Engineered Antibodies to Improve Efficacy against Neurodegenerative Disorders
Abstract
:1. Introduction
2. Current Status
2.1. Amyloid Hypothesis
2.2. Brain Immunity
2.3. Natural Antibodies
3. Engineered Antibodies
3.1. scFv-CH (Single-Chain Variable Fragment)
3.2. Single-Chain Variable Fragment (scFv)
3.3. scFV-CH3 (Minibodies)
3.4. Diabody
3.5. sdAb (Single Domain Antibody)
3.6. F(ab)2 Fragments
3.7. F(ab) Fragment
3.8. Reduced IgG (rIgG)
3.9. Bispecific Antibodies (BsAbs)
3.10. Multispecific Antibodies
4. Administration and Disposition Profile
4.1. Transcytosis
4.2. Transferrin
4.3. Engineered Antibody
4.4. Transferrin Conjugation
4.5. In Vivo Linker
4.6. Fc-Domain Engineered Transcytosis
4.7. Manufactured Linked Products
- Val-Cit (VC): The sequence Valine–Citrulline (Val-Cit) is a commonly used dipeptide linker that is cleavable by Cathepsin B. It is often used in antibody–drug conjugates (ADCs) targeting cancer cells [194].
- Phe-Lys (FK): Phenylalanine–Lysine (Phe-Lys) is another dipeptide sequence that can be specifically cleaved by Cathepsin B [195]. This linker is useful in contexts where a slightly different cleavage rate or stability is required compared to Val-Cit.
- Gly-Phe-Leu-Gly (GFLG): This tetrapeptide sequence is one of the most typical Cathepsin B-sensitive linkers. It offers a balance of stability and efficient cleavage under physiological conditions [196].
- Ala-Leu-Ala-Leu (Ala-Leu)2: This repeated dipeptide sequence provides a robust framework sensitive to Cathepsin B cleavage. It is helpful in formulations where extended linker length is needed for optimal drug function [197].
4.8. Nanoparticle
5. An Example of Computer Modeling
6. Conclusions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
References
- Goedert, M. Neurodegenaration: Alzheimer’s and Parkinson’s diseases: The prion concept in relation to assembled Aβ, tau, and α-synuclein. Science 2015, 349, 1255555. [Google Scholar] [CrossRef] [PubMed]
- Gate, D.; Saligrama, N.; Leventhal, O.; Yang, A.C.; Unger, M.S.; Middeldorp, J.; Chen, K.; Lehallier, B.; Channappa, D.; De Los Santos, M.B.; et al. Clonally expanded CD8 T cells patrol the cerebrospinal fluid in Alzheimer’s disease. Nature 2020, 577, 399–404. [Google Scholar] [CrossRef]
- Sulzer, D.; Alcalay, R.N.; Garretti, F.; Cote, L.; Kanter, E.; Agin-Liebes, J.; Liong, C.; McMurtrey, C.; Hildebrand, W.H.; Mao, X.; et al. T cells from patients with Parkinson’s disease recognize α-synuclein peptides. Nature 2017, 546, 656–661. [Google Scholar] [CrossRef] [PubMed]
- Heneka, M.T.; Kummer, M.P.; Latz, E. Innate immune activation in neurodegenerative disease. Nat. Rev. Immunol. 2014, 14, 463–477. [Google Scholar] [CrossRef] [PubMed]
- Alzheimer’s disease facts and figures. Alzheimers Dement. 2023, 19, 1598–1695.
- Bertram, L.; Tanzi, R.E. The genetic epidemiology of neurodegenerative disease. J. Clin. Investig. 2005, 115, 1449–1457. [Google Scholar] [CrossRef] [PubMed]
- KEGG. Pathways of Neurodegeneration—Multiple Diseases—Homo Sapiens (Human); KEGG, 2024. Available online: https://www.genome.jp/dbget-bin/www_bget?hsa05022 (accessed on 7 March 2024).
- Selkoe, D.J.; Hardy, J. The amyloid hypothesis of Alzheimer’s disease at 25 years. EMBO Mol. Med. 2016, 8, 595–608. [Google Scholar] [CrossRef] [PubMed]
- Poewe, W.; Seppi, K.; Tanner, C.M.; Halliday, G.M.; Brundin, P.; Volkmann, J.; Schrag, A.E.; Lang, A.E. Parkinson disease. Nat. Rev. Dis. Primers 2017, 3, 17013. [Google Scholar] [CrossRef] [PubMed]
- Foerster, B.R.; Welsh, R.C.; Feldman, E.L. 25 years of neuroimaging in amyotrophic lateral sclerosis. Nat. Rev. Neurol. 2013, 9, 513–524. [Google Scholar] [CrossRef]
- Hendricks, E.; Quihuis, A.M.; Hung, S.T.; Chang, J.; Dorjsuren, N.; Der, B.; Staats, K.A.; Shi, Y.; Sta Maria, N.S.; Jacobs, R.E.; et al. The C9ORF72 repeat expansion alters neurodevelopment. Cell Rep. 2023, 42, 112983. [Google Scholar] [CrossRef] [PubMed]
- Smeyers, J.; Banchi, E.G.; Latouche, M. C9ORF72: What It Is, What It Does, and Why It Matters. Front. Cell. Neurosci. 2021, 15, 661447. [Google Scholar] [PubMed]
- Walsh, D.M.; Selkoe, D.J. A critical appraisal of the pathogenic protein spread hypothesis of neurodegeneration. Nat. Rev. Neurosci. 2016, 17, 251–260. [Google Scholar] [CrossRef] [PubMed]
- Makin, S. The amyloid hypothesis on trial. Nature 2018, 559, S4–S7. [Google Scholar] [CrossRef] [PubMed]
- Bard, F.; Cannon, C.; Barbour, R.; Burke, R.L.; Games, D.; Grajeda, H.; Guido, T.; Hu, K.; Huang, J.; Johnson-Wood, K.; et al. Peripherally administered antibodies against amyloid beta-peptide enter the central nervous system and reduce pathology in a mouse model of Alzheimer disease. Nat. Med. 2000, 6, 916–919. [Google Scholar] [CrossRef] [PubMed]
- Felgenhauer, K. Protein size and cerebrospinal fluid composition. Klin. Wochenschr. 1974, 52, 1158–1164. [Google Scholar] [CrossRef] [PubMed]
- Poduslo, J.F.; Curran, G.L.; Berg, C.T. Macromolecular permeability across the blood-nerve and blood-brain barriers. Proc. Natl. Acad. Sci. USA 1994, 91, 5705–5709. [Google Scholar] [CrossRef] [PubMed]
- Atwal, J.K.; Chen, Y.; Chiu, C.; Mortensen, D.L.; Meilandt, W.J.; Liu, Y.; Heise, C.E.; Hoyte, K.; Luk, W.; Lu, Y.; et al. A therapeutic antibody targeting BACE1 inhibits amyloid-β production in vivo. Sci. Transl. Med. 2011, 3, 84ra43. [Google Scholar] [CrossRef] [PubMed]
- St-Amour, I.; Paré, I.; Alata, W.; Coulombe, K.; Ringuette-Goulet, C.; Drouin-Ouellet, J.; Vandal, M.; Soulet, D.; Bazin, R.; Calon, F. Brain bioavailability of human intravenous immunoglobulin and its transport through the murine blood-brain barrier. J. Cereb. Blood Flow. Metab. 2013, 33, 1983–1992. [Google Scholar] [CrossRef] [PubMed]
- Yu, Y.J.; Watts, R.J. Developing therapeutic antibodies for neurodegenerative disease. Neurotherapeutics 2013, 10, 459–472. [Google Scholar] [CrossRef] [PubMed]
- Golde, T.E. Open questions for Alzheimer’s disease immunotherapy. Alzheimers Res. Ther. 2014, 6, 3. [Google Scholar] [PubMed]
- Rajadhyaksha, M.; Boyden, T.; Liras, J.; El-Kattan, A.; Brodfuehrer, J. Current advances in delivery of biotherapeutics across the blood-brain barrier. Curr. Drug Discov. Technol. 2011, 8, 87–101. [Google Scholar] [CrossRef] [PubMed]
- Larsen, J.M.; Martin, D.R.; Byrne, M.E. Recent advances in delivery through the blood-brain barrier. Curr. Top. Med. Chem. 2014, 14, 1148–1160. [Google Scholar] [CrossRef] [PubMed]
- Patel, M.M.; Patel, B.M. Crossing the Blood-Brain Barrier: Recent Advances in Drug Delivery to the Brain. CNS Drugs 2017, 31, 109–133. [Google Scholar] [CrossRef] [PubMed]
- Kumar, N.N.; Pizzo, M.E.; Nehra, G.; Wilken-Resman, B.; Boroumand, S.; Thorne, R.G. Passive Immunotherapies for Central Nervous System Disorders: Current Delivery Challenges and New Approaches. Bioconjug. Chem. 2018, 29, 3937–3966. [Google Scholar] [CrossRef] [PubMed]
- Crehan, H.; Liu, B.; Kleinschmidt, M.; Rahfeld, J.-U.; Le, K.X.; Caldarone, B.J.; Frost, J.L.; Hettmann, T.; Hutter-Paier, B.; O’Nuallain, B.; et al. Effector function of anti-pyroglutamate-3 Aβ antibodies affects cognitive benefit, glial activation and amyloid clearance in Alzheimer’s-like mice. Alzheimer’s Res. Ther. 2020, 12, 12. [Google Scholar] [CrossRef]
- Kang, T.H.; Jung, S.T. Boosting therapeutic potency of antibodies by taming Fc domain functions. Exp. Mol. Med. 2019, 51, 1–9. [Google Scholar] [PubMed]
- Beshir, S.A.; Aadithsoorya, A.M.; Parveen, A.; Goh, S.S.L.; Hussain, N.; Menon, V.B. Aducanumab Therapy to Treat Alzheimer’s Disease: A Narrative Review. Int. J. Alzheimers Dis. 2022, 2022, 9343514. [Google Scholar] [CrossRef] [PubMed]
- Cummings, J.; Osse, A.M.L.; Cammann, D.; Powell, J.; Chen, J. Anti-Amyloid Monoclonal Antibodies for the Treatment of Alzheimer’s Disease. BioDrugs 2024, 38, 5–22. [Google Scholar] [CrossRef] [PubMed]
- Cummings, J. Anti-Amyloid Monoclonal Antibodies are Transformative Treatments that Redefine Alzheimer’s Disease Therapeutics. Drugs 2023, 83, 569–576. [Google Scholar] [CrossRef] [PubMed]
- Budd Haeberlein, S.; Aisen, P.S.; Barkhof, F.; Chalkias, S.; Chen, T.; Cohen, S.; Dent, G.; Hansson, O.; Harrison, K.; von Hehn, C.; et al. Two Randomized Phase 3 Studies of Aducanumab in Early Alzheimer’s Disease. J. Prev. Alzheimers Dis. 2022, 9, 197–210. [Google Scholar] [CrossRef] [PubMed]
- Association As. Aducanumab to Be Discontinued as an Alzheimer’s Treatment. Available online: https://www.alz.org/alzheimers-dementia/treatments/aducanumab2024 (accessed on 7 March 2024).
