130–D135. [Google Scholar] [CrossRef] [PubMed]
- Jin, J.; Tian, F.; Yang, D.-C.; Meng, Y.-Q.; Kong, L.; Luo, J.; Gao, G. PlantTFDB 4.0: Toward a Central Hub for Transcription Factors and Regulatory Interactions in Plants. Nucleic Acids Res. 2017, 45, D1040–D1045. [Google Scholar] [CrossRef] [PubMed]
- Zerbino, D.R.; Achuthan, P.; Akanni, W.; Amode, M.R.; Barrell, D.; Bhai, J.; Billis, K.; Cummins, C.; Gall, A.; Girón, C.G. Ensembl 2018. Nucleic Acids Res. 2018, 46, D754–D761. [Google Scholar] [CrossRef]
- UniProt Consortium. UniProt: The Universal Protein Knowledgebase. Nucleic Acids Res. 2017, 45, D158–D169. [Google Scholar] [CrossRef]
- Sayers, E.W.; Cavanaugh, M.; Clark, K.; Pruitt, K.D.; Schoch, C.L.; Sherry, S.T.; Karsch-Mizrachi, I. GenBank. Nucleic Acids Res. 2022, 50, D161–D164. [Google Scholar] [CrossRef] [PubMed]
- Minh, B.Q.; Schmidt, H.A.; Chernomor, O.; Schrempf, D.; Woodhams, M.D.; von Haeseler, A.; Lanfear, R. IQ-TREE 2: New Models and Efficient Methods for Phylogenetic Inference in the Genomic Era. Mol. Biol. Evol. 2020, 37, 1530–1534. [Google Scholar] [CrossRef] [PubMed]
- Katoh, K.; Standley, D.M. MAFFT Multiple Sequence Alignment Software Version 7: Improvements in Performance and Usability. Mol. Biol. Evol. 2013, 30, 772–780. [Google Scholar] [CrossRef] [PubMed]
- Katoh, K.; Rozewicki, J.; Yamada, K.D. MAFFT Online Service: Multiple Sequence Alignment, Interactive Sequence Choice and Visualization. Brief. Bioinform. 2019, 20, 1160–1166. [Google Scholar] [CrossRef] [PubMed]
- Kalyaanamoorthy, S.; Minh, B.Q.; Wong, T.K.F.; von Haeseler, A.; Jermiin, L.S. ModelFinder: Fast Model Selection for Accurate Phylogenetic Estimates. Nat. Methods 2017, 14, 587–589. [Google Scholar] [CrossRef]
- Hoang, D.T.; Chernomor, O.; von Haeseler, A.; Minh, B.Q.; Vinh, L.S. UFBoot2: Improving the Ultrafast Bootstrap Approximation. Mol. Biol. Evol. 2018, 35, 518–522. [Google Scholar] [CrossRef]
Motif | Motif Consensus Amino Acid Sequences | Width, aa |
---|---|---|
1 | DILDDGYRWRKYGQKPVKGSP | 21 |
2 | GCPVRKQVZRSSEDPSIVITTYEGKHNHP | 29 |
3 | YPRSYYRCTSA | 11 |
4 | DGYNWRKYGQKQVKGSEYPRSYYKCTYPNC | 30 |
5 | KKKAZKTIREPRVAVQTRSEV | 21 |
6 | ERSHDGQITEIIYKGTHNHPKPQPNRRSALG | 31 |
7 | KDELEVLKAELERVREENEKLREMLEQITKBYNALQMHLVEJMQ | 44 |
8 | TVEAATAAITADPNFTAALAAAITSIIG | 28 |
9 | SSGRCHCSKRRKLRVKRSIRVPAISNKIA | 29 |
10 | LPPAATAMASTTSAAASMLLS | 21 |
11 | MASISASAPFPTITLDLTQ | 19 |
12 | PSPLPIARSPYFTIPPGLSPTSLLDSPVLLS | 33 |
13 | EDGYNWRKYGQKQVKGSE | 18 |
14 | DCREIADYAVSKFKKVISJLNRTGHGRFR | 29 |
15 | MEEKLSWEQKTLINELTQGRELAKQLKIHL | 33 |
16 | LLRDHGLLQDIVPSFIRK | 18 |
17 | DEDDEDEPESKRRKKEV | 18 |
18 | QEAIQEAASAGLESVEKLIRLLSHAQDQ | 28 |
19 | QQMKHQADMMYRRSNSGINLKFDGSSCTPTMSSTRSFISSLSMDGSVANL | 50 |
20 | PVKKARVSVRARCDT | 15 |
21 | QGPFGMSHQZVLAQVTAQAAQAQSHMQLQ | 29 |
22 | REDLVVKILRSFEKALSILKCGG | 23 |
23 | NPRSYYKCTNA | 11 |
24 | EKPTDNFEHILNQMQ | 15 |
25 | VPAARNSSHBTAG | 13 |
Cultivar | Cabernet Franc | Cabernet Sauvignon | Pinot Noir | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Clone | 04 | 08 | FPS123 | PN40024 | |||||||||
