Recent Advances in Glioma Cancer Treatment: Conventional and Epigenetic Realms
Abstract
:1. Introduction
2. Epigenetics in the Pathogenesis of Glioma
2.1. DNA Methylation
2.2. miRNAs and Glioma
2.3. Chromatin Remodeling and Glioma
2.4. Histone Modification and Gliomas
3. Glioma Treatment Strategies
3.1. Glioma Epigenetic Therapy
3.1.1. DNA Methylation Inhibitors (DNMTi)
3.1.2. Histone Deacetylase Inhibitors (HDACi)
4. Histone Methyltransferase
4.1. Methyltransferase Inhibitors
4.1.1. Bromodomain Inhibitors (BDI)
4.1.2. Arginine Methyltransferase (PRMT5)
4.2. Glioma Immunotherapy
4.2.1. Immune Checkpoint Inhibition
PD-L1
CTLA-4
Indolamine 2,3-dioxygenase (IDO)
4.2.2. Bispecific Antibodies (BsAbs)
4.2.3. CAR-T Treatment in Glioma
4.2.4. Immunostimulatory Gene Therapy
Oncolytic Viruses in Gliomas
Suicide Gene Therapy
Cytokine Therapy
4.2.5. Tumor-Associated Macrophage Treatment in Gliomas
4.3. Therapeutic Gene Vaccines for Gliomas
4.3.1. Peptides-Based Vaccine
4.3.2. Dendritic Cell Vaccines
Tumor Peptide Loaded DCs
Tumor Lysate-Loaded DCs
mRNA-Loaded DCs
Glioma Stem Cell-Loaded DCs
Viral Antigen-Loaded DCs
4.4. Peptides-Based Treatment in Glioma
5. Future Directions
6. Conclusions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
Abbreviations
GBM | Glioblastoma |
WHO | World Health Organization |
OXPHOS | Oxidative phosphorylation |
TMZ | Temozolomide |
BBB | Blood-brain barrier |
5hmC | 5-hydroxymethylcytosine |
IDH1 | Isocitrate dehydrogenase 1 |
PDGFRA | Platelet-Derived Growth Factor Receptor Alpha |
ACVR1 | Activin A receptor type I |
HDACs | Histone deacetylases |
HATs | Acetyltransferases |
DNMTi | DNA methylation inhibitors |
PBMC | Peripheral blood mononuclear cells |
PFS6 | Progression-free survival |
VPA | Valproic acid |
EMT | Epithelial-mesenchymal transition |
BRD | Bromodomain |
IDO | Indolamine 2,3-dioxygenase |
BsAbs | Bispecific antibodies |
TAAs | Tumor-associated antigens |
ADCC | Antibody-dependent cytotoxicity |
PRRs | Pattern recognition receptors |
HSV-TK | Herpes simplex virus type 1 |
DCVs | Dendritic cell vaccines |
References
- Xu, S.; Tang, L.; Li, X.; Fan, F.; Liu, Z. Immunotherapy for glioma: Current management and future application. Cancer Lett. 2020, 476, 1–12. [Google Scholar] [CrossRef]
- Nicholson, J.G.; Fine, H.A. Diffuse Glioma Heterogeneity and Its Therapeutic Implications. Cancer Discov. 2021, 11, 575–590. [Google Scholar] [CrossRef]
- Poteet, E.; Choudhury, G.R.; Winters, A.; Li, W.; Ryou, M.-G.; Liu, R.; Tang, L.; Ghorpade, A.; Wen, Y.; Yuan, F. Reversing the Warburg effect as a treatment for glioblastoma. J. Biol. Chem. 2013, 288, 9153–9164. [Google Scholar] [CrossRef] [PubMed]
- Park, J.; Shim, J.-K.; Kang, J.H.; Choi, J.; Chang, J.H.; Kim, S.-Y.; Kang, S.-G. Regulation of bioenergetics through dual inhibition of aldehyde dehydrogenase and mitochondrial complex I suppresses glioblastoma tumorspheres. Neuro-Oncology 2018, 20, 954–965. [Google Scholar] [CrossRef] [PubMed]
- Geng, F.; Cheng, X.; Wu, X.; Yoo, J.Y.; Cheng, C.; Guo, J.Y.; Mo, X.; Ru, P.; Hurwitz, B.; Kim, S.-H. Inhibition of SOAT1 Suppresses Glioblastoma Growth via Blocking SREBP-1–Mediated LipogenesisTargeting SOAT1 to Treat Glioblastoma. Clin. Cancer Res. 2016, 22, 5337–5348. [Google Scholar] [CrossRef] [PubMed]