- Perneczky, R.; Jessen, F.; Grimmer, T.; Levin, J.; Flöel, A.; Peters, O.; Froelich, L. Anti-amyloid antibody therapies in Alzheimer’s disease. Brain 2023, 146, 842–849. [Google Scholar] [CrossRef] [PubMed]
- Englund, H.; Sehlin, D.; Johansson, A.S.; Nilsson, L.N.; Gellerfors, P.; Paulie, S.; Lannfelt, L.; Pettersson, F.E. Sensitive ELISA detection of amyloid-beta protofibrils in biological samples. J. Neurochem. 2007, 103, 334–345. [Google Scholar] [CrossRef]
- Swanson, C.J.; Zhang, Y.; Dhadda, S.; Wang, J.; Kaplow, J.; Lai, R.Y.K.; Lannfelt, L.; Bradley, H.; Rabe, M.; Koyama, A.; et al. A randomized, double-blind, phase 2b proof-of-concept clinical trial in early Alzheimer’s disease with lecanemab, an anti-Aβ protofibril antibody. Alzheimer’s Res. Ther. 2021, 13, 80. [Google Scholar] [CrossRef] [PubMed]
- van Dyck, C.H.; Swanson, C.J.; Aisen, P.; Bateman, R.J.; Chen, C.; Gee, M.; Kanekiyo, M.; Li, D.; Reyderman, L.; Cohen, S.; et al. Lecanemab in Early Alzheimer’s Disease. N. Engl. J. Med. 2023, 388, 9–21. [Google Scholar] [CrossRef] [PubMed]
- Harris, E. Alzheimer Drug Lecanemab Gains Traditional FDA Approval. JAMA 2023, 330, 495. [Google Scholar] [CrossRef] [PubMed]
- Sims, J.R.; Zimmer, J.A.; Evans, C.D.; Lu, M.; Ardayfio, P.; Sparks, J.; Wessels, A.M.; Shcherbinin, S.; Wang, H.; Monkul Nery, E.S.; et al. Donanemab in Early Symptomatic Alzheimer Disease: The TRAILBLAZER-ALZ 2 Randomized Clinical Trial. JAMA 2023, 330, 512–527. [Google Scholar] [CrossRef] [PubMed]
- Hutchison, R.M.; Fraser, K.; Yang, M.; Fox, T.; Hirschhorn, E.; Njingti, E.; Scott, D.; Bedell, B.J.; Kistner, K.M.; Cedarbaum, J.M.; et al. Cinpanemab in Early Parkinson Disease: Evaluation of Biomarker Results From the Phase 2 SPARK Clinical Trial. Neurology 2024, 102, e209137. [Google Scholar] [CrossRef] [PubMed]
- Mintun, M.A.; Lo, A.C.; Duggan Evans, C.; Wessels, A.M.; Ardayfio, P.A.; Andersen, S.W.; Shcherbinin, S.; Sparks, J.; Sims, J.R.; Brys, M.; et al. Donanemab in Early Alzheimer’s Disease. N. Engl. J. Med. 2021, 384, 1691–1704. [Google Scholar] [CrossRef] [PubMed]
- The Washington Post. FDA Delays Alzheimer’s Drug for Further Review in Surprise Move. Available online: https://www.washingtonpost.com/business/2024/03/08/eli-lilly-alzheimers-donanemab-fda/2024 (accessed on 7 March 2024).
- Söderberg, L.; Johannesson, M.; Nygren, P.; Laudon, H.; Eriksson, F.; Osswald, G.; Möller, C.; Lannfelt, L. Lecanemab, Aducanumab, and Gantenerumab—Binding Profiles to Different Forms of Amyloid-Beta Might Explain Efficacy and Side Effects in Clinical Trials for Alzheimer’s Disease. Neurotherapeutics 2023, 20, 195–206. [Google Scholar] [CrossRef] [PubMed]
- Lang, A.E.; Siderowf, A.D.; Macklin, E.A.; Poewe, W.; Brooks, D.J.; Fernandez, H.H.; Rascol, O.; Giladi, N.; Stocchi, F.; Tanner, C.M.; et al. Trial of Cinpanemab in Early Parkinson’s Disease. N. Engl. J. Med. 2022, 387, 408–420. [Google Scholar] [CrossRef] [PubMed]
- The New York Times. A.L.S. Drug Relyvrio Fails Clinical Trial and May Be Withdrawn from the Market. Available online: https://www.nytimes.com/2024/03/08/health/als-drug-relyvrio.html2024 (accessed on 7 March 2024).
- Today PsN. Biogen Discontinues Development of Cinpanemab. Available online: https://parkinsonsnewstoday.com/news/biogen-announcement-discontinue-cinpanemab-parkinsons/2024 (accessed on 7 March 2024).
- Clinicaltrials.gov. Alzheimer’s Disease Antibody Response. Available online: https://clinicaltrials.gov/search?cond=Neurological%20Disorder&aggFilters=studyType:int&term=Antibody%20Response&intr=antibody2024 (accessed on 7 March 2024).
- Feinberg, H.; Saldanha, J.W.; Diep, L.; Goel, A.; Widom, A.; Veldman, G.M.; Weis, W.I.; Schenk, D.; Basi, G.S. Crystal structure reveals conservation of amyloid-β conformation recognized by 3D6 following humanization to bapineuzumab. Alzheimers Res. Ther. 2014, 6, 31. [Google Scholar] [CrossRef] [PubMed]
- Rinne, J.O.; Brooks, D.J.; Rossor, M.N.; Fox, N.C.; Bullock, R.; Klunk, W.E.; Mathis, C.A.; Blennow, K.; Barakos, J.; Okello, A.A.; et al. 11C-PiB PET assessment of change in fibrillar amyloid-beta load in patients with Alzheimer’s disease treated with bapineuzumab: A phase 2, double-blind, placebo-controlled, ascending-dose study. Lancet Neurol. 2010, 9, 363–372. [Google Scholar] [CrossRef] [PubMed]
- Salloway, S.; Sperling, R.; Fox, N.C.; Blennow, K.; Klunk, W.; Raskind, M.; Sabbagh, M.; Honig, L.S.; Porsteinsson, A.P.; Ferris, S.; et al. Two phase 3 trials of bapineuzumab in mild-to-moderate Alzheimer’s disease. N. Engl. J. Med. 2014, 370, 322–333. [Google Scholar] [CrossRef] [PubMed]
- Klein, G.; Delmar, P.; Voyle, N.; Rehal, S.; Hofmann, C.; Abi-Saab, D.; Andjelkovic, M.; Ristic, S.; Wang, G.; Bateman, R.; et al. Gantenerumab reduces amyloid-β plaques in patients with prodromal to moderate Alzheimer’s disease: A PET substudy interim analysis. Alzheimers Res. Ther. 2019, 11, 101. [Google Scholar] [CrossRef] [PubMed]
- Sevigny, J.; Chiao, P.; Bussière, T.; Weinreb, P.H.; Williams, L.; Maier, M.; Dunstan, R.; Salloway, S.; Chen, T.; Ling, Y.; et al. The antibody aducanumab reduces Aβ plaques in Alzheimer’s disease. Nature 2016, 537, 50–56. [Google Scholar] [CrossRef] [PubMed]
- Sperling, R.; Salloway, S.; Brooks, D.J.; Tampieri, D.; Barakos, J.; Fox, N.C.; Raskind, M.; Sabbagh, M.; Honig, L.S.; Porsteinsson, A.P.; et al. Amyloid-related imaging abnormalities in patients with Alzheimer’s disease treated with bapineuzumab: A retrospective analysis. Lancet Neurol. 2012, 11, 241–249. [Google Scholar] [CrossRef] [PubMed]
- Foley, K.E.; Wilcock, D.M. Vascular Considerations for Amyloid Immunotherapy. Curr. Neurol. Neurosci. Rep. 2022, 22, 709–719. [Google Scholar] [CrossRef] [PubMed]
- Fortea, J.; Pegueroles, J.; Alcolea, D.; Belbin, O.; Dols-Icardo, O.; Vaqué-Alcázar, L.; Videla, L.; Gispert, J.D.; Suárez-Calvet, M.; Johnson, S.C.; et al. APOE4 homozygozity represents a distinct genetic form of Alzheimer’s disease. Nat. Med. 2024, 30, 1284–1291. [Google Scholar] [CrossRef] [PubMed]
- Bellenguez, C.; Küçükali, F.; Jansen, I.E.; Kleineidam, L.; Moreno-Grau, S.; Amin, N.; Naj, A.C.; Campos-Martin, R.; Grenier-Boley, B.; Andrade, V.; et al. New insights into the genetic etiology of Alzheimer’s disease and related dementias. Nat. Genet. 2022, 54, 412–436. [Google Scholar] [PubMed]
- Foley, K.E.; Wilcock, D.M. Three major effects of APOE(ε4) on Aβ immunotherapy induced ARIA. Front. Aging Neurosci. 2024, 16, 1412006. [Google Scholar] [CrossRef] [PubMed]
- Qiao, Y.; Gu, J.; Yu, M.; Chi, Y.; Ma, Y. Comparative Efficacy and Safety of Monoclonal Antibodies for Cognitive Decline in Patients with Alzheimer’s Disease: A Systematic Review and Network Meta-Analysis. CNS Drugs 2024, 38, 169–192. [Google Scholar] [CrossRef] [PubMed]
- Mortada, I.; Farah, R.; Nabha, S.; Ojcius, D.M.; Fares, Y.; Almawi, W.Y.; Sadier, N.S. Immunotherapies for Neurodegenerative Diseases. Front. Neurol. 2021, 12, 654739. [Google Scholar] [CrossRef] [PubMed]
- Singh Gautam, A.; Pandey, S.K.; Lasure, V.; Dubey, S.; Singh, R.K. Monoclonal antibodies for the management of central nervous system diseases: Clinical success and future strategies. Expert Opin. Biol. Ther. 2023, 23, 603–618. [Google Scholar] [CrossRef] [PubMed]
- Alzforum. Alzheimer Treatment. Available online: https://www.alzforum.org/therapeutics/2024 (accessed on 7 March 2024).