Assembly | Diploid | Haploid, 12X, and Reference | Haploid, Assembly v. 5 | ||||||||||
Grape Genomics | RefSeq | GenBank | Grape Genomics | ||||||||||
Gene Name | Ni | Ng | Ni | Ng | Ni | Ng | Ni | Ng | Ni | Ng | Ni | Ng | Gene ID |
VvWRKY1 | 12 | 2 | 10 | 2 | 15 | 2 | 1 | 1 | 1 | 1 | 4 | 1 | Vitvi01g04492.t001 |
VvWRKY2 | 4 | 2 | 1 | 1 | 2 | 2 | 2 | 1 | 1 | 1 | 3 | 1 | Vitvi01g04490.t001 |
VvWRKY3 | 2 | 1 | 3 | 2 | 6 | 3 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi01g02157.t001 |
VvWRKY4 | 1 | 1 | - | - | 2 | 2 | 1 | 1 | 1 | 1 | 2 | 1 | Vitvi01g01680.t002 |
VvWRKY5 | 4 | 2 | 6 | 3 | 2 | 2 | 2 | 1 | 1 | 1 | 1 | 1 | Vitvi02g00039.t001 |
VvWRKY6 | 2 | 2 | 2 | 2 | 2 | 2 | 1 | 1 | 2 | 1 | 2 | 1 | Vitvi02g00114.t001 |
VvWRKY7 | 3 | 2 | 2 | 2 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi02g01847.t001 |
VvWRKY8 | 2 | 2 | 2 | 2 | 2 | 2 | 1 | 1 | - | - | 1 | 1 | Vitvi04g00133.t001 |
VvWRKY9 | 4 | 2 | 2 | 2 | 6 | 2 | 1 | 1 | 1 | 1 | 3 | 1 | Vitvi04g04524.t001 |
VvWRKY10 | 14 | 2 | 14 | 2 | 12 | 2 | 2 | 1 | 1 | 1 | 1 | 1 | Vitvi04g00511.t001 |
VvWRKY11 | 2 | 2 | 2 | 2 | 4 | 2 | 1 | 1 | 1 | 1 | 3 | 1 | Vitvi04g04525.t001 |
VvWRKY12 | 4 | 2 | 2 | 1 | 4 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi04g00756.t001 |
VvWRKY13 | 6 | 2 | 1 | 1 | 2 | 2 | 2 | 1 | 1 | 1 | 2 | 1 | Vitvi04g00760.t001 |
VvWRKY14 | 2 | 2 | 1 | 1 | 2 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi04g01985.t001 |
VvWRKY15 | 3 | 2 | 2 | 2 | 36 | 2 | 5 | 1 | 2 | 1 | 1 | 1 | Vitvi04g01163.t001 |
VvWRKY16 | 2 | 2 | 2 | 2 | 2 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi05g00145.t001 |
VvWRKY17 | 2 | 2 | 3 | 2 | 4 | 2 | 2 | 1 | 1 | 1 | 1 | 1 | Vitvi06g01574.t001 |
VvWRKY18 | 7 | 2 | 4 | 2 | 2 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi06g00741.t001 |
VvWRKY19 | 8 | 2 | 4 | 1 | 6 | 2 | 3 | 1 | 1 | 1 | 1 | 1 | Vitvi07g00026.t001 |
VvWRKY20 | 6 | 2 | 4 | 2 | 6 | 2 | 3 | 1 | 1 | 1 | 2 | 1 | Vitvi07g00421.t001 |
VvWRKY21 | 2 | 2 | 2 | 2 | 2 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi07g00434.t001 |
VvWRKY22 | 12 | 2 | 2 | 2 | 12 | 2 | 2 | 1 | 1 | 1 | 1 | 1 | Vitvi07g00523.t002 |
VvWRKY23 | 4 | 2 | 4 | 2 | 4 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi07g01694.t001 |
VvWRKY24 | 2 | 2 | 2 | 2 | 4 | 2 | 1 | 1 | 1 | 1 | 2 | 1 | Vitvi07g04782.t002 |
VvWRKY25 | 2 | 2 | 2 | 2 | 2 | 2 | 2 | 1 | 1 | 1 | 1 | 1 | Vitvi07g01860.t001 |
VvWRKY26 | - | - | - | - | 2 | 2 | - | - | 1 | 1 | 1 | 1 | Vitvi08g04106.t001 |
VvWRKY27 | 6 | 2 | 3 | 1 | 6 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi08g00793.t001 |
VvWRKY28 | 2 | 2 | 1 | 1 | 4 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi08g00868.t001 |
VvWRKY29 | 9 | 2 | 5 | 1 | 5 | 2 | 7 | 1 | 1 | 1 | 2 | 1 | Vitvi08g01134.t001 |
VvWRKY30 | 2 | 2 | 1 | 1 | 2 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi08g01221.t001 |
VvWRKY31 | 1 | 1 | 9 | 3 | 8 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi09g01122.t001 |
