Genomic Surveillance of Rabies Virus in Georgian Canines
Abstract
:1. Introduction
2. Materials and Methods
2.1. Biosafety Precautions
2.2. Collection of Brain Tissue from Suspected Rabid Dogs and Jackals in Georgia
2.3. RNA Purification and Degenerate PCR Amplification and Sequencing of the Lyssavirus N Gene
2.4. Shotgun Sequencing of Total RNA Samples
2.5. Sequencing-Data Processing and Genome Assembly
2.6. Analysis of Heterozygous Single Nucleotide Variants (SNVs)
2.7. Phylogenetic Analysis
2.8. Sequence Analysis of the G Glycoprotein Ectodomain
2.9. Principal Components Analysis (PCA) of Ectodomain Group and Geographic Origin of Samples
2.10. Clustering of RABV Genomes and RABV Protein Sequences
2.11. Alignment of Clustered RABV Amino Acid Sequences
2.12. Analysis of Predicted Epitopes for RABV-GEO P, M, L Proteins
2.13. RABV Isolation and Neutralization with mAb A6
3. Results
3.1. PCR Screening and Sequencing of N genes of Georgian Canine Brain Tissue Isolates
3.2. Sequencing and Assembly of Seventy-Seven Complete Georgian RABV Genomes
3.3. Phylogeny of the Newly Identified RABV Genomes
3.4. Clustering Analysis of RABV Full-Length Genomes
3.5. Amino Acid Sequence Variability in the RABV G Ectodomain
3.6. Global Sequence Variability of RABV Proteins
3.7. Epitopes in RABV-GEO P, M, and L Proteins
3.8. Neutralization of RABV Isolates by mAb A6
4. Discussion
Supplementary Materials
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Hampson, K.; Coudeville, L.; Lembo, T.; Sambo, M.; Kieffer, A.; Attlan, M.; Barrat, J.; Blanton, J.D.; Briggs, D.J.; Cleaveland, S.; et al. Estimating the global burden of endemic canine rabies. PLoS Neglect. Trop. Dis. 2015, 9, e0003709. [Google Scholar] [CrossRef]
- Shwiff, S.; Hampson, K.; Anderson, A. Potential economic benefits of eliminating canine rabies. Antivir. Res. 2013, 98, 352–356. [Google Scholar] [CrossRef]
- Knobel, D.L.; Jackson, A.C.; Bingham, J.; Ertl, H.C.J.; Gibson, A.D.; Hughes, D.; Joubert, K.; Mani, R.S.; Mohr, B.J.; Moore, S.M.; et al. A One Medicine Mission for an Effective Rabies Therapy. Front. Veter-Sci. 2022, 9, 867382. [Google Scholar] [CrossRef]
- Benavides, J.A.; Valderrama, W.; Recuenco, S.; Uieda, W.; Suzán, G.; Avila-Flores, R.; Velasco-Villa, A.; Almeida, M.; de Andrade, F.A.; Molina-Flores, B.; et al. Defining New Pathways to Manage the Ongoing Emergence of Bat Rabies in Latin America. Viruses 2020, 12, 1002. [Google Scholar] [CrossRef] [PubMed]
- Acharya, K.P.; Chand, R.; Huettmann, F.; Ghimire, T.R. Rabies Elimination: Is It Feasible without Considering Wildlife? J. Trop. Med. 2022, 2022, 5942693. [Google Scholar] [CrossRef]
- Tidman, R.; Fahrion, A.S.; Thumbi, S.M.; Wallace, R.M.; De Balogh, K.; Iwar, V.; Yale, G.; Dieuzy-Labaye, I. United Against Rabies Forum: The first 2 years. Front. Public Health 2023, 11, 1010071. [Google Scholar] [CrossRef]