- Abushouk, A.I.; Elmaraezy, A.; Aglan, A.; Salama, R.; Fouda, S.; Fouda, R.; AlSafadi, A.M. Bapineuzumab for mild to moderate Alzheimer’s disease: A meta-analysis of randomized controlled trials. BMC Neurol. 2017, 17, 66. [Google Scholar] [CrossRef] [PubMed]
- Ma, B.; Zhao, J.; Nussinov, R. Conformational selection in amyloid-based immunotherapy: Survey of crystal structures of antibody-amyloid complexes. Biochim. Biophys. Acta 2016, 1860 Pt B, 2672–2681. [Google Scholar] [CrossRef]
- Ostrowitzki, S.; Bittner, T.; Sink, K.M.; Mackey, H.; Rabe, C.; Honig, L.S.; Cassetta, E.; Woodward, M.; Boada, M.; van Dyck, C.H.; et al. Evaluating the Safety and Efficacy of Crenezumab vs Placebo in Adults With Early Alzheimer Disease: Two Phase 3 Randomized Placebo-Controlled Trials. JAMA Neurol. 2022, 79, 1113–1121. [Google Scholar] [CrossRef] [PubMed]
- Ayalon, G.; Lee, S.H.; Adolfsson, O.; Foo-Atkins, C.; Atwal, J.K.; Blendstrup, M.; Booler, H.; Bravo, J.; Brendza, R.; Brunstein, F.; et al. Antibody semorinemab reduces tau pathology in a transgenic mouse model and engages tau in patients with Alzheimer’s disease. Sci. Transl. Med. 2021, 13, eabb2639. [Google Scholar] [CrossRef] [PubMed]
- Zhang, D.; Zhang, W.; Ming, C.; Gao, X.; Yuan, H.; Lin, X.; Mao, X.; Wang, C.; Guo, X.; Du, Y.; et al. P-tau217 correlates with neurodegeneration in Alzheimer’s disease, and targeting p-tau217 with immunotherapy ameliorates murine tauopathy. Neuron 2024, 112, 1676–1693.e12. [Google Scholar] [CrossRef] [PubMed]
- Florian, H.; Wang, D.; Arnold, S.E.; Boada, M.; Guo, Q.; Jin, Z.; Zheng, H.; Fisseha, N.; Kalluri, H.V.; Rendenbach-Mueller, B.; et al. Tilavonemab in early Alzheimer’s disease: Results from a phase 2, randomized, double-blind study. Brain 2023, 146, 2275–2284. [Google Scholar] [CrossRef] [PubMed]
- Höglinger, G.U.; Litvan, I.; Mendonca, N.; Wang, D.; Zheng, H.; Rendenbach-Mueller, B.; Lon, H.-K.; Jin, Z.; Fisseha, N.; Budur, K.; et al. Safety and efficacy of tilavonemab in progressive supranuclear palsy: A phase 2, randomised, placebo-controlled trial. Lancet Neurol. 2021, 20, 182–192. [Google Scholar] [CrossRef] [PubMed]
- Foster, J.K.; Verdile, G.; Bates, K.A.; Martins, R.N. Immunization in Alzheimer’s disease: Naïve hope or realistic clinical potential? Mol. Psychiatry 2009, 14, 239–251. [Google Scholar] [CrossRef] [PubMed]
- Holmes, C.; Boche, D.; Wilkinson, D.; Yadegarfar, G.; Hopkins, V.; Bayer, A.; Jones, R.W.; Bullock, R.; Love, S.; Neal, J.W.; et al. Long-term effects of Aβ42 immunisation in Alzheimer’s disease: Follow-up of a randomised, placebo-controlled phase I trial. Lancet 2008, 372, 216–223. [Google Scholar] [CrossRef] [PubMed]
- Carlström, K.; Castelo-Branco, G. Alzheimer’s risk variant APOE4 linked to myelin-assembly malfunction. Nature 2022, 611, 670–671. [Google Scholar] [CrossRef] [PubMed]
- Blanchard, J.W.; Akay, L.A.; Davila-Velderrain, J.; von Maydell, D.; Mathys, H.; Davidson, S.M.; Effenberger, A.; Chen, C.-Y.; Maner-Smith, K.; Hajjar, I.; et al. APOE4 impairs myelination via cholesterol dysregulation in oligodendrocytes. Nature 2022, 611, 769–779. [Google Scholar] [CrossRef] [PubMed]
- Ross, C.A.; Tabrizi, S.J. Huntington’s disease: From molecular pathogenesis to clinical treatment. Lancet Neurol. 2011, 10, 83–98. [Google Scholar] [CrossRef] [PubMed]
- Orr, H.T.; Zoghbi, H.Y. SCA1 molecular genetics: A history of a 13 year collaboration against glutamines. Hum. Mol. Genet. 2001, 10, 2307–2311. [Google Scholar] [CrossRef] [PubMed]
- Iadanza, M.G.; Jackson, M.P.; Hewitt, E.W.; Ranson, N.A.; Radford, S.E. A new era for understanding amyloid structures and disease. Nat. Rev. Mol. Cell Biol. 2018, 19, 755–773. [Google Scholar] [CrossRef] [PubMed]
- Mathieu, C.; Pappu, R.V.; Taylor, J.P. Beyond aggregation: Pathological phase transitions in neurodegenerative disease. Science 2020, 370, 56–60. [Google Scholar] [CrossRef] [PubMed]
- Petkova, A.T.; Leapman, R.D.; Guo, Z.; Yau, W.M.; Mattson, M.P.; Tycko, R. Self-propagating, molecular-level polymorphism in Alzheimer’s beta-amyloid fibrils. Science 2005, 307, 262–265. [Google Scholar] [CrossRef] [PubMed]
- Fitzpatrick, A.W.P.; Falcon, B.; He, S.; Murzin, A.G.; Murshudov, G.; Garringer, H.J.; Crowther, R.A.; Ghetti, B.; Goedert, M.; Scheres, S.H.W. Cryo-EM structures of tau filaments from Alzheimer’s disease. Nature 2017, 547, 185–190. [Google Scholar] [CrossRef] [PubMed]
- Kwon, D. Rogue antibodies involved in almost one-fifth of COVID deaths. Nature 2021, 597, 162. [Google Scholar] [CrossRef] [PubMed]
- Zakariya, S.M.; Zehra, A.; Khan, R.H. Biophysical Insight into Protein Folding, Aggregate Formation and its Inhibition Strategies. Protein Pept. Lett. 2022, 29, 22–36. [Google Scholar] [CrossRef] [PubMed]
- Abner, E.L.; Neltner, J.H.; Jicha, G.A.; Patel, E.; Anderson, S.L.; Wilcock, D.M.; Van Eldik, L.J.; Nelson, P.T. Diffuse Amyloid-β Plaques, Neurofibrillary Tangles, and the Impact of APOE in Elderly Persons’ Brains Lacking Neuritic Amyloid Plaques. J. Alzheimers Dis. 2018, 64, 1307–1324. [Google Scholar] [CrossRef] [PubMed]
- Rahman, M.M.; Lendel, C. Extracellular protein components of amyloid plaques and their roles in Alzheimer’s disease pathology. Mol. Neurodegener. 2021, 16, 59. [Google Scholar] [CrossRef] [PubMed]
- Hardy, J.; Allsop, D. Amyloid deposition as the central event in the aetiology of Alzheimer’s disease. Trends Pharmacol. Sci. 1991, 12, 383–388. [Google Scholar] [CrossRef] [PubMed]
- Loeffler, D.A. Antibody-Mediated Clearance of Brain Amyloid-β: Mechanisms of Action, Effects of Natural and Monoclonal Anti-Aβ Antibodies, and Downstream Effects. J. Alzheimers Dis. Rep. 2023, 7, 873–899. [Google Scholar] [CrossRef] [PubMed]
- Deane, R.; Bell, R.D.; Sagare, A.; Zlokovic, B.V. Clearance of amyloid-beta peptide across the blood-brain barrier: Implication for therapies in Alzheimer’s disease. CNS Neurol. Disord. Drug Targets 2009, 8, 16–30. [Google Scholar] [CrossRef] [PubMed]
- Pascale, C.L.; Miller, M.C.; Chiu, C.; Boylan, M.; Caralopoulos, I.N.; Gonzalez, L.; Johanson, C.E.; Silverberg, G.D. Amyloid-beta transporter expression at the blood-CSF barrier is age-dependent. Fluids Barriers CNS 2011, 8, 21. [Google Scholar] [CrossRef] [PubMed]
- Iliff, J.J.; Wang, M.; Zeppenfeld, D.M.; Venkataraman, A.; Plog, B.A.; Liao, Y.; Deane, R.; Nedergaard, M. Cerebral arterial pulsation drives paravascular CSF-interstitial fluid exchange in the murine brain. J. Neurosci. 2013, 33, 18190–18199. [Google Scholar] [CrossRef] [PubMed]