VvWRKY32 | 6 | 2 | 4 | 2 | 4 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi10g00063.t001 |
VvWRKY33 | 2 | 2 | 2 | 2 | 10 | 2 | 4 | 1 | 1 | 1 | 1 | 1 | Vitvi10g00270.t001 |
VvWRKY34 | 2 | 1 | 4 | 2 | 4 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi10g00618.t001 |
VvWRKY35 | 4 | 2 | 2 | 1 | 4 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi10g00732.t001 |
VvWRKY36 | 2 | 2 | 2 | 2 | 3 | 3 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi10g01078.t001 |
VvWRKY37 | 6 | 2 | 4 | 2 | 5 | 2 | 3 | 1 | 1 | 1 | 1 | 1 | Vitvi11g00694.t002 |
VvWRKY38 | 4 | 2 | 4 | 2 | 4 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi11g01188.t001 |
VvWRKY39 | 2 | 2 | 2 | 2 | 3 | 3 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi12g00048.t001 |
VvWRKY40 | 2 | 2 | 2 | 2 | 2 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi12g00148.t001 |
VvWRKY41 | 2 | 2 | 1 | 1 | 4 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi12g00388.t001 |
VvWRKY42 | 1 | 1 | 2 | 2 | 5 | 3 | 4 | 1 | 3 | 3 | 3 | 3 | Vitvi12g00664.t003 Vitvi12g04520.t001 Vitvi12g04129.t001 |
VvWRKY43 | 4 | 2 | 2 | 2 | 3 | 3 | 1 | 1 | 2 | 1 | 1 | 1 | Vitvi12g01676.t001 |
VvWRKY44 | 2 | 2 | 1 | 1 | 2 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi13g00189.t001 |
VvWRKY45 | 2 | 2 | 1 | 1 | 2 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi13g01916.t001 |
VvWRKY46 | 4 | 2 | 4 | 2 | 4 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi14g00540.t001 |
VvWRKY47 | 3 | 2 | 2 | 2 | 2 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi14g01523.t001 |
VvWRKY48 | 2 | 2 | 1 | 1 | 2 | 2 | 3 | 1 | 1 | 1 | 1 | 1 | Vitvi14g01907.t001 |
VvWRKY49 | 1 | 1 | 2 | 1 | 10 | 2 | 1 | 1 | 1 | 1 | 2 | 1 | Vitvi14g02007.t001 |
VvWRKY50 | 4 | 2 | 4 | 2 | 6 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi15g00539.t001 |
VvWRKY51 | 4 | 2 | 4 | 2 | 4 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi15g01003.t001 |
VvWRKY52 | 1 | 1 | 2 | 2 | 2 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi15g01087.t001 |
VvWRKY53 | - | - | 2 | 2 | 2 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi15g01090.t001 |
VvWRKY54 | 3 | 3 | 2 | 2 | 3 | 3 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi16g01132.t001 |
VvWRKY55 | 1 | 1 | 2 | 2 | 2 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi16g01133.t001 |
VvWRKY56 | 2 | 2 | 2 | 2 | 2 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi16g01213.t001 |
VvWRKY57 | 3 | 3 | 2 | 2 | 2 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi17g00102.t001 |
VvWRKY58 | 3 | 2 | 6 | 3 | 4 | 2 | 2 | 1 | 1 | 1 | 1 | 1 | Vitvi1700556.t001 |
VvWRKY59 | 6 | 2 | 3 | 1 | 5 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi18g00742.t001 |
VvWRKY60 | 4 | 2 | 1 | 1 | 6 | 2 | 2 | 1 | 1 | 1 | 1 | 1 | Vitvi19g00530.t001 |
VvWRKY61 | 4 | 2 | 4 | 2 | 1 | 1 | 1 | 1 | 1 | 1 | 1 | 1 | Vitvi19g00617.t001 |
VvWRKY62 | 16 | 3 | 7 | 2 | 22 | 3 | 4 | 1 | - | - | 5 | 1 | Vitvi19g04652.t002 |
Total | 234 | 115 | 181 | 106 | 304 | 129 | 97 | 61 | 65 | 62 | 84 | 64 |