- Robardet, E.; Bosnjak, D.; Englund, L.; Demetriou, P.; Martín, P.R.; Cliquet, F. Zero Endemic Cases of Wildlife Rabies (Classical Rabies Virus, RABV) in the European Union by 2020: An Achievable Goal. Trop. Med. Infect. Dis. 2019, 4, 124. [Google Scholar] [CrossRef]
- Lojkić, I.; Šimić, I.; Bedeković, T.; Krešić, N. Current Status of Rabies and Its Eradication in Eastern and Southeastern Europe. Pathogens 2021, 10, 742. [Google Scholar] [CrossRef]
- Müller, F.T.; Freuling, C. Rabies control in Europe: An overview of past, current and future strategies. Rev. Sci. Tech. 2018, 37, 409–419. [Google Scholar] [CrossRef]
- Rupprecht, C.E.; Bannazadeh Baghi, H.; Del Rio Vilas, V.J.; Gibson, A.D.; Lohr, F.; Meslin, F.X.; Seetahal, J.F.R.; Shervell, K.; Gamble, L. Historical, current and expected future occurrence of rabies in enzootic regions. Rev. Sci. Tech. 2018, 37, 729–739. [Google Scholar] [CrossRef]
- Taylor, E.; Del Rio Vilas, V.; Scott, T.; Coetzer, A.; Prada, J.M.; Alireza, G.; Alqadi, N.A.; Berry, A.; Bazzal, B.; Barkia, A.; et al. Rabies in the Middle East, Eastern Europe, Central Asia and North Africa: Building evidence and delivering a regional approach to rabies elimination. J. Infect. Public Health 2021, 14, 787–794. [Google Scholar] [CrossRef] [PubMed]
- Fisher, C.R.; Streicker, D.G.; Schnell, M.J. The spread and evolution of rabies virus: Conquering new frontiers. Nat. Rev. Microbiol. 2018, 16, 241–255. [Google Scholar] [CrossRef] [PubMed]
- Scott, T.P.; Nel, L.H. Lyssaviruses and the Fatal Encephalitic Disease Rabies. Front. Immunol. 2021, 12, 786953. [Google Scholar] [CrossRef] [PubMed]
- Brunker, K.; Nadin-Davis, S.; Biek, R. Genomic sequencing, evolution and molecular epidemiology of rabies virus. Rev. Sci. Tech. 2018, 37, 401–408. [Google Scholar] [CrossRef]
- Holmes, E.C. The phylogeography of human viruses. Mol. Ecol. 2004, 13, 745–756. [Google Scholar] [CrossRef]
- Bourhy, H.; Reynes, J.-M.; Dunham, E.J.; Dacheux, L.; Larrous, F.; Huong, V.T.Q.; Xu, G.; Yan, J.; Miranda, M.E.G.; Holmes, E.C. The origin and phylogeography of dog rabies virus. J. Gen. Virol. 2008, 89, 2673–2681. [Google Scholar] [CrossRef]
- Troupin, C.; Dacheux, L.; Tanguy, M.; Sabeta, C.; Blanc, H.; Bouchier, C.; Vignuzzi, M.; Duchene, S.; Holmes, E.C.; Bourhy, H. Large-Scale Phylogenomic Analysis Reveals the Complex Evolutionary History of Rabies Virus in Multiple Carnivore Hosts. PLoS Pathog. 2016, 12, e1006041. [Google Scholar] [CrossRef]
- Campbell, K.; Gifford, R.J.; Singer, J.; Hill, V.; O’toole, A.; Rambaut, A.; Hampson, K.; Brunker, K. Making genomic surveillance deliver: A lineage classification and nomenclature system to inform rabies elimination. PLoS Pathog. 2022, 18, e1010023. [Google Scholar] [CrossRef]
- Bacus, M.G.; Buenaventura, S.G.C.; Mamites, A.M.C.; Elizagaque, H.G.; Labrador, C.C.; Delfin, F.C.; Eng, M.N.J.; Lagare, A.P.; Marquez, G.N.; Murao, L.A.E. Genome-based local dynamics of canine rabies virus epidemiology, transmission, and evolution in Davao City, Philippines, 2018–2019. Infect. Genet. Evol. 2021, 92, 104868. [Google Scholar] [CrossRef]