- Weller, R.O.; Subash, M.; Preston, S.D.; Mazanti, I.; Carare, R.O. Perivascular drainage of amyloid-beta peptides from the brain and its failure in cerebral amyloid angiopathy and Alzheimer’s disease. Brain Pathol. 2008, 18, 253–266. [Google Scholar] [CrossRef] [PubMed]
- Nixon, R.A. Amyloid precursor protein and endosomal-lysosomal dysfunction in Alzheimer’s disease: Inseparable partners in a multifactorial disease. FASEB J. 2017, 31, 2729–2743. [Google Scholar] [CrossRef] [PubMed]
- Hong, L.; Huang, H.C.; Jiang, Z.F. Relationship between amyloid-beta and the ubiquitin-proteasome system in Alzheimer’s disease. Neurol. Res. 2014, 36, 276–282. [Google Scholar] [CrossRef]
- Cho, M.H.; Cho, K.; Kang, H.J.; Jeon, E.Y.; Kim, H.S.; Kwon, H.J.; Kim, H.M.; Kim, D.H.; Yoon, S.Y. Autophagy in microglia degrades extracellular β-amyloid fibrils and regulates the NLRP3 inflammasome. Autophagy 2014, 10, 1761–1775. [Google Scholar] [CrossRef] [PubMed]
- Kametani, F.; Hasegawa, M. Reconsideration of Amyloid Hypothesis and Tau Hypothesis in Alzheimer’s Disease. Front. Neurosci. 2018, 12, 25. [Google Scholar] [CrossRef] [PubMed]
- Walsh, D.M.; Selkoe, D.J. A beta oligomers—A decade of discovery. J. Neurochem. 2007, 101, 1172–1184. [Google Scholar] [CrossRef] [PubMed]
- Mehta, D.; Jackson, R.; Paul, G.; Shi, J.; Sabbagh, M. Why do trials for Alzheimer’s disease drugs keep failing? A discontinued drug perspective for 2010–2015. Expert Opin. Investig. Drugs 2017, 26, 735–739. [Google Scholar] [CrossRef] [PubMed]
- Morris, G.P.; Clark, I.A.; Vissel, B. Inconsistencies and controversies surrounding the amyloid hypothesis of Alzheimer’s disease. Acta Neuropathol. Commun. 2014, 2, 135. [Google Scholar] [CrossRef] [PubMed]
- Montagne, A.; Nation, D.A.; Pa, J.; Sweeney, M.D.; Toga, A.W.; Zlokovic, B.V. Brain imaging of neurovascular dysfunction in Alzheimer’s disease. Acta Neuropathol. 2016, 131, 687–707. [Google Scholar] [CrossRef] [PubMed]
- Farrall, A.J.; Wardlaw, J.M. Blood-brain barrier: Ageing and microvascular disease—Systematic review and meta-analysis. Neurobiol. Aging 2009, 30, 337–352. [Google Scholar] [CrossRef] [PubMed]
- Rasmussen, J.; Langerman, H. Alzheimer’s Disease—Why We Need Early Diagnosis. Degener. Neurol. Neuromuscul. Dis. 2019, 9, 123–130. [Google Scholar] [CrossRef] [PubMed]
- Solito, E.; Sastre, M. Microglia function in Alzheimer’s disease. Front. Pharmacol. 2012, 3, 14. [Google Scholar] [CrossRef] [PubMed]
- Wilcock, D.M.; Munireddy, S.K.; Rosenthal, A.; Ugen, K.E.; Gordon, M.N.; Morgan, D. Microglial activation facilitates Abeta plaque removal following intracranial anti-Abeta antibody administration. Neurobiol. Dis. 2004, 15, 11–20. [Google Scholar] [CrossRef] [PubMed]
- Farfara, D.; Lifshitz, V.; Frenkel, D. Neuroprotective and neurotoxic properties of glial cells in the pathogenesis of Alzheimer’s disease. J. Cell Mol. Med. 2008, 12, 762–780. [Google Scholar] [CrossRef] [PubMed]
- Zhang, W.; Xiao, D.; Mao, Q.; Xia, H. Role of neuroinflammation in neurodegeneration development. Signal Transduct. Target Ther. 2023, 8, 267. [Google Scholar] [CrossRef]
- O’Reilly, M.L.; Tom, V.J. Neuroimmune System as a Driving Force for Plasticity Following CNS Injury. Front. Cell. Neurosci. 2020, 14, 187. [Google Scholar] [CrossRef] [PubMed]
- Ren, H.; Han, R.; Chen, X.; Liu, X.; Wan, J.; Wang, L.; Yang, X.; Wang, J. Potential therapeutic targets for intracerebral hemorrhage-associated inflammation: An update. J. Cereb. Blood Flow. Metab. 2020, 40, 1752–1768. [Google Scholar] [CrossRef] [PubMed]
- Zhu, H.; Wang, Z.; Yu, J.; Yang, X.; He, F.; Liu, Z.; Che, F.; Chen, X.; Ren, H.; Hong, M.; et al. Role and mechanisms of cytokines in the secondary brain injury after intracerebral hemorrhage. Prog. Neurobiol. 2019, 178, 101610. [Google Scholar] [CrossRef] [PubMed]
- Bradt, B.M.; Kolb, W.P.; Cooper, N.R. Complement-dependent proinflammatory properties of the Alzheimer’s disease beta-peptide. J. Exp. Med. 1998, 188, 431–438. [Google Scholar] [CrossRef] [PubMed]
- Webster, S.D.; Galvan, M.D.; Ferran, E.; Garzon-Rodriguez, W.; Glabe, C.G.; Tenner, A.J. Antibody-mediated phagocytosis of the amyloid beta-peptide in microglia is differentially modulated by C1q. J. Immunol. 2001, 166, 7496–7503. [Google Scholar] [CrossRef] [PubMed]
- Wyss-Coray, T.; Mucke, L. Inflammation in neurodegenerative disease—A double-edged sword. Neuron 2002, 35, 419–432. [Google Scholar] [CrossRef] [PubMed]
- Bach, J.P.; Dodel, R. Naturally occurring autoantibodies against β-Amyloid. Adv. Exp. Med. Biol. 2012, 750, 91–99. [Google Scholar] [PubMed]
- Kappler, K.; Hennet, T. Emergence and significance of carbohydrate-specific antibodies. Genes Immun. 2020, 21, 224–239. [Google Scholar] [CrossRef] [PubMed]
- Dodel, R.; Hampel, H.; Depboylu, C.; Lin, S.; Gao, F.; Schock, S.; Jäckel, S.; Wei, X.; Buerger, K.; Höft, C.; et al. Human antibodies against amyloid beta peptide: A potential treatment for Alzheimer’s disease. Ann. Neurol. 2002, 52, 253–256. [Google Scholar] [CrossRef] [PubMed]
- Istrin, G.; Bosis, E.; Solomon, B. Intravenous immunoglobulin enhances the clearance of fibrillar amyloid-beta peptide. J. Neurosci. Res. 2006, 84, 434–443. [Google Scholar] [CrossRef] [PubMed]
- Klaver, A.C.; Finke, J.M.; Digambaranath, J.; Balasubramaniam, M.; Loeffler, D.A. Antibody concentrations to Abeta1-42 monomer and soluble oligomers in untreated and antibody-antigen-dissociated intravenous immunoglobulin preparations. Int. Immunopharmacol. 2010, 10, 115–119. [Google Scholar] [CrossRef] [PubMed]
- Dodel, R.; Balakrishnan, K.; Keyvani, K.; Deuster, O.; Neff, F.; Andrei-Selmer, L.C.; Röskam, S.; Stüer, C.; Al-Abed, Y.; Noelker, C.; et al. Naturally occurring autoantibodies against beta-amyloid: Investigating their role in transgenic animal and in vitro models of Alzheimer’s disease. J. Neurosci. 2011, 31, 5847–5854. [Google Scholar] [CrossRef] [PubMed]
- Smith, L.M.; Coffey, M.P.; Klaver, A.C.; Loeffler, D.A. Intravenous immunoglobulin products contain specific antibodies to recombinant human tau protein. Int. Immunopharmacol. 2013, 16, 424–428. [Google Scholar] [CrossRef] [PubMed]
- Wisniewski, T.; Sigurdsson, E.M. Murine models of Alzheimer’s disease and their use in developing immunotherapies. Biochim. Biophys. Acta 2010, 1802, 847–859. [Google Scholar] [CrossRef] [PubMed]
- DeMattos, R.B.; Bales, K.R.; Cummins, D.J.; Dodart, J.C.; Paul, S.M.; Holtzman, D.M. Peripheral anti-A beta antibody alters CNS and plasma A beta clearance and decreases brain A beta burden in a mouse model of Alzheimer’s disease. Proc. Natl. Acad. Sci. USA 2001, 98, 8850–8855. [Google Scholar] [CrossRef] [PubMed]