Gene Name | ORF, aa | Exons | Mean Distance | WRKY Domain Location | DNA-Binding Residues | Zinc Finger | Functional Family | WRKY Group/Clade | Other Features |
---|---|---|---|---|---|---|---|---|---|
VvWRKY1 | 305 | 3 | 0.001 | 162–218 | WRKYGQK | C2H2 | FF:3 | IIc/B | - |
VvWRKY2 | 594 | 5 | 0.012 | 245–303 | WRKYGQK | C2H2 | FF:2 | IIb/D | COILS Coil: 60–101 LxLxLx motif |
VvWRKY3 | 502 | 4 | 0.051 | 247–303 427–484 | WRKYGQK | C2H2 | FF:6 FF:1 | I/C | - |
VvWRKY4 | 189 | 2 | 0.064 | 111–168 | WRKYGQK | C2H2 | FF:3 | IIc/B | - |
VvWRKY5 | 330 | 3 | 0.030 | 144–200 | WRKYGQK | C2HC | FF:7 | IIe/E | - |
VvWRKY6 | 342 | 3 | 0.005 | 133–192 | WRKYGQK | C2HC | FF:9 | III/A | - |
VvWRKY7 | 323 | 3 | 0.042 | 254–310 | WRKYGQK | C2H2 | FF:4 | IId/E | Zn-cluster: 204–250 LxxLL motif |
VvWRKY8 | 166 | 3 | 0.005 | 104–161 | WRKYGKK | C2H2 | FF:3 | IIc/B | - |
VvWRKY9 | 258 | 4 | 0.021 | 97–155 | WRKYGQK | C2H2 | FF:8 | IIa/D | COILS Coil: 14–34 LxLxLx motif |
VvWRKY10 | 317 | 5 | 0.010 | 160–218 | WRKYGQK | C2H2 | FF:8 | IIa/D | LxxLL motif LxLxLx motif |
VvWRKY11 | 491 | 5 | 0.004 | 139–196 354–410 | WRKYGQK | C2H2 | - FF:6 | I/C | - |
VvWRKY12 | 338 | 3 | 0.000 | 261–317 | WRKYGQK | C2H2 | FF:4 | IId/E | Zn-cluster: 210–257 |
VvWRKY13 | 191 | 3 | 0.008 | 103–160 | WRKYGKK | C2H2 | FF:3 | IIc/B | - |
VvWRKY14 | 136 | 3 | 0.008 | 53–111 | WRKYGKK | C2H2 | FF:3 | IIc/B | - |
VvWRKY15 | 700 | 5 | 0.044 | 234–290 452–509 | WRKYGQK | C2H2 | FF:6 FF:6 | I/C | LxLxLx motif |
VvWRKY16 | 309 | 3 | 0.001 | 155–212 | WRKYGQK | C2H2 | FF:3 | IIc/B | COILS Coil: 107–127 LxxLL motif |
VvWRKY17 | 189 | 3 | 0.113 | 92–148 | WKKYGQK | C2H2 | - | NG | Signal peptide: 1–21 Non cytoplasmic domain: 22–189 LxLxLx motif |
VvWRKY18 | 603 | 5 | 0.004 | 256–312 427–484 | WRKYGQK | C2H2 | FF:6 FF:1 | I/C | - |
VvWRKY19 | 340 | 3 | 0.001 | 274–331 | WRKYGQK | C2H2 | FF:4 | IId/E | Zn-cluster: 226–270 |
VvWRKY20 | 242 | 3 | 0.030 | 48–105 | WKKYGQK | C2H2 | FF:4 | IIe/E | - |
VvWRKY21 | 302 | 3 | 0.003 | 149–206 | WRKYGQK | C2H2 | FF:3 | IIc/B | COILS Coil: 102–122 |
VvWRKY22 | 512 | 6 | 0.041 | 269–326 | WRKYGQK | C2H2 | FF:2 | IIb/D | COILS Coil: 105–132 |
VvWRKY23 | 336 | 3 | 0.045 | 265–321 | WRKYGQK | C2H2 | FF:4 | IId/E | Zn-cluster: 215–261 LxxLL motif |
VvWRKY24 | 193 | 3 | 0.068 | 106–163 | WRKYGKK | C2H2 | FF:3 | IIc/B | - |
VvWRKY25 | 226 | 3 | 0.026 | 150–206 | WRKYGQK | C2H2 | FF:3 | IIc/B | - |
VvWRKY26 | 236 | 4 | 0.005 | 66–109 | WMKGNPH | C2HY | - | I/C | - |
VvWRKY27 | 552 | 5 | 0.026 | 230–286 393–450 | WRKYGQK | C2H2 | FF:6 FF:1 | I/C | - |
VvWRKY28 | 334 | 3 | 0.008 | 136–196 | WRKYGQK | C2HC | - | III/A | LxLxLx motif |
VvWRKY29 | 477 | 5 | 0.029 | 196–250 397–453 | WRKYGQK | C2H2 | FF:6 FF:6 | I/C | - |
VvWRKY30 | 299 | 3 | 0.006 | 112–168 | WRKYGQK | C2H2 | FF:6 | NG | - |
VvWRKY31 | 311 | 5 | 0.020 | 160–218 | WRKYGQK | C2H2 | FF:8 | IIa/D | - |
VvWRKY32 | 535 | 6 | 0.004 | 277–334 | WRKYGQK | C2H2 | FF:2 | IIb/D | COILS Coil: 99–133 |
VvWRKY33 | 626 | 5 | 0.019 | 270–326 437–493 | WRKYGQK | C2H2 | - | I/C | - |