- Dellicour, S.; Troupin, C.; Jahanbakhsh, F.; Salama, A.; Massoudi, S.; Moghaddam, M.K.; Baele, G.; Lemey, P.; Gholami, A.; Bourhy, H. Using phylogeographic approaches to analyse the dispersal history, velocity and direction of viral lineages—Application to rabies virus spread in Iran. Mol. Ecol. 2019, 28, 4335–4350. [Google Scholar] [CrossRef]
- Tabatadze, L.; Gabashvili, E.; Kobakhidze, S.; Lomidze, G.; Loladze, J.; Tsitskishvili, L.; Kotetishvili, M. Evolutionary analysis of rabies virus isolates from Georgia. Arch. Virol. 2022, 167, 2293–2298. [Google Scholar] [CrossRef] [PubMed]
- Meechan, P.J.; Potts, J. Biosafety in Microbiological and Biomedical Laboratories, 6th ed.; U.S. Department of Health and Human Services: Washington, DC, USA, 2020. [Google Scholar]
- Heaton, P.R.; Johnstone, P.; McElhinney, L.M.; Cowley, R.; O’Sullivan, E.; Whitby, J.E. Heminested PCR assay for detection of six genotypes of rabies and rabies-related viruses. J. Clin. Microbiol. 1997, 35, 2762–2766. [Google Scholar] [CrossRef] [PubMed]
- Bushnell, B. BBMap: A Fast, Accurate, Splice-Aware Aligner. In Proceedings of the Conference: 9th Annual Genomics of Energy & Environment Meeting, Walnut Creek, CA, USA, 17–20 March 2014. [Google Scholar]
- Shen, W.; Ren, H. TaxonKit: A practical and efficient NCBI taxonomy toolkit. J. Genet. Genom. 2021, 48, 844–850. [Google Scholar] [CrossRef] [PubMed]
- Nurk, S.; Meleshko, D.; Korobeynikov, A.; Pevzner, P.A. metaSPAdes: A new versatile metagenomic assembler. Genome Res. 2017, 27, 824–834. [Google Scholar] [CrossRef]
- Wick, R.R.; Schultz, M.B.; Zobel, J.; Holt, K.E. Bandage: Interactive visualization of de novo genome assemblies. Bioinformatics 2015, 31, 3350–3352. [Google Scholar] [CrossRef]
- Wick, R.R.; Judd, L.M.; Gorrie, C.L.; Holt, K.E. Unicycler: Resolving bacterial genome assemblies from short and long sequencing reads. PLoS Comput. Biol. 2017, 13, e1005595. [Google Scholar] [CrossRef]
- Kalyaanamoorthy, S.; Minh, B.Q.; Wong, T.K.F.; Von Haeseler, A.; Jermiin, L.S. ModelFinder: Fast model selection for accurate phylogenetic estimates. Nat. Methods 2017, 14, 587–589. [Google Scholar] [CrossRef]
- Minh, B.Q.; Schmidt, H.A.; Chernomor, O.; Schrempf, D.; Woodhams, M.D.; von Haeseler, A.; Lanfear, R. IQ-TREE 2: New Models and Efficient Methods for Phylogenetic Inference in the Genomic Era. Mol. Biol. Evol. 2020, 37, 1530–1534. [Google Scholar] [CrossRef]
- Hoang, D.T.; Chernomor, O.; Von Haeseler, A.; Minh, B.Q.; Vinh, L.S. UFBoot2: Improving the Ultrafast Bootstrap Approximation. Mol. Biol. Evol. 2018, 35, 518–522. [Google Scholar] [CrossRef]
- Rambaut, A. FigTree. Available online: http://tree.bio.ed.ac.uk/software/figtree/ (accessed on 13 February 2023).