- Dong, Z.; Cui, H. Epigenetic modulation of metabolism in glioblastoma. Semin. Cancer Biol. 2019, 57, 45–51. [Google Scholar] [CrossRef]
- Vander Heiden, M.G.; Cantley, L.C.; Thompson, C.B. Understanding the Warburg effect: The metabolic requirements of cell proliferation. Science 2009, 324, 1029–1033. [Google Scholar] [CrossRef]
- Seyfried, T.N.; Flores, R.; Poff, A.M.; D’Agostino, D.P.; Mukherjee, P. Metabolic therapy: A new paradigm for managing malignant brain cancer. Cancer Lett. 2015, 356, 289–300. [Google Scholar] [CrossRef]
- DeBerardinis, R.J.; Lum, J.J.; Hatzivassiliou, G.; Thompson, C.B. The biology of cancer: Metabolic reprogramming fuels cell growth and proliferation. Cell Metab. 2008, 7, 11–20. [Google Scholar] [CrossRef]
- Malarmathi, S.; Safeekh, A.; Joshua, A.M. Neurobehavioral Issues in Adult Neurological Conditions. In Physiotherapy for Adult Neurological Conditions; Springer: Berlin/Heidelberg, Germany, 2022; pp. 833–854. [Google Scholar]
- Cantidio, F.S.; Gil, G.O.B.; Queiroz, I.N.; Regalin, M. Glioblastoma—Treatment and obstacles. Rep. Pract. Oncol. Radiother. 2022. [Google Scholar] [CrossRef]
- Nakagawa-Saito, Y.; Saitoh, S.; Mitobe, Y.; Sugai, A.; Togashi, K.; Suzuki, S.; Kitanaka, C.; Okada, M. HDAC Class I Inhibitor Domatinostat Preferentially Targets Glioma Stem Cells over Their Differentiated Progeny. Int. J. Mol. Sci. 2022, 23, 8084. [Google Scholar] [CrossRef]
- Troike, K.M.; Silver, D.J.; Ghosh, P.K.; Mulkearns-Hubert, E.E.; Hubert, C.G.; Connor, J.R.; Fox, P.L.; Kristensen, B.W.; Lathia, J. Tumor cell-intrinsic HFE drives glioblastoma growth. bioRxiv 2022. [Google Scholar] [CrossRef]
- Gritsch, S.; Batchelor, T.T.; Gonzalez Castro, L.N. Diagnostic, therapeutic, and prognostic implications of the 2021 World Health Organization classification of tumors of the central nervous system. Cancer 2022, 128, 47–58. [Google Scholar] [CrossRef]
- Horbinski, C.; Berger, T.; Packer, R.J.; Wen, P.Y. Clinical implications of the 2021 edition of the WHO classification of central nervous system tumours. Nat. Rev. Neurol. 2022, 18, 515–529. [Google Scholar] [CrossRef]
- Popova, S.N.; Bergqvist, M.; Dimberg, A.; Edqvist, P.H.; Ekman, S.; Hesselager, G.; Ponten, F.; Smits, A.; Sooman, L.; Alafuzoff, I. Subtyping of gliomas of various WHO grades by the application of immunohistochemistry. Histopathology 2014, 64, 365–379. [Google Scholar] [CrossRef]
- Özcan, H.; Emiroğlu, B.G.; Sabuncuoğlu, H.; Özdoğan, S.; Soyer, A.; Saygı, T. A comparative study for glioma classification using deep convolutional neural networks. Math. Biosci. Eng. 2021, 18, 1550–1572. [Google Scholar] [CrossRef]
- Belykh, E.; Onaka, N.R.; Zhao, X.; Abramov, I.; Eschbacher, J.M.; Nakaji, P.; Preul, M.C. High-Dose Fluorescein Reveals Unusual Confocal Endomicroscope Imaging of Low-Grade Glioma. Front. Neurol. 2021, 12, 668656. [Google Scholar] [CrossRef]
- Louis, D.N.; Wesseling, P.; Aldape, K.; Brat, D.J.; Capper, D.; Cree, I.A.; Eberhart, C.; Figarella-Branger, D.; Fouladi, M.; Fuller, G.N.; et al. cIMPACT-NOW update 6: New entity and diagnostic principle recommendations of the cIMPACT-Utrecht meeting on future CNS tumor classification and grading. Brain Pathol. 2020, 30, 844–856. [Google Scholar] [CrossRef]