VvWRKY34 | 278 | 3 | 0.003 | 78–135 | WRKYGQK | C2H2 | FF:4 | IIe/E | - |
VvWRKY35 | 438 | 3 | 0.056 | 181–238 | WRKYGQK | C2H2 | FF:3 | IIc/B | - |
VvWRKY36 | 438 | 3 | 0.006 | 220–277 | WRKYGQK | C2H2 | FF:5 | IIe/E | - |
VvWRKY37 | 500 | 4 | 0.004 | 190–245 363–419 | WRKYGQK | C2H2 | - FF:6 | I/C | - |
VvWRKY38 | 297 | 3 | 0.006 | 226–282 | WRKYGQK | C2H2 | FF:4 | IId/E | Zn-cluster: 175–222 LxxLL motif LxLxLx motif |
VvWRKY39 | 311 | 3 | 0.004 | 173–230 | WRKYGQK | C2H2 | FF:3 | IIc/B | - |
VvWRKY40 | 244 | 3 | 0.008 | 76–133 | WRKYGQK | C2H2 | FF:4 | IIe/E | - |
VvWRKY41 | 593 | 5 | 0.005 | 311–368 | WRKYGQK | C2H2 | FF:2 | IIb/D | COILS Coil: 130–171 |
VvWRKY42 | 407 | 4 | 0.069 | 110–166 285–342 | WRKYGQK | C2H2 | FF:6 FF:3 | I/C | - |
VvWRKY43 | 487 | 5 | 0.005 | 232–290 | WRKYGQK | C2H2 | FF:2 | IIb/D | COILS Coil: 81–101 LxLxLx motif |
VvWRKY44 | 364 | 3 | 0.001 | 175–235 | WRKYGQK | C2HC | - | III/A | - |
VvWRKY45 | 313 | 3 | 0.003 | 111–170 | WRKYGQK | C2HC | - | III/A | LxxLL motif |
VvWRKY46 | 365 | 3 | 0.004 | 298–354 | WRKYGQK | C2H2 | FF:4 | IId/E | Zn-cluster: 249–294 |
VvWRKY47 | 182 | 2 | 0.034 | 105–162 | WRKYGQK | C2H2 | FF:3 | IIc/B | - |
VvWRKY48 | 555 | 4 | 0.001 | 225–283 | WRKYGQK | C2H2 | FF:2 | IIb/D | COILS Coil: 33–81 LxLxLx motif |
VvWRKY49 | 529 | 4 | 0.046 | 233–289 415–472 | WRKYGQK | C2H2 | FF:6 FF:1 | I/C | - |
VvWRKY50 | 228 | 4 | 0.033 | 155–211 | WRKYGQK | C2H2 | FF:3 | IIc/B | - |
VvWRKY51 | 349 | 3 | 0.004 | 119–178 | WRKYGQK | C2HC | FF:9 | III/A | - |
VvWRKY52 | 201 | 2 | 0.006 | 123–180 | WRKYGQK | C2H2 | FF:3 | IIc/B | LxxLL motif |
VvWRKY53 | 348 | 3 | 0.001 | 168–225 | WRKYGQK | C2H2 | FF:7 | IIe/E | - |
VvWRKY54 | 329 | 3 | 0.058 | 159–215 | WRKYGQK | C2H2 | - | IIe/E | COILS Coil: 275–295 |
VvWRKY55 | 185 | 3 | 0.011 | 45–101 | WRKYGQK | C2H2 | - | IIe/E | - |
VvWRKY56 | 364 | 3 | 0.006 | 134–193 | WRKYGQK | C2HC | FF:9 | III/A | - |
VvWRKY57 | 151 | 2 | 0.004 | 72–129 | WRKYGQK | C2H2 | FF:3 | IIc/B | - |
VvWRKY58 | 618 | 6 | 0.005 | 271–329 | WRKYGQK | C2H2 | FF:2 | IIb/D | COILS Coil: 102–129 LxLxLx motif |
VvWRKY59 | 347 | 3 | 0.004 | 275–331 | WRKYGQK | C2H2 | FF:4 | IId/E | Zn-cluster: 226–271 LxxLL motif |
VvWRKY60 | 551 | 6 | 0.008 | 300–357 | WRKYGQK | C2H2 | FF:2 | IIb/D | COILS Coil: 114–148 LxLxLx motif |
VvWRKY61 | 700 | 8 | 0.048 | 346–402 516–573 | WRKYGQK | C2H2 | FF:6 FF:1 | I/C | Frigida-like: 81–147 LxLxLx motif |
VvWRKY62 | 746 | 5 | 0.015 | 318–373 533–590 | WRKYGQK | C2H2 | FF:1 FF:6 | I/C | - |
WRKY Name | PlantTFDB Wang L [44]/Guo [45] | NCBI | Ensembel | Uniprot | According to Wu [49]/ Zhang and Feng [47] | |
---|---|---|---|---|---|---|
Refseq | GenBank | |||||
VvWRKY1 | GSVIVT01012196001 VvWRKY11/VvWRKY1 | XP_002274549.1 VvWRKY57 | WJZ80117 | VIT_01s0011g00720 | F6HF79 | VvWRKY1/VvWRKY13-1, VvWRKY57-1 |
VvWRKY2 | GSVIVT01020060001 VvWRKY19/VvWRKY2 | XP_010652374.1 VvWRKY72 | WJZ81033 | VIT_01s0026g01730 | D7TND6 | VvWRKY2/VvWRKY72-3 |