- Wheeler, D.L.; Barrett, T.; Benson, D.A.; Bryant, S.H.; Canese, K.; Chetvernin, V.; Church, D.M.; DiCuccio, M.; Edgar, R.; Federhen, S.; et al. Database resources of the National Center for Biotechnology Information. Nucleic Acids Res. 2008, 36, D13–D21. [Google Scholar] [CrossRef]
- Madeira, F.; Pearce, M.; Tivey, A.R.N.; Basutkar, P.; Lee, J.; Edbali, O.; Madhusoodanan, N.; Kolesnikov, A.; Lopez, R. Search and sequence analysis tools services from EMBL-EBI in 2022. Nucleic Acids Res. 2022, 50, W276–W279. [Google Scholar] [CrossRef]
- Lai, C.Y.; Dietzschold, B. Amino acid composition and terminal sequence analysis of the rabies virus glycoprotein: Identification of the reading frame on the cDNA sequence. Biochem. Biophys. Res. Commun. 1981, 103, 536–542. [Google Scholar] [CrossRef]
- Yang, F.; Lin, S.; Ye, F.; Yang, J.; Qi, J.; Chen, Z.; Lin, X.; Wang, J.; Yue, D.; Cheng, Y.; et al. Structural Analysis of Rabies Virus Glycoprotein Reveals pH-Dependent Conformational Changes and Interactions with a Neutralizing Antibody. Cell Host Microbe 2020, 27, 441–453.e7. [Google Scholar] [CrossRef]
- R Core Team. R: A Language and Environment for Statistical Computing; R Foundation for Statistical Computing: Vienna, Austria, 2022. [Google Scholar]
- Wickham, H. ggplot2: Elegant Graphics for Data Analysis; Springer: New York, NY, USA, 2016. [Google Scholar]
- Benson, D.A.; Karsch-Mizrachi, I.; Lipman, D.J.; Ostell, J.; Rapp, B.A.; Wheeler, D.L. GenBank. Nucleic Acids Res. 2000, 28, 15–18. [Google Scholar] [CrossRef]
- Steinegger, M.; Söding, J. MMseqs2 enables sensitive protein sequence searching for the analysis of massive data sets. Nat. Biotechnol. 2017, 35, 1026–1028. [Google Scholar] [CrossRef] [PubMed]
- Mistry, J.; Chuguransky, S.; Williams, L.; Qureshi, M.; Salazar, G.A.; Sonnhammer, E.L.L.; Tosatto, S.C.E.; Paladin, L.; Raj, S.; Richardson, L.J.; et al. Pfam: The protein families database in 2021. Nucleic Acids Res. 2021, 49, D412–D419. [Google Scholar] [CrossRef] [PubMed]
- Dhanda, S.K.; Mahajan, S.; Paul, S.; Yan, Z.; Kim, H.; Jespersen, M.C.; Jurtz, V.; Andreatta, M.; Greenbaum, J.A.; Marcatili, P.; et al. IEDB-AR: Immune epitope database—Analysis resource in 2019. Nucleic Acids Res. 2019, 47, W502–W506. [Google Scholar] [CrossRef] [PubMed]
- Olson, R.D.; Assaf, R.; Brettin, T.; Conrad, N.; Cucinell, C.; Davis, J.J.; Dempsey, D.M.; Dickerman, A.; Dietrich, E.M.; Kenyon, R.W.; et al. Introducing the Bacterial and Viral Bioinformatics Resource Center (BV-BRC): A resource combining PATRIC, IRD and ViPR. Nucleic Acids Res. 2022, 51, D678–D689. [Google Scholar] [CrossRef]