- Brat, D.J.; Aldape, K.; Colman, H.; Holland, E.C.; Louis, D.N.; Jenkins, R.B.; Kleinschmidt-DeMasters, B.; Perry, A.; Reifenberger, G.; Stupp, R. cIMPACT-NOW update 3: Recommended diagnostic criteria for “Diffuse astrocytic glioma, IDH-wildtype, with molecular features of glioblastoma, WHO grade IV”. Acta Neuropathol. 2018, 136, 805–810. [Google Scholar] [CrossRef]
- Noël, G.; Schott, R.; Froelich, S.; Gaub, M.-P.; Boyer, P.; Fischer-Lokou, D.; Dufour, P.; Kehrli, P.; Maitrot, D. Retrospective comparison of chemoradiotherapy followed by adjuvant chemotherapy, with or without prior gliadel implantation (carmustine) after initial surgery in patients with newly diagnosed high-grade gliomas. Int. J. Radiat. Oncol. Biol. Phys. 2012, 82, 749–755. [Google Scholar] [CrossRef]
- He, Y.; Kaina, B. Are there thresholds in glioblastoma cell death responses triggered by temozolomide? Int. J. Mol. Sci. 2019, 20, 1562. [Google Scholar] [CrossRef] [PubMed]
- Beranek, D.T. Distribution of methyl and ethyl adducts following alkylation with monofunctional alkylating agents. Mutat. Res. Fundam. Mol. Mech. Mutagenes. 1990, 231, 11–30. [Google Scholar] [CrossRef]
- Norden, A.D.; Drappatz, J.; Wen, P.Y. Novel anti-angiogenic therapies for malignant gliomas. Lancet Neurol. 2008, 7, 1152–1160. [Google Scholar] [CrossRef]
- Arabzadeh, A.; Mortezazadeh, T.; Aryafar, T.; Gharepapagh, E.; Majdaeen, M.; Farhood, B. Therapeutic potentials of resveratrol in combination with radiotherapy and chemotherapy during glioblastoma treatment: A mechanistic review. Cancer Cell Int. 2021, 21, 391. [Google Scholar] [CrossRef] [PubMed]
- Esteller, M.; Garcia-Foncillas, J.; Andion, E.; Goodman, S.N.; Hidalgo, O.F.; Vanaclocha, V.; Baylin, S.B.; Herman, J.G. Inactivation of the DNA-repair gene MGMT and the clinical response of gliomas to alkylating agents. N. Engl. J. Med. 2000, 343, 1350–1354. [Google Scholar] [CrossRef] [PubMed]
- Hotta, T.; Saito, Y.; Fujita, H.; Mikami, T.; Kurisu, K.; Kiya, K.; Uozumi, T.; Isowa, G.; Ishizaki, K.; Ikenaga, M. O6-alkylguanine-DNA alkyltransferase activity of human malignant glioma and its clinical implications. J. Neuro-Oncol. 1994, 21, 135–140. [Google Scholar] [CrossRef]
- Ochs, K.; Kaina, B. Apoptosis induced by DNA Damage O-Methylguanine is Bcl-2 and Caspase-9/3 regulated and Fas/Caspase-8 independent. Cancer Res. 2000, 60, 5815–5824. [Google Scholar]
- Herman, J.G.; Baylin, S.B. Gene silencing in cancer in association with promoter hypermethylation. N. Engl. J. Med. 2003, 349, 2042–2054. [Google Scholar] [CrossRef]
- Komine, C.; Watanabe, T.; Katayama, Y.; Yoshino, A.; Yokoyama, T.; Fukushima, T. Promoter hypermethylation of the DNA repair gene O6-methylguanine-DNA methyltransferase is an independent predictor of shortened progression free survival in patients with low-grade diffuse astrocytomas. Brain Pathol. 2003, 13, 176–184. [Google Scholar] [CrossRef]
- Tsankova, N.M.; Canoll, P. Advances in genetic and epigenetic analyses of gliomas: A neuropathological perspective. J. Neuro-Oncol. 2014, 119, 481–490. [Google Scholar] [CrossRef]
- Berghoff, A.S.; Hainfellner, J.A.; Marosi, C.; Preusser, M. Assessing MGMT methylation status and its current impact on treatment in glioblastoma. CNS Oncol. 2015, 4, 47–52. [Google Scholar] [CrossRef]
- Masumoto, H.; Hawke, D.; Kobayashi, R.; Verreault, A. A role for cell-cycle-regulated histone H3 lysine 56 acetylation in the DNA damage response. Nature 2005, 436, 294–298. [Google Scholar] [CrossRef]