VvWRKY3 | GSVIVT01001332001 VvWRKY3/VvWRKY4 | NP_001268110.1 VvWRKY2 | WJZ81270 | VIT_01s0011g00220 | F6HYH9 | VvWRKY58/VvWRKY2-3, VvWRKY3-1 |
VvWRKY4 | GSVIVT01010525001 VvWRKY8/VvWRKY3 | XP_002275576.1 VvWRKY75 | WJZ91720 | VIT_01s0010g03930 | D7TB08 | VvWRKY3/VvWRKY57-2 |
VvWRKY5 | GSVIVT01019419001 VvWRKY17/VvWRKY5 | XP_010658402.1 VvWRKY22 | WJZ81903 | VIT_02s0025g00420 | F6HUN4 | VvWRKY4/VvWRKY22-3 |
VvWRKY6 | GSVIVT01019511001 VvWRKY18/VvWRKY6 | XP_002272720.1 VvWRKY41 | WJZ81983 | VIT_02s0025g01280 | D7TVE1 | VvWRKY5/VvWRKY41 |
VvWRKY7 | GSVIVT01001286001 VvWRKY2/VvWRKY7 | XP_059589595.1 VvWRKY21 | WJZ82421 | VIT_02s0154g00210 | D7TN24 | VvWRKY60/- |
VvWRKY8 | GSVIVT01035426001 VvWRKY53/VvWRKY8 | XP_002279407.1 VvWRKY50 | - | VIT_04s0008g01470 | D7STT5 | VvWRKY6/VvWRKY50 |
VvWRKY9 | GSVIVT01035884001 VvWRKY54/VvWRKY9 | XP_010648680.1 VvWRKY18 | WJZ85291 | VIT_04s0008g05750 | F6H3I5 | VvWRKY7/VvWRKY18 |
VvWRKY10 | GSVIVT01035885001 VvWRKY55/VvWRKY10 | XP_010648274.1 VvWRKY40 | WJZ85292 | VIT_04s0008g05760 | F6H3I6 | VvWRKY8/VvWRKY40-2 |
VvWRKY11 | GSVIVT01035965001 VvWRKY56/VvWRKY 11 | XP_010648749.1 VvWRKY32 | WJZ85365 | VIT_04s0008g06600 | F6H336 | VvWRKY9/VvWRKY32-2 |
VvWRKY12 | GSVIVT01033188001 VvWRKY48/VvWRKY12 | XP_002262775.1 VvWRKY17 | WJZ85515 | VIT_04s0069g00920 | A0A1U8AHW6 | VvWRKY10/VvWRKY11-1 |
VvWRKY13 | GSVIVT01033194001 VvWRKY49/VvWRKY13 | XP_002263836.1 VvWRKY51 | WJZ85520 | VIT_04s0069g00970 | D7T0E7 | VvWRKY11/VvWRKY51-3 |
VvWRKY14 | GSVIVT01033195001 VvWRKY50/VvWRKY14 | XP_003631843.1 VvWRKY43 | WJZ85521 | VIT_04s0069g00980 | A0A438DL90 D7T0E8 | VvWRKY12/VvWRKY51-1 |
VvWRKY15 | GSVIVT01019109001 VvWRKY16/VvWRKY15 | XP_059592356.1 VvWRKYsusiba2 | WJZ85872 | VIT_04s0023g00470 | F6GX25 | VvWRKY13/VvWRKY2-1 |
VvWRKY16 | GSVIVT01034968001 VvWRKY52/VvWRKY16 | XP_002279385.1 VvWRKY48 | WJZ86707 | VIT_05s0077g00730 | A0A438GHD0 D7SYJ2 | VvWRKY14/VvWRKY48 |
VvWRKY17 | GSVIVT01025491001 VvWRKY29/VvWRKY17 | XP_003632174.3 VvWRKY3 | WJZ88411 | VIT_06s0004g00230 | F6GUN9 | VvWRKY15/VvWRKY2-4 |
VvWRKY18 | GSVIVT01024624001 VvWRKY28/VvWRKY18 | XP_002272040.1 VvWRKY24 | WJZ89183 | VIT_06s0004g07500 | F6GUH8 | VvWRKY16/VvWRKY33-2 |
VvWRKY19 | GSVIVT01000752001 VvWRKY1/VvWRKY19 | XP_002282258.1 VvWRKY21 | WJZ90025 | VIT_07s0141g00680 | F6GXM5 | VvWRKY17/VvWRKY21 |
VvWRKY20 | GSVIVT01028129001 VvWRKY34/VvWRKY20 | XP_002270750.3 VvWRKY65 | WJZ90472 | VIT_07s0005g01520 | D7U2J0 | VvWRKY18/VvWRKY22-1 |
VvWRKY21 | GSVIVT01028147001 VvWRKY35/VvWRKY21 | XP_002277882.1 VvWRKY23 | WJZ90489 | VIT_07s0005g01710 | D7U2K4 | VvWRKY19/VvWRKY23 |
VvWRKY22 | GSVIVT01028244001 VvWRKY36/VvWRKY22 | XP_002281194.1 VvWRKY47 | WJZ90578 | VIT_07s0005g02570 | F6HZF7 | VvWRKY20/VvWRKY47 |
VvWRKY23 | GSVIVT01022067001 VvWRKY24/VvWRKY23 | XP_002283219.1 VvWRKY7 | WJZ91947 | VIT_07s0031g00080 | F6H4G0 | VvWRKY21/VvWRKY7-2 |
VvWRKY24 | GSVIVT01022245001 VvWRKY25/VvWRKY24 | XP_010652864.1 VvWRKY51 | WJZ92108 | VIT_07s0031g01710 | F6H4B4 | VvWRKY22/VvWRKY51-2, VvWRKY51-4 |