- Weir, D.L.; Coggins, S.A.; Vu, B.K.; Coertse, J.; Yan, L.; Smith, I.L.; Laing, E.D.; Markotter, W.; Broder, C.C.; Schaefer, B.C. Isolation and Characterization of Cross-Reactive Human Monoclonal Antibodies That Potently Neutralize Australian Bat Lyssavirus Variants and Other Phylogroup 1 Lyssaviruses. Viruses 2021, 13, 391. [Google Scholar] [CrossRef] [PubMed]
- Tordo, N.; Kouknetzoff, A. The rabies virus genome: An overview. Onderstepoort J. Veter-Res. 1993, 60, 263–269. [Google Scholar]
- Tordo, N.; Badrane, H.; Bourhy, H.; Sacramento, D. Molecular epidemiology of lyssaviruses: Focus on the glycoprotein and pseudogenes. Onderstepoort J. Veter-Res. 1993, 60, 315–323. [Google Scholar]
- Badrane, H.; Bahloul, C.; Perrin, P.; Tordo, N. Evidence of Two Lyssavirus Phylogroups with Distinct Pathogenicity and Immunogenicity. J. Virol. 2001, 75, 3268–3276. [Google Scholar] [CrossRef] [PubMed]
- Wunner, W.H.; Larson, J.K.; Dietzschold, B.; Smith, C.L. The Molecular Biology of Rabies Viruses. Rev. Infect. Dis. 1988, 10 (Suppl. S4), S771–S784. [Google Scholar] [CrossRef] [PubMed]
- Dietzschold, B.; Tollis, M.; Lafon, M.; Wunner, W.H.; Koprowski, H. Mechanisms of rabies virus neutralization by glycoprotein-specific monoclonal antibodies. Virology 1987, 161, 29–36. [Google Scholar] [CrossRef]
- Liu, J.; Zhao, W.; He, W.; Wang, N.; Su, J.; Ji, S.; Chen, J.; Wang, D.; Zhou, J.; Su, S. Generation of Monoclonal Antibodies against Variable Epitopes of the M Protein of Rabies Virus. Viruses 2019, 11, 375. [Google Scholar] [CrossRef]
- Zhao, W.; Su, J.; Zhao, N.; Liu, J.; Su, S. Development of Monoclonal Antibodies for Detection of Conserved and Variable Epitopes of Large Protein of Rabies Virus. Viruses 2021, 13, 220. [Google Scholar] [CrossRef]
- Jiang, Y.; Luo, Y.; Michel, F.; Hogan, R.J.; He, Y.; Fu, Z.F. Characterization of conformation-specific monoclonal antibodies against rabies virus nucleoprotein. Arch. Virol. 2010, 155, 1187–1192. [Google Scholar] [CrossRef]
- Du Pont, V.; Plemper, R.K.; Schnell, M.J. Status of antiviral therapeutics against rabies virus and related emerging lyssaviruses. Curr. Opin. Virol. 2019, 35, 1–13. [Google Scholar] [CrossRef]
- Lushasi, K.; Hayes, S.; Ferguson, E.A.; Changalucha, J.; Cleaveland, S.; Govella, N.J.; Haydon, D.T.; Sambo, M.; Mchau, G.J.; Mpolya, E.A.; et al. Reservoir dynamics of rabies in south-east Tanzania and the roles of cross-species transmission and domestic dog vaccination. J. Appl. Ecol. 2021, 58, 2673–2685. [Google Scholar] [CrossRef]
- Mogano, K.; Suzuki, T.; Mohale, D.; Phahladira, B.; Ngoepe, E.; Kamata, Y.; Chirima, G.; Sabeta, C.; Makita, K. Spatio-temporal epidemiology of animal and human rabies in northern South Africa between 1998 and 2017. PLoS Negl. Trop. Dis. 2022, 16, e0010464. [Google Scholar] [CrossRef] [PubMed]
- Lanszki, J.; Hayward, M.W.; Ranc, N.; Zalewski, A. Dietary flexibility promotes range expansion: The case of golden jackals in Eurasia. J. Biogeogr. 2022, 49, 993–1005. [Google Scholar] [CrossRef]