- Menendez-Gonzalez, M.; Padilla-Zambrano, H.S.; Alvarez, G.; Capetillo-Zarate, E.; Tomas-Zapico, C.; Costa, A. Targeting Beta-Amyloid at the CSF: A New Therapeutic Strategy in Alzheimer’s Disease. Front. Aging Neurosci. 2018, 10, 100. [Google Scholar] [CrossRef] [PubMed]
- Das, P.; Howard, V.; Loosbrock, N.; Dickson, D.; Murphy, M.P.; Golde, T.E. Amyloid-beta immunization effectively reduces amyloid deposition in FcRgamma-/- knock-out mice. J. Neurosci. 2003, 23, 8532–8538. [Google Scholar] [CrossRef] [PubMed]
- Garcia-Alloza, M.; Ferrara, B.J.; Dodwell, S.A.; Hickey, G.A.; Hyman, B.T.; Bacskai, B.J. A limited role for microglia in antibody mediated plaque clearance in APP mice. Neurobiol. Dis. 2007, 28, 286–292. [Google Scholar] [CrossRef] [PubMed]
- Solomon, B.; Koppel, R.; Hanan, E.; Katzav, T. Monoclonal antibodies inhibit in vitro fibrillar aggregation of the Alzheimer beta-amyloid peptide. Proc. Natl. Acad. Sci. USA 1996, 93, 452–455. [Google Scholar] [CrossRef] [PubMed]
- Taguchi, H.; Planque, S.; Nishiyama, Y.; Symersky, J.; Boivin, S.; Szabo, P.; Friedland, R.P.; Ramsland, P.A.; Edmundson, A.B.; Weksler, M.E.; et al. Autoantibody-catalyzed hydrolysis of amyloid beta peptide. J. Biol. Chem. 2008, 283, 4714–4722. [Google Scholar] [CrossRef] [PubMed]
- Gu, H.; Zhong, Z.; Jiang, W.; Du, E.; Dodel, R.; Farlow, M.R.; Zheng, W.; Du, Y. The role of choroid plexus in IVIG-induced beta-amyloid clearance. Neuroscience 2014, 270, 168–176. [Google Scholar] [CrossRef] [PubMed]
- Veronesi, G.; Baldwin, D.R.; Henschke, C.I.; Ghislandi, S.; Iavicoli, S.; Oudkerk, M.; De Koning, H.J.; Shemesh, J.; Field, J.K.; Zulueta, J.J.; et al. Recommendations for Implementing Lung Cancer Screening with Low-Dose Computed Tomography in Europe. Cancers 2020, 12, 1672. [Google Scholar] [CrossRef] [PubMed]
- Söldner, C.A.; Sticht, H.; Horn, A.H.C. Role of the N-terminus for the stability of an amyloid-β fibril with three-fold symmetry. PLoS ONE 2017, 12, e0186347. [Google Scholar] [CrossRef] [PubMed]
- Liu, Y.H.; Bu, X.L.; Liang, C.R.; Wang, Y.R.; Zhang, T.; Jiao, S.S.; Zeng, F.; Yao, X.Q.; Zhou, H.D.; Deng, J.; et al. An N-terminal antibody promotes the transformation of amyloid fibrils into oligomers and enhances the neurotoxicity of amyloid-beta: The dust-raising effect. J. Neuroinflam. 2015, 12, 153. [Google Scholar] [CrossRef] [PubMed]
- Sullivan, C.P.; Berg, E.A.; Elliott-Bryant, R.; Fishman, J.B.; McKee, A.C.; Morin, P.J.; Shia, M.A.; Fine, R.E. Pyroglutamate-Aβ 3 and 11 colocalize in amyloid plaques in Alzheimer’s disease cerebral cortex with pyroglutamate-Aβ 11 forming the central core. Neurosci. Lett. 2011, 505, 109–112. [Google Scholar] [CrossRef]
- Bakrania, P.; Hall, G.; Bouter, Y.; Bouter, C.; Beindorff, N.; Cowan, R.; Davies, S.; Price, J.; Mpamhanga, C.; Love, E.; et al. Discovery of a novel pseudo β-hairpin structure of N-truncated amyloid-β for use as a vaccine against Alzheimer’s disease. Mol. Psychiatry 2022, 27, 840–848. [Google Scholar] [CrossRef]
- Faresjö, R.; Sehlin, D.; Syvänen, S. Age, dose, and binding to TfR on blood cells influence brain delivery of a TfR-transported antibody. Fluids Barriers CNS 2023, 20, 34. [Google Scholar] [CrossRef] [PubMed]
- Faresjö, R.; Bonvicini, G.; Fang, X.T.; Aguilar, X.; Sehlin, D.; Syvänen, S. Brain pharmacokinetics of two BBB penetrating bispecific antibodies of different size. Fluids Barriers CNS 2021, 18, 26. [Google Scholar] [CrossRef] [PubMed]
- Holliger, P.; Prospero, T.; Winter, G. “Diabodies”: Small bivalent and bispecific antibody fragments. Proc. Natl. Acad. Sci. USA 1993, 90, 6444–6448. [Google Scholar] [CrossRef] [PubMed]
- Muñoz-López, P.; Ribas-Aparicio, R.M.; Becerra-Báez, E.I.; Fraga-Pérez, K.; Flores-Martínez, L.F.; Mateos-Chávez, A.A.; Luria-Pérez, R. Single-Chain Fragment Variable: Recent Progress in Cancer Diagnosis and Therapy. Cancers 2022, 14, 4206. [Google Scholar] [CrossRef] [PubMed]
- Rofo, F.; Buijs, J.; Falk, R.; Honek, K.; Lannfelt, L.; Lilja, A.M.; Metzendorf, N.G.; Gustavsson, T.; Sehlin, D.; Söderberg, L.; et al. Novel multivalent design of a monoclonal antibody improves binding strength to soluble aggregates of amyloid beta. Transl. Neurodegener. 2021, 10, 38. [Google Scholar] [CrossRef] [PubMed]
- Kalinovsky, D.V.; Kholodenko, I.V.; Kibardin, A.V.; Doronin, I.I.; Svirshchevskaya, E.V.; Ryazantsev, D.Y.; Konovalova, M.V.; Rozov, F.N.; Larin, S.S.; Deyev, S.M.; et al. Minibody-Based and scFv-Based Antibody Fragment-Drug Conjugates Selectively Eliminate GD2-Positive Tumor Cells. Int. J. Mol. Sci. 2023, 24, 1239. [Google Scholar] [CrossRef]
- Harmsen, M.M.; De Haard, H.J. Properties, production, and applications of camelid single-domain antibody fragments. Appl. Microbiol. Biotechnol. 2007, 77, 13–22. [Google Scholar] [CrossRef] [PubMed]
- Möller, A.; Pion, E.; Narayan, V.; Ball, K.L. Intracellular activation of interferon regulatory factor-1 by nanobodies to the multifunctional (Mf1) domain. J. Biol. Chem. 2010, 285, 38348–38361. [Google Scholar] [CrossRef] [PubMed]
- Zheng, F.; Pang, Y.; Li, L.; Pang, Y.; Zhang, J.; Wang, X.; Raes, G. Applications of nanobodies in brain diseases. Front. Immunol. 2022, 13, 978513. [Google Scholar] [CrossRef] [PubMed]
- Butler, Y.R.; Liu, Y.; Kumbhar, R.; Zhao, P.; Gadhave, K.; Wang, N.; Li, Y.; Mao, X.; Wang, W. α-Synuclein fibril-specific nanobody reduces prion-like α-synuclein spreading in mice. Nat. Commun. 2022, 13, 4060. [Google Scholar] [CrossRef] [PubMed]
- Dobritzsch, D.; Ricagno, S.; Schneider, G.; Schnackerz, K.D.; Lindqvist, Y. Crystal structure of the productive ternary complex of dihydropyrimidine dehydrogenase with NADPH and 5-iodouracil. Implications for mechanism of inhibition and electron transfer. J. Biol. Chem. 2002, 277, 13155–13166. [Google Scholar] [CrossRef] [PubMed]
- Spiegelberg, H.L.; Heath, V.C.; Lang, J.E. IgG Half-Molecules: Clinical and Immunologic Features in a Patient With Plasma Cell Leukemia. Blood 1975, 45, 305–313. [Google Scholar] [CrossRef] [PubMed]
- Goulet, D.R.; Atkins, W.M. Considerations for the Design of Antibody-Based Therapeutics. J. Pharm. Sci. 2020, 109, 74–103. [Google Scholar] [CrossRef] [PubMed]
- FDA. Bispecific Antibody Development Programs—Guidance for Industry. Available online: https://www.fda.gov/regulatory-information/search-fda-guidance-documents/bispecific-antibody-development-programs-guidance-industry2021 (accessed on 7 March 2024).