VvWRKY25 | GSVIVT01022259001 VvWRKY26/VvWRKY25 | XP_002279024.1 VvWRKY13 | WJZ92120 | VIT_07s0031g01840 | A0A438KK47 D7SW85, I0AVQ1 | VvWRKY23 |
VvWRKY26 | -/- | - | WJZ92812 | - | - | -/- |
VvWRKY27 | GSVIVT01030258001 VvWRKY43/VvWRKY26 | XP_019077410.1 VvWRKY26 | WJZ92895 | VIT_08s0058g00690 | F6GXS4 | VvWRKY24/VvWRKY33-1 |
VvWRKY28 | GSVIVT01030174001 VvWRKY42/VvWRKY27 | XP_002272504.1 VvWRKY70 | WJZ92963 | VIT_08s0058g01390 | F6GXW4 | VvWRKY25/VvWRKY70-2 |
VvWRKY29 | GSVIVT01025562001 VvWRKY30/VvWRKY28 | XP_002275978.1 VvWRKY44 | WJZ93250 | VIT_08s0040g03070 | F6HQV7 | VvWRKY26/VvWRKY44 |
VvWRKY30 | GSVIVT01034148001 VvWRKY51/VvWRKY29 | XP_002270859.1 VvWRKY49 | WJZ93336 | VIT_08s0007g00570 | A0A438HSE3 D7THM0 | VvWRKY27/VvWRKY49 |
VvWRKY31 | GSVIVT01015952001 VvWRKY14/VvWRKY30 | NP_001267919.1 VvWRKY40 | WJZ95373 | VIT_09s0018g00240 | F6HBV8 | VvWRKY28/VvWRKY4, VvWRKY40-1 |
VvWRKY32 | GSVIVT01012682001 VvWRKY12/VvWRKY31 | XP_002263115.1 VvWRKY31 | WJZ95843 | VIT_10s0116g01200 | F6H7H0 | VvWRKY29/VvWRKY6-2 |
VvWRKY33 | GSVIVT01007006001 VvWRKY4/VvWRKY59 | XP_010647039.2 VvWRKY20 | WJZ96075 | VIT_00s0463g00010 | A0A438DDY6 | VvWRKY59/VvWRKY20-1, VvWRKY20-4 |
VvWRKY34 | GSVIVT01021252001 VvWRKY21/VvWRKY32 | XP_002269267.1 VvWRKY65 | WJZ96565 | VIT_10s0003g01600 | D7TJP4 | VvWRKY30/VvWRKY65-1 |
VvWRKY35 | GSVIVT01021397001 VvWRKY22/VvWRKY33 | XP_002272089.1 VvWRKY 71 | WJZ96695 | VIT_10s0003g02810 | A5BVH3 D7TK05 | VvWRKY31/VvWRKY28-1 |
VvWRKY36 | GSVIVT01021765001 VvWRKY23/VvWRKY34 | XP_002269170.1 VvWRKY14 | WJZ97031 | VIT_10s0003g05740 | A0A438BWU0 | VvWRKY32/VvWRKY14 |
VvWRKY37 | GSVIVT01023600001 VvWRKY27/VvWRKY35 | XP_002276194.1 VvWRKY32 | WJZ98338 | VIT_11s0037g00150 | D7U1A8 | VvWRKY33/VvWRKY32-1 |
VvWRKY38 | GSVIVT01029265001 VvWRKY39/VvWRKY36 | XP_002266188.1 VvWRKY51 | WJZ98778 | VIT_11s0052g00450 | D0V9L3 | VvWRKY34/VvWRKY11-2, VvWRKY11-3 |
VvWRKY39 | GSVIVT01020864001 VvWRKY20/VvWRKY37 | XP_002283603.1 VvWRKY71 | WJZ98954 | VIT_12s0028g00270 | E0CU42 | VvWRKY35/VvWRKY28-2 |
VvWRKY40 | -/- | XP_002277383.1 VvWRKY65 | WJZ99058 | - | - | VvWRKY36/VvWRKY3-2, VvWRKY65-2, VvWRKY65-3 |
VvWRKY41 | GSVIVT01030453001 VvWRKY44/VvWRKY38 | XP_002269696.2 VvWRKY 31 | WJZ99341 | VIT_12s0059g00880 | F6HIC7 | VvWRKY37/VvWRKY6-1 |
VvWRKY42 | GSVIVT01030046001 VvWRKY41/VvWRKY39 | XP_002272407.1 VvWRKY20 | WJZ99676 | VIT_12s0057g00550 | F6HHL8 | VvWRKY38/VvWRKY20-3, VvWRKY20-6 |
VvWRKY43 | GSVIVT01029688001 VvWRKY40/VvWRKY40 | XP_010657556.1 VvWRKY9 | WKA00085 | VIT_12s0055g00340 | F6H1R3 | VvWRKY39/VvWRKY9 |
VvWRKY44 | GSVIVT01032662001 VvWRKY46/VvWRKY41 | XP_002275373.1 VvWRKY55 | WKA00784 | VIT_13s0067g03130 | A0A438E3U8 F6HC34 | VvWRKY40/VvWRKY55 |
VvWRKY45 | GSVIVT01032661001 VvWRKY45/VvWRKY42 | XP_002275401.1 VvWRKY70 | WKA00785 | VIT_13s0067g03140 | F6HC33 | VvWRKY41/VvWRKY70-1 |
VvWRKY46 | GSVIVT01036223001 VvWRKY57/VvWRKY43 | XP_002270614.2 VvWRKY74 | WKA03253 | VIT_14s0081g00560 | F6HVI7 | VvWRKY42/VvWRKY74 |
VvWRKY47 | GSVIVT01033063001 VvWRKY47/VvWRKY44 | XP_002274387.1 VvWRKY75 | WKA04134 | VIT_14s0068g01770 | D7SVN0 I3RQB5 | VvWRKY43/VvWRKY45 |