- Horton, D.L.; McElhinney, L.M.; Freuling, C.M.; Marston, D.A.; Banyard, A.C.; Goharrriz, H.; Wise, E.; Breed, A.C.; Saturday, G.; Kolodziejek, J.; et al. Complex Epidemiology of a Zoonotic Disease in a Culturally Diverse Region: Phylogeography of Rabies Virus in the Middle East. PLoS Negl. Trop. Dis. 2015, 9, e0003569. [Google Scholar] [CrossRef] [PubMed]
- Zhao, J.; Wang, S.; Zhang, S.; Liu, Y.; Zhang, J.; Zhang, F.; Mi, L.; Hu, R. Molecular characterization of a rabies virus isolate from a rabid dog in Hanzhong District, Shaanxi Province, China. Arch. Virol. 2013, 159, 1481–1486. [Google Scholar] [CrossRef] [PubMed]
- Tohma, K.; Saito, M.; Kamigaki, T.; Tuason, L.T.; Demetria, C.S.; Orbina, J.R.C.; Manalo, D.L.; Miranda, M.E.; Noguchi, A.; Inoue, S.; et al. Phylogeographic analysis of rabies viruses in the Philippines. Infect. Genet. Evol. 2014, 23, 86–94. [Google Scholar] [CrossRef]
- Kuzmina, N.A.; Kuzmin, I.V.; Ellison, J.A.; Rupprecht, C.E. Conservation of Binding Epitopes for Monoclonal Antibodies on the Rabies Virus Glycoprotein. J. Antivir. Antiretrovir. 2013, 5, 037–043. [Google Scholar] [CrossRef]
- Dietzschold, B.; Gore, M.; Casali, P.; Ueki, Y.; Rupprecht, C.E.; Notkins, A.L.; Koprowski, H. Biological characterization of human monoclonal antibodies to rabies virus. J. Virol. 1990, 64, 3087–3090. [Google Scholar] [CrossRef]
- Lafay, F.; Benmansour, A.; Chebli, K.; Flamand, A. Immunodominant epitopes defined by a yeast-expressed library of random fragments of the rabies virus glycoprotein map outside major antigenic sites. J. Gen. Virol. 1996, 77 Pt 2, 339–346. [Google Scholar] [CrossRef]
- de Melo, G.D.; Hellert, J.; Gupta, R.; Corti, D.; Bourhy, H. Monoclonal antibodies against rabies: Current uses in prophylaxis and in therapy. Curr. Opin. Virol. 2022, 53, 101204. [Google Scholar] [CrossRef]
- de Melo, G.D.; Sonthonnax, F.; Lepousez, G.; Jouvion, G.; Minola, A.; Zatta, F.; Larrous, F.; Kergoat, L.; Mazo, C.; Moigneu, C.; et al. A combination of two human monoclonal antibodies cures symptomatic rabies. EMBO Mol. Med. 2020, 12, e12628. [Google Scholar] [CrossRef]
- Müller, T.; Demetriou, P.; Moynagh, J.; Cliquet, F.; Fooks, A.; Conraths, F.; Mettenleiter, T.; Freuling, C. Rabies elimination in Europe: A success story. In Proceedings of the Rabies Control: Towards Sustainable Prevention at the Source, Compendium of the OIE Global Conf. on Rabies Control, Incheon-Seoul, Republic of Korea, 7–9 September 2011; pp. 31–44. [Google Scholar]
Protein | Number of Sequences from NCBI | RABV-GEO Sequences | Number of Clusters | Number of Clusters Containing RABV-GEO Samples |
---|---|---|---|---|
N | 7489 | 77 | 2 | 1 |
P | 2579 | 77 | 9 | 1 |