- Brinkmann, U.; Kontermann, R.E. Bispecific antibodies. Science 2021, 372, 916–917. [Google Scholar] [CrossRef] [PubMed]
- Fu, B.M. Transport Across the Blood-Brain Barrier. Adv. Exp. Med. Biol. 2018, 1097, 235–259. [Google Scholar] [PubMed]
- Pardridge, W.M. Drug targeting to the brain. Pharm. Res. 2007, 24, 1733–1744. [Google Scholar] [CrossRef] [PubMed]
- Fortin, D.; Gendron, C.; Boudrias, M.; Garant, M.P. Enhanced chemotherapy delivery by intraarterial infusion and blood-brain barrier disruption in the treatment of cerebral metastasis. Cancer 2007, 109, 751–760. [Google Scholar] [CrossRef] [PubMed]
- Hynynen, K.; McDannold, N.; Vykhodtseva, N.; Jolesz, F.A. Noninvasive MR imaging-guided focal opening of the blood-brain barrier in rabbits. Radiology 2001, 220, 640–646. [Google Scholar] [CrossRef] [PubMed]
- Burgess, A.; Hynynen, K. Noninvasive and targeted drug delivery to the brain using focused ultrasound. ACS Chem. Neurosci. 2013, 4, 519–526. [Google Scholar] [CrossRef]
- Bradley, M.O.; Swindell, C.S.; Anthony, F.H.; Witman, P.A.; Devanesan, P.; Webb, N.L.; Baker, S.D.; Wolff, A.C.; Donehower, R.C. Tumor targeting by conjugation of DHA to paclitaxel. J. Control. Release 2001, 74, 233–236. [Google Scholar] [CrossRef] [PubMed]
- Moghimi, S.M.; Szebeni, J. Stealth liposomes and long circulating nanoparticles: Critical issues in pharmacokinetics, opsonization and protein-binding properties. Prog. Lipid Res. 2003, 42, 463–478. [Google Scholar] [CrossRef] [PubMed]
- Dhuria, S.V.; Hanson, L.R.; Frey, W.H., 2nd. Intranasal delivery to the central nervous system: Mechanisms and experimental considerations. J. Pharm. Sci. 2010, 99, 1654–1673. [Google Scholar] [CrossRef] [PubMed]
- Gilman, S.; Koller, M.; Black, R.S.; Jenkins, L.; Griffith, S.G.; Fox, N.C.; Eisner, L.; Kirby, L.; Rovira, M.B.; Forette, F.; et al. Clinical effects of Abeta immunization (AN1792) in patients with AD in an interrupted trial. Neurology 2005, 64, 1553–1562. [Google Scholar] [CrossRef] [PubMed]
- Aisen, P.S.; Gauthier, S.; Ferris, S.H.; Saumier, D.; Haine, D.; Garceau, D.; Duong, A.; Suhy, J.; Oh, J.; Lau, W.C.; et al. Tramiprosate in mild-to-moderate Alzheimer’s disease—A randomized, double-blind, placebo-controlled, multi-centre study (the Alphase Study). Arch. Med. Sci. 2011, 7, 102–111. [Google Scholar] [CrossRef] [PubMed]
- Moussa-Pacha, N.M.; Abdin, S.M.; Omar, H.A.; Alniss, H.; Al-Tel, T.H. BACE1 inhibitors: Current status and future directions in treating Alzheimer’s disease. Med. Res. Rev. 2020, 40, 339–384. [Google Scholar] [CrossRef] [PubMed]
- Green, R.C.; Schneider, L.S.; Amato, D.A.; Beelen, A.P.; Wilcock, G.; Swabb, E.A.; Zavitz, K.H. Effect of tarenflurbil on cognitive decline and activities of daily living in patients with mild Alzheimer disease: A randomized controlled trial. JAMA 2009, 302, 2557–2564. [Google Scholar] [CrossRef] [PubMed]
- Imbimbo, B.P.; Panza, F.; Frisardi, V.; Solfrizzi, V.; D’Onofrio, G.; Logroscino, G.; Seripa, D.; Pilotto, A. Therapeutic intervention for Alzheimer’s disease with γ-secretase inhibitors: Still a viable option? Expert Opin. Investig. Drugs 2011, 20, 325–341. [Google Scholar] [CrossRef] [PubMed]
- Dodel, R.; Rominger, A.; Bartenstein, P.; Barkhof, F.; Blennow, K.; Förster, S.; Winter, Y.; Bach, J.P.; Popp, J.; Alferink, J.; et al. Intravenous immunoglobulin for treatment of mild-to-moderate Alzheimer’s disease: A phase 2, randomised, double-blind, placebo-controlled, dose-finding trial. Lancet Neurol. 2013, 12, 233–243. [Google Scholar] [CrossRef] [PubMed]
- Doody, R.S.; Thomas, R.G.; Farlow, M.; Iwatsubo, T.; Vellas, B.; Joffe, S.; Kieburtz, K.; Raman, R.; Sun, X.; Aisen, P.S.; et al. Phase 3 trials of solanezumab for mild-to-moderate Alzheimer’s disease. N. Engl. J. Med. 2014, 370, 311–321. [Google Scholar] [CrossRef] [PubMed]
- Lannfelt, L.; Möller, C.; Basun, H.; Osswald, G.; Sehlin, D.; Satlin, A.; Logovinsky, V.; Gellerfors, P. Perspectives on future Alzheimer therapies: Amyloid-β protofibrils—A new target for immunotherapy with BAN2401 in Alzheimer’s disease. Alzheimers Res. Ther. 2014, 6, 16. [Google Scholar] [CrossRef] [PubMed]
- Boada, M.; López, O.L.; Olazarán, J.; Núñez, L.; Pfeffer, M.; Paricio, M.; Lorites, J.; Piñol-Ripoll, G.; Gámez, J.E.; Anaya, F.; et al. A randomized, controlled clinical trial of plasma exchange with albumin replacement for Alzheimer’s disease: Primary results of the AMBAR Study. Alzheimers Dement. 2020, 16, 1412–1425. [Google Scholar] [CrossRef] [PubMed]
- Al Ojaimi, Y.; Blin, T.; Lamamy, J.; Gracia, M.; Pitiot, A.; Denevault-Sabourin, C.; Joubert, N.; Pouget, J.P.; Gouilleux-Gruart, V.; Heuzé-Vourc’h, N.; et al. Therapeutic antibodies—Natural and pathological barriers and strategies to overcome them. Pharmacol. Ther. 2022, 233, 108022. [Google Scholar] [CrossRef] [PubMed]
- Xenaki, K.T.; Oliveira, S.; van Bergen En Henegouwen, P.M.P. Antibody or Antibody Fragments: Implications for Molecular Imaging and Targeted Therapy of Solid Tumors. Front. Immunol. 2017, 8, 1287. [Google Scholar] [CrossRef] [PubMed]
- Cooper, P.R.; Ciambrone, G.J.; Kliwinski, C.M.; Maze, E.; Johnson, L.; Li, Q.; Feng, Y.; Hornby, P.J. Efflux of monoclonal antibodies from rat brain by neonatal Fc receptor, FcRn. Brain Res. 2013, 1534, 13–21. [Google Scholar] [CrossRef] [PubMed]
- Garg, A.; Balthasar, J.P. Investigation of the influence of FcRn on the distribution of IgG to the brain. AAPS J. 2009, 11, 553–557. [Google Scholar] [CrossRef] [PubMed]
- Hervé, F.; Ghinea, N.; Scherrmann, J.M. CNS delivery via adsorptive transcytosis. AAPS J. 2008, 10, 455–472. [Google Scholar] [CrossRef]
- Jones, A.R.; Shusta, E.V. Blood-brain barrier transport of therapeutics via receptor-mediation. Pharm. Res. 2007, 24, 1759–1771. [Google Scholar] [CrossRef] [PubMed]
- Boado, R.J.; Zhang, Y.; Zhang, Y.; Pardridge, W.M. Humanization of anti-human insulin receptor antibody for drug targeting across the human blood-brain barrier. Biotechnol. Bioeng. 2007, 96, 381–391. [Google Scholar] [CrossRef] [PubMed]
- Pardridge, W.M. The blood-brain barrier: Bottleneck in brain drug development. NeuroRx 2005, 2, 3–14. [Google Scholar] [CrossRef] [PubMed]
- Zhou, M.; Shi, S.X.; Liu, N.; Jiang, Y.; Karim, M.S.; Vodovoz, S.J.; Wang, X.; Zhang, B.; Dumont, A.S. Caveolae-Mediated Endothelial Transcytosis across the Blood-Brain Barrier in Acute Ischemic Stroke. J. Clin. Med. 2021, 10, 3795. [Google Scholar] [CrossRef] [PubMed]
- Johnsen, K.B.; Burkhart, A.; Thomsen, L.B.; Andresen, T.L.; Moos, T. Targeting the transferrin receptor for brain drug delivery. Prog. Neurobiol. 2019, 181, 101665. [Google Scholar] [CrossRef] [PubMed]
- Gatter, K.C.; Brown, G.; Trowbridge, I.S.; Woolston, R.E.; Mason, D.Y. Transferrin receptors in human tissues: Their distribution and possible clinical relevance. J. Clin. Pathol. 1983, 36, 539–545. [Google Scholar] [CrossRef] [PubMed]
- Kawabata, H.; Germain, R.S.; Vuong, P.T.; Nakamaki, T.; Said, J.W.; Koeffler, H.P. Transferrin receptor 2-alpha supports cell growth both in iron-chelated cultured cells and in vivo. J. Biol. Chem. 2000, 275, 16618–16625. [Google Scholar] [CrossRef] [PubMed]
- Kleven, M.D.; Jue, S.; Enns, C.A. Transferrin Receptors TfR1 and TfR2 Bind Transferrin through Differing Mechanisms. Biochemistry 2018, 57, 1552–1559. [Google Scholar] [CrossRef] [PubMed]
- Lord, A.; Kalimo, H.; Eckman, C.; Zhang, X.Q.; Lannfelt, L.; Nilsson, L.N. The Arctic Alzheimer mutation facilitates early intraneuronal Abeta aggregation and senile plaque formation in transgenic mice. Neurobiol. Aging 2006, 27, 67–77. [Google Scholar] [CrossRef] [PubMed]