VvWRKY48 | GSVIVT01011356001 VvWRKY9/VvWRKY45 | XP_002277221.2 VvWRKY72 | WKA04564 | VIT_14s0108g00120 | D7SX70 | VvWRKY44/VvWRKY72-2 |
VvWRKY49 | GSVIVT01011472001 VvWRKY10/VvWRKY46 | XP_010661104.2 VvWRKY4 | WKA04672 | VIT_14s0108g01280 | - | VvWRKY45/- |
VvWRKY50 | GSVIVT01018300001 VvWRKY15/VvWRKY47 | XP_002270527.1 VvWRKY12 | WKA05315 | VIT_15s0021g01310 | A0A1U6ZIF2 | VvWRKY46/VvWRKY12-1, VvWRKY12-2 |
VvWRKY51 | GSVIVT01027069001 VvWRKY33/VvWRKY48 | XP_002281031.1 VvWRKY46 | WKA05852 | VIT_15s0046g01140 | F6I6B1 | VvWRKY47/VvWRKY46 |
VvWRKY52 | GSVIVT01026969001 VvWRKY32/VvWRKY49 | XP_002275528.3 VvWRKY24 | WKA05934 | VIT_15s0046g02150 | D7UCE6 A0A438JLT2 | VvWRKY48/VvWRKY24 |
VvWRKY53 | GSVIVT01026965001 VvWRKY31/VvWRKY50 | XP_002276925.1 VvWRKY22 | WKA05938 | VIT_15s0046g02190 | D7UCE2 A0A438JM47 | VvWRKY49/VvWRKY22-2 |
VvWRKY54 | GSVIVT01028823001 VvWRKY38/VvWRKY51 | XP_010662789.1 VvWRKY22 | WKA07335 | VIT_16s0050g01480 | E0CUS7 | VvWRKY50/- |
VvWRKY55 | -/- | XP_010662788 VvWRKY27 | WKA07336 | - | - | -/- |
VvWRKY56 | GSVIVT01028718001 VvWRKY37/VvWRKY52 | XP_002267793.2 VvWRKY53 | WKA07458 | VIT_16s0050g02510 | E0CUJ8 | VvWRKY51/VvWRKY53 |
VvWRKY57 | GSVIVT01008553001 VvWRKY6/VvWRKY53 | NP_001268218.1 VvWRKY1 | WKA07893 | VIT_17s0000g01280 | Q5IZC7 | VvWRKY52/VvWRKY1-2, VvWRKY75 |
VvWRKY58 | GSVIVT01008046001 VvWRKY5/VvWRKY54 | XP_010663394.1 VvWRKY72 | WKA08379 | VIT_17s0000g05810 | D7SIE7 | VvWRKY53/VvWRKY72-1 |
VvWRKY59 | GSVIVT01009441001 VvWRKY7/VvWRKY55 | XP_002284966.1 VvWRKY7 | WKA09909 | VIT_18s0001g10030 | E0CPR7 | VvWRKY54/VvWRKY7-1 |
VvWRKY60 | GSVIVT01037686001 VvWRKY58/VvWRKY56 | XP_010644476.1 VvWRKY31 | WKA12500 | VIT_19s0090g00840 | F6HEQ5 | VvWRKY55/VvWRKY42 |
VvWRKY61 | GSVIVT01037775001 VvWRKY59/VvWRKY57 | XP_010644520.1 VvWRKY20 | WKA12584 | VIT_19s0090g01720 | F6HER4 | VvWRKY56/VvWRKY20-2, VvWRKY20-5 |
VvWRKY62 | GSVIVT01014854001 VvWRKY13/VvWRKY58 | XP_002265612.1 VvWRKY2 | - | VIT_19s0015g01870 | F6I4X4 | VvWRKY57/VvWRKY2-2 |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Vodiasova, E.; Sinchenko, A.; Khvatkov, P.; Dolgov, S. Genome-Wide Identification, Characterisation, and Evolution of the Transcription Factor WRKY in Grapevine (Vitis vinifera): New View and Update. Int. J. Mol. Sci. 2024, 25, 6241. https://doi.org/10.3390/ijms25116241
Vodiasova E, Sinchenko A, Khvatkov P, Dolgov S. Genome-Wide Identification, Characterisation, and Evolution of the Transcription Factor WRKY in Grapevine (Vitis vinifera): New View and Update. International Journal of Molecular Sciences. 2024; 25(11):6241. https://doi.org/10.3390/ijms25116241
Chicago/Turabian StyleVodiasova, Ekaterina, Anastasiya Sinchenko, Pavel Khvatkov, and Sergey Dolgov. 2024. "Genome-Wide Identification, Characterisation, and Evolution of the Transcription Factor WRKY in Grapevine (Vitis vinifera): New View and Update" International Journal of Molecular Sciences 25, no. 11: 6241. https://doi.org/10.3390/ijms25116241