M | 2178 | 77 | 4 | 1 |
G | 5915 | 77 | 5 | 1 |
L | 2948 | 77 | 5 | 1 |
Epitope ID | Epitope Sequence | Difference in Representative Sequence (If Relevant, Colored Red and Bold) | Protein Name | Protein ID | Protein Accession | Start | End |
---|---|---|---|---|---|---|---|
1336019 | EIFSIP | - | L | ADJ29912.1 | P11213 | 1479 | 1484 |
1336142 | RALSK | - | L | ADJ29912.1 | P11213 | 1659 | 1663 |
1336215 | VFNSL | - | L | ADJ29912.1 | P11213 | 1724 | 1728 |
93714 | RKLGWWLKL | not present in representative sequence set | L | SRC266014 | P11213 | ||
929568 | PPDDD | - | M | CEH11416.1 | P08671 | 42 | 46 |
929569 | PPYDDD | not present in representative sequence set | M | ADJ29910.1 | P08671 | 25 | 30 |
12638 | EKDDLSVEAEIAHQIA | EEDDLSVEAEIAHQIA | P | P69479.1 | P06747 | 191 | 206 |
1795 | AHLQGEPIEVDNLPEDMKRLQLDDKKPSGL | AHLQGEPIEVDNLPEDMRRLNLDDGKSPNL | P | AAK54996.1 | P06747 | 37 | 66 |
20735 | GKYREDFQMDEGDPS | GKYREDFQMDEGEDP | P | SRC279966 | P06747 | ||
23111 | GVQIVRQIRSGERFLKIWSQ | GVQIVRQMRSGERFLKIWSQ | P | NP_056794.1 | P06747 | 101 | 120 |
31389 | KIPLRCVLGWVALANSKKFQLLVEADKLSKIMQDDLNRYTSC | KLPLRCVLGWVALANSKKFQLLVEADKLSRIMQDDLNRYASS | P | AAZ07892.1 | P06747 | 256 | 297 |
31531 | KKETTSISSQRDSQSSKA | KKETTSTPSQRESQSSKA | P | AAK54996.1 | P06747 | 154 | 171 |
38005 | LMDEGEDPSLLFQSYLDNVGVQIVRQMRSGER | QMDEGEDPSLLFQSYLDNVGVQIVRQMRSGER | P | AAK54996.1 | P06747 | 82 | 113 |
451183 | VLGWV | - | P | AAK55085.1 | P06747 | 262 | 266 |
53736 | RFLKIWSQTVEEIISYVAVN | RFLKIWSQTVEEIISYVTVN | P | P69479.1 | P06747 | 113 | 132 |
59254 | SLLFQSYLDNVGVQIVRQIR | SLLFQSYLDNVGVQIVRQMR | P | NP_056794.1 | P06747 | 90 | 109 |
68113 | VEAEIAHQI | - | P | P15198.1 | P06747 | 197 | 205 |
93760 | RQMKSGGRF | RQMRSGERF | P | AAY23584.1 | P06747 | 68 | 76 |
94299 | YLDNVGVHI | YLDNVGVQI | P | AAK55014.1 | P06747 | 96 | 104 |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2023 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Huaman, C.; Paskey, A.C.; Clouse, C.; Feasley, A.; Rader, M.; Rice, G.K.; Luquette, A.E.; Fitzpatrick, M.C.; Drumm, H.M.; Yan, L.; et al. Genomic Surveillance of Rabies Virus in Georgian Canines. Viruses 2023, 15, 1797. https://doi.org/10.3390/v15091797
Huaman C, Paskey AC, Clouse C, Feasley A, Rader M, Rice GK, Luquette AE, Fitzpatrick MC, Drumm HM, Yan L, et al. Genomic Surveillance of Rabies Virus in Georgian Canines. Viruses. 2023; 15(9):1797. https://doi.org/10.3390/v15091797
Chicago/Turabian StyleHuaman, Celeste, Adrian C. Paskey, Caitlyn Clouse, Austin Feasley, Madeline Rader, Gregory K. Rice, Andrea E. Luquette, Maren C. Fitzpatrick, Hannah M. Drumm, Lianying Yan, and et al. 2023. "Genomic Surveillance of Rabies Virus in Georgian Canines" Viruses 15, no. 9: 1797. https://doi.org/10.3390/v15091797