- Sterner, D.E.; Berger, S.L. Acetylation of histones and transcription-related factors. Microbiol. Mol. Biol. Rev. 2000, 64, 435–459. [Google Scholar] [CrossRef]
- Bao, S.; Wu, Q.; McLendon, R.E.; Hao, Y.; Shi, Q.; Hjelmeland, A.B.; Dewhirst, M.W.; Bigner, D.D.; Rich, J.N. Glioma stem cells promote radioresistance by preferential activation of the DNA damage response. Nature 2006, 444, 756–760. [Google Scholar] [CrossRef]
- Chakravarti, A.; Zhai, G.G.; Zhang, M.; Malhotra, R.; Latham, D.E.; Delaney, M.A.; Robe, P.; Nestler, U.; Song, Q.; Loeffler, J. Survivin enhances radiation resistance in primary human glioblastoma cells via caspase-independent mechanisms. Oncogene 2004, 23, 7494–7506. [Google Scholar] [CrossRef]
- Wang, Y.; Chen, R.; Zhou, X.; Guo, R.; Yin, J.; Li, Y.; Ma, G. miR-137: A novel therapeutic target for human glioma. Mol. Ther.-Nucleic Acids 2020, 21, 614–622. [Google Scholar] [CrossRef]
- Kane, J.R.; Miska, J.; Young, J.S.; Kanojia, D.; Kim, J.W.; Lesniak, M.S. Sui generis: Gene therapy and delivery systems for the treatment of glioblastoma. Neuro-Oncology 2015, 17, ii24–ii36. [Google Scholar] [CrossRef]
- Wang, K.; Kievit, F.M.; Zhang, M. Nanoparticles for cancer gene therapy: Recent advances, challenges, and strategies. Pharmacol. Res. 2016, 114, 56–66. [Google Scholar] [CrossRef]
- Li, A.; Zhang, T.; Huang, T.; Lin, R.; Mu, J.; Su, Y.; Sun, H.; Jiang, X.; Wu, H.; Xu, D. Iron oxide nanoparticles promote Cx43-overexpression of mesenchymal stem cells for efficient suicide gene therapy during glioma treatment. Theranostics 2021, 11, 8254. [Google Scholar] [CrossRef]
- Zheng, H.; Momeni, A.; Cedoz, P.-L.; Vogel, H.; Gevaert, O. Whole slide images reflect DNA methylation patterns of human tumors. NPJ Genom. Med. 2020, 5, 11. [Google Scholar] [CrossRef]
- Chen, X.; Zhao, C.; Zhao, Z.; Wang, H.; Fang, Z. Specific glioma prognostic subtype distinctions based on DNA methylation patterns. Front. Genet. 2019, 10, 786. [Google Scholar] [CrossRef] [PubMed]
- Malta, T.M.; de Souza, C.F.; Sabedot, T.S.; Silva, T.C.; Mosella, M.S.; Kalkanis, S.N.; Snyder, J.; Castro, A.V.B.; Noushmehr, H. Glioma CpG island methylator phenotype (G-CIMP): Biological and clinical implications. Neuro-Oncology 2018, 20, 608–620. [Google Scholar] [CrossRef] [PubMed]
- Lövkvist, C.; Dodd, I.B.; Sneppen, K.; Haerter, J.O. DNA methylation in human epigenomes depends on local topology of CpG sites. Nucleic Acids Res. 2016, 44, 5123–5132. [Google Scholar] [CrossRef] [PubMed]
- Lee, S.; Kim, M.; Kwon, H.; Park, I.; Park, M.; Lee, C.; Kim, Y.; Kim, C.; Hong, S. Growth inhibitory effect on glioma cells of adenovirus-mediated p16/INK4a gene transfer in vitro and in vivo. Int. J. Mol. Med. 2000, 6, 559–622. [Google Scholar] [CrossRef]
- Gömöri, É.; Pál, J.; Mészáros, I.; Dóczi, T.; Matolcsy, A. Epigenetic inactivation of the hMLH1 gene in progression of gliomas. Diagn. Mol. Pathol. 2007, 16, 104–107. [Google Scholar]
- Mur, P.; Rodríguez de Lope, Á.; Díaz-Crespo, F.J.; Hernández-Iglesias, T.; Ribalta, T.; Fiaño, C.; García, J.F.; Rey, J.A.; Mollejo, M.; Meléndez, B. Impact on prognosis of the regional distribution of MGMT methylation with respect to the CpG island methylator phenotype and age in glioma patients. J. Neuro-