- Zhao, P.; Anami, Y.; Gao, P.; Fan, X.; Li, L.; Tsuchikama, K.; Zhang, N.; An, Z. Enhanced anti-angiogenetic effect of transferrin receptor-mediated delivery of VEGF-trap in a glioblastoma mouse model. mAbs 2022, 14, 2057269. [Google Scholar] [CrossRef] [PubMed]
- Edavettal, S.; Cejudo-Martin, P.; Dasgupta, B.; Yang, D.; Buschman, M.D.; Domingo, D.; Van Kolen, K.; Jaiprasat, P.; Gordon, R.; Schutsky, K.; et al. Enhanced delivery of antibodies across the blood-brain barrier via TEMs with inherent receptor-mediated phagocytosis. Med 2022, 3, 860–882.e15. [Google Scholar] [CrossRef]
- Yu, Y.J.; Atwal, J.K.; Zhang, Y.; Tong, R.K.; Wildsmith, K.R.; Tan, C.; Bien-Ly, N.; Hersom, M.; Maloney, J.A.; Meilandt, W.J.; et al. Therapeutic bispecific antibodies cross the blood-brain barrier in nonhuman primates. Sci. Transl. Med. 2014, 6, 261ra154. [Google Scholar] [CrossRef] [PubMed]
- Couch, J.A.; Yu, Y.J.; Zhang, Y.; Tarrant, J.M.; Fuji, R.N.; Meilandt, W.J.; Solanoy, H.; Tong, R.K.; Hoyte, K.; Luk, W.; et al. Addressing safety liabilities of TfR bispecific antibodies that cross the blood-brain barrier. Sci. Transl. Med. 2013, 5, 183ra157. [Google Scholar] [CrossRef] [PubMed]
- Yu, Y.J.; Zhang, Y.; Kenrick, M.; Hoyte, K.; Luk, W.; Lu, Y.; Atwal, J.; Elliott, J.M.; Prabhu, S.; Watts, R.J.; et al. Boosting brain uptake of a therapeutic antibody by reducing its affinity for a transcytosis target. Sci. Transl. Med. 2011, 3, 84ra44. [Google Scholar] [CrossRef] [PubMed]
- Johnsen, K.B.; Bak, M.; Kempen, P.J.; Melander, F.; Burkhart, A.; Thomsen, M.S.; Nielsen, M.S.; Moos, T.; Andresen, T.L. Antibody affinity and valency impact brain uptake of transferrin receptor-targeted gold nanoparticles. Theranostics 2018, 8, 3416–3436. [Google Scholar] [CrossRef] [PubMed]
- Arguello, A.; Mahon, C.S.; Calvert, M.E.K.; Chan, D.; Dugas, J.C.; Pizzo, M.E.; Thomsen, E.R.; Chau, R.; Damo, L.A.; Duque, J.; et al. Molecular architecture determines brain delivery of a transferrin receptor-targeted lysosomal enzyme. J. Exp. Med. 2022, 219, e20211057. [Google Scholar] [CrossRef] [PubMed]
- Cheng, Y.; Zak, O.; Aisen, P.; Harrison, S.C.; Walz, T. Structure of the human transferrin receptor-transferrin complex. Cell 2004, 116, 565–576. [Google Scholar] [CrossRef] [PubMed]
- Grimm, H.P.; Schumacher, V.; Schäfer, M.; Imhof-Jung, S.; Freskgård, P.O.; Brady, K.; Hofmann, C.; Rüger, P.; Schlothauer, T.; Göpfert, U.; et al. Delivery of the Brainshuttle™ amyloid-beta antibody fusion trontinemab to non-human primate brain and projected efficacious dose regimens in humans. mAbs 2023, 15, 2261509. [Google Scholar] [CrossRef] [PubMed]
- Puris, E.; Fricker, G.; Gynther, M. Targeting Transporters for Drug Delivery to the Brain: Can We Do Better? Pharm. Res. 2022, 39, 1415–1455. [Google Scholar] [CrossRef] [PubMed]
- Yang, J.; Sun, J.; Castellanos, D.M.; Pardridge, W.M.; Sumbria, R.K. Eliminating Fc N-Linked Glycosylation and Its Impact on Dosing Consideration for a Transferrin Receptor Antibody-Erythropoietin Fusion Protein in Mice. Mol. Pharm. 2020, 17, 2831–2839. [Google Scholar] [CrossRef] [PubMed]
- Sonoda, H.; Morimoto, H.; Yoden, E.; Koshimura, Y.; Kinoshita, M.; Golovina, G.; Takagi, H.; Yamamoto, R.; Minami, K.; Mizoguchi, A.; et al. A Blood-Brain-Barrier-Penetrating Anti-human Transferrin Receptor Antibody Fusion Protein for Neuronopathic Mucopolysaccharidosis II. Mol. Ther. 2018, 26, 1366–1374. [Google Scholar] [CrossRef] [PubMed]
- Kariolis, M.S.; Wells, R.C.; Getz, J.A.; Kwan, W.; Mahon, C.S.; Tong, R.; Kim, D.J.; Srivastava, A.; Bedard, C.; Henne, K.R.; et al. Brain delivery of therapeutic proteins using an Fc fragment blood-brain barrier transport vehicle in mice and monkeys. Sci. Transl. Med. 2020, 12, eaay1359. [Google Scholar] [CrossRef] [PubMed]
- Gabathuler, R. Approaches to transport therapeutic drugs across the blood-brain barrier to treat brain diseases. Neurobiol. Dis. 2010, 37, 48–57. [Google Scholar] [CrossRef] [PubMed]
- Torchilin, V.P. Multifunctional, stimuli-sensitive nanoparticulate systems for drug delivery. Nat. Rev. Drug Discov. 2014, 13, 813–827. [Google Scholar] [CrossRef] [PubMed]
- Ducry, L.; Stump, B. Antibody-drug conjugates: Linking cytotoxic payloads to monoclonal antibodies. Bioconjug. Chem. 2010, 21, 5–13. [Google Scholar] [CrossRef] [PubMed]
- Beck, A.; Goetsch, L.; Dumontet, C.; Corvaïa, N. Strategies and challenges for the next generation of antibody-drug conjugates. Nat. Rev. Drug Discov. 2017, 16, 315–337. [Google Scholar] [CrossRef] [PubMed]
- Hamblett, K.J.; Senter, P.D.; Chace, D.F.; Sun, M.M.; Lenox, J.; Cerveny, C.G.; Kissler, K.M.; Bernhardt, S.X.; Kopcha, A.K.; Zabinski, R.F.; et al. Effects of drug loading on the antitumor activity of a monoclonal antibody drug conjugate. Clin. Cancer Res. 2004, 10, 7063–7070. [Google Scholar] [CrossRef] [PubMed]
- Poreba, M. Protease-activated prodrugs: Strategies, challenges, and future directions. FEBS J. 2020, 287, 1936–1969. [Google Scholar] [CrossRef] [PubMed]
- Alas, M.; Saghaeidehkordi, A.; Kaur, K. Peptide-Drug Conjugates with Different Linkers for Cancer Therapy. J. Med. Chem. 2021, 64, 216–232. [Google Scholar] [CrossRef] [PubMed]
- Anami, Y.; Yamazaki, C.M.; Xiong, W.; Gui, X.; Zhang, N.; An, Z.; Tsuchikama, K. Glutamic acid–valine–citrulline linkers ensure stability and efficacy of antibody–drug conjugates in mice. Nat. Commun. 2018, 9, 2512. [Google Scholar] [CrossRef] [PubMed]
- Kern, H.B.; Srinivasan, S.; Convertine, A.J.; Hockenbery, D.; Press, O.W.; Stayton, P.S. Enzyme-Cleavable Polymeric Micelles for the Intracellular Delivery of Proapoptotic Peptides. Mol. Pharm. 2017, 14, 1450–1459. [Google Scholar] [CrossRef] [PubMed]
- Zhong, Y.J.; Shao, L.H.; Li, Y. Cathepsin B-cleavable doxorubicin prodrugs for targeted cancer therapy (Review). Int. J. Oncol. 2013, 42, 373–383. [Google Scholar] [CrossRef] [PubMed]
- Yoon, M.C.; Phan, V.; Podvin, S.; Mosier, C.; O’Donoghue, A.J.; Hook, V. Distinct Cleavage Properties of Cathepsin B Compared to Cysteine Cathepsins Enable the Design and Validation of a Specific Substrate for Cathepsin B over a Broad pH Range. Biochemistry 2023, 62, 2289–2300. [Google Scholar] [CrossRef] [PubMed]
- Thomsen, M.S.; Johnsen, K.B.; Kucharz, K.; Lauritzen, M.; Moos, T. Blood–Brain Barrier Transport of Transferrin Receptor-Targeted Nanoparticles. Pharmaceutics 2022, 14, 2237. [Google Scholar] [CrossRef] [PubMed]
- Ban, W.; You, Y.; Yang, Z. Imaging Technologies for Cerebral Pharmacokinetic Studies: Progress and Perspectives. Biomedicines 2022, 10, 2447. [Google Scholar] [CrossRef] [PubMed]
- Marathe, P.H.; Shyu, W.C.; Humphreys, W.G. The use of radiolabeled compounds for ADME studies in discovery and exploratory development. Curr. Pharm. Des. 2004, 10, 2991–3008. [Google Scholar] [CrossRef] [PubMed]
- Arndt, J.W.; Qian, F.; Smith, B.A.; Quan, C.; Kilambi, K.P.; Bush, M.W.; Walz, T.; Pepinsky, R.B.; Bussière, T.; Hamann, S.; et al. Structural and kinetic basis for the selectivity of aducanumab for aggregated forms of amyloid-β. Sci. Rep. 2018, 8, 6412. [Google Scholar] [CrossRef] [PubMed]
- Niazi, S.K. Non-Invasive Drug Delivery across the Blood-Brain Barrier: A Prospective Analysis. Pharmaceutics 2023, 15, 2599. [Google Scholar] [CrossRef] [PubMed]
- FDA. Peripheral and Central Nervous System Drugs Advisory Committee; Notice of Meeting; Establishment of a Public Docket; Request for Comments-Biologics License Application 761248, for Donanemab Solution for Intravenous Infusion; FDA, 2024. Available online: https://www.federalregister.gov/documents/2024/05/08/2024-10051/peripheral-and-central-nervous-system-drugs-advisory-committee-notice-of-meeting-establishment-of-a (accessed on 7 March 2024).
Antibody (Structure or Part) | IgG Subclass | Sequence Targeted | Aβ Conformation Specificity | Highest Trial Phase Completed |
---|---|---|---|---|
Bapineuzumab PDB 4OJF Fab complexed to amyloid beta 1–8 [61] | IgG1 (humanized mouse mAb 3D6) | Aβ1–5 | Monomers, oligomers, fibrils | III, failed |
Solanezumab (PDB 4XXD; Kegg D10058) [62] | IgG1 (humanized mouse mAb m266) | Aβ16–26 | Monomers | III, failed |
Crenezumab (PDB 5VZX; Kegg D10101) [63] | IgG4 (humanized) | Aβ13–24 | Monomers | III, failed |
Gantenerumab (PDB 5CSZ; Kegg D09713) [63] | Human IgG1 | Aβ2–11 and Aβ18–27 | Oligomers, fibrils | III, failed |
Aducanumab (PDB Fabs complex to Aβ 8azs; 6CNR; 6CO3; KEGG 10541; | Human IgG1: human-derived monoclonal antibody | Aβ3–7 | Oligomers, fibrils | Approved and withdrawn |
Lecanemab (PDB 8AZU; KEGG D11678 [60] | IgG1 (humanized mouse mAb158) | Aβ1–16 | Oligomers, protofibrils, fibrils | Approved |
Donanemab (PDB 7CM0; KEGG D11500) [60] | Humanized IgG1 (developed from mouse IgG2a mE8) | Aβ3–42 | Fibrils | III; halted at FDA |
Cinpanemab (PDB 6CT7; KEGG D 11467) [60] | Human IgG1 human-derived monoclonal antibody against α-synuclein | α-synuclein residues 1–10; 800× affinity for aggregate | Monomer, aggregates | III halted by the developer |
Gantenerumab PDB 5CSZ Fragment in complex with Aβ1–11; KEGG D09713 (heavy chain only) [60] | Human IgG1 human-derived monoclonal antibody against Aβ | Aggregated beta-amyloid fibers. | Fibrils | III, failed |
Semorinemab, RO7105705 [64,65] | IgG4 monoclonal antibody against Aβ | Anti-Tau | Tau-isoforms | II |
Tilavonemab [66] | IgG4 monoclonal antibody against Aβ | Anti-Tau | Tau-isoforms | II |
ABBV-8E12 [67] | IgG4 monoclonal antibody against Aβ | Anti-Tau | Tau-isoforms | II |
AN179, [68,69] | IgG4 monoclonal antibody against Aβ 42 | Anti-Aβ4 | Monomer, aggregates | Discontinued after Phase 2 |
Antibody Type | Molecular Weight (kDa) | Molecular Size (nm) | Disposition Half-Life |
---|---|---|---|
Whole IgG | ~150 | 10–15 | 21 days (average) * |
F(ab’)2 fragment | ~110 | 5–10 | 1 week (approx.) |
Minibody (scFv-CH) | ~80 | 4–8 | 1–3 days (approx.) |
rIgG | ~75 | 5–8 | 1–3 days (approx.) |
Fab fragment | ~50 | 3.5–4.5 | 1–2 days (approx.) |
Diabody | ~50–60 | 2–3 | Hours to 1 day |
Single-chain variable fragment (scFv) | ~25–30 | 2–3 | Hours |
Nanobody (sdAb) | ~12–15 | 1.5–2.5 | Hours to 1 day |
1SUV_1|Chains A, B|Transferrin Receptor Protein 1|Homo Sapiens (9606) |
---|
LYWDDLKRKLSEKLDSTDFTSTIKLLNENSYVPREAGSQKDENLALYVENEFREFKLSKVWRDQHFVKIQVKDSAQNSVIIVDKNGRLVYLVENPGGYVAYSKAATVTGKLVHANFGTKKDFEDLYTPVNGSIVIVRAGKITFAEKVANAESLNAIGVLIYMDQTKFPIVNAELSFFGHAHLGTGDPYTPGFPSFNHTQFPPSRSSGLPNIPVQTISRAAAEKLFGNMEGDCPSDWKTDSTCRMVTSESKNVKLTVSNVLKEIKILNIFGVIKGFVEPDHYVVVGAQRDAWGPGAAKSGVGTALLLKLAQMFSDMVLKDGFQPSRSIIFASWSAGDFGSVGATEWLEGYLSSLHLKAFTYINLDKAVLGTSNFKVSASPLLYTLIEKTMQNVKHPVTGQFLYQDSNWASKVEKLTLDNAAFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDTYKELIERIPELNKVARAAAEVAGQFVIKLTHDVELNLDYEEYNSQLLSFVRDLNQYRADIKEMGLSLQWLYSARGDFFRATSRLTTDFGNAEKTDRFVMKKLNDRVMRVEYHFLSPYVSPKESPFRHVFWGSGSHTLPALLENLKLRKQNNGAFNETLFRNQLALATWTIQGAANALSGDVWDIDNEF |
1SUV_2|Chains C, D|Serotransferrin, N-lobe|Homo sapiens (9606) |
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC |
1SUV_3|Chains E, F|Serotransferrin, C-lobe|Homo sapiens (9606) |
PDPLQDECKAVKWCALGHHERLKCDEWSVTSGGLIECESAETPEDCIAKIMNGEADAMSLDGGYVYIAGQCGLVPVLAENYESTDCKKAPEEGYLSVAVVKKSNPDINWNNLEGKKSCHTAVDRTAGWNIPMGLLYNRINHCRFDEFFRQGCAPGSQKNSSLCELCVGPSVCAPNNREGYYGYTGAFRCLVEKGDVAFVKSQTVLQNTGGRNSEPWAKDLKEEDFELLCLDGTRKPVSEAHNCHLAKAPNHAVVSRKDKAACVKQKLLDLQVEFGNTVADCSSKFCMFHSKTKDLLFRDDTKCLVDLRGKNTYEKYLGADYIKAVSNLRKCSTSRLLEACTFHKH |
Protein–Protein Complex | ΔG (kcal mol−1) | Kd (M) at °C | ICs Charged–Charged | ICs Charged–Polar | ICs Charged–Apolar | ICs Polar–Polar | ICs Polar–Apolar | ICs Apolar–Apolar | NIS Charged | NIS Apolar |
---|---|---|---|---|---|---|---|---|---|---|
Aducanumab–Abeta | −18.1 | 5.10 × 10−14 | 22 | 20 | 64 | 1 | 19 | 29 | 21.2 | 40.1 |
Transferrin–(G4S)–Aducanumab–Abeta | −21.3 | 2.60 × 10−16 | 39 | 27 | 83 | 1 | 18 | 43 | 28.5 | 35.5 |
Transferrin–(G4S)3–Aducanumab–Abeta | −29.2 | 4.10 × 10−22 | 32 | 33 | 136 | 7 | 38 | 79 | 28.9 | 35.7 |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Niazi, S.K.; Mariam, Z.; Magoola, M. Engineered Antibodies to Improve Efficacy against Neurodegenerative Disorders. Int. J. Mol. Sci. 2024, 25, 6683. https://doi.org/10.3390/ijms25126683
Niazi SK, Mariam Z, Magoola M. Engineered Antibodies to Improve Efficacy against Neurodegenerative Disorders. International Journal of Molecular Sciences. 2024; 25(12):6683. https://doi.org/10.3390/ijms25126683
Chicago/Turabian StyleNiazi, Sarfaraz K., Zamara Mariam, and Matthias Magoola. 2024. "Engineered Antibodies to Improve Efficacy against Neurodegenerative Disorders" International Journal of Molecular Sciences 25, no. 12: 6683. https://doi.org/10.3390/ijms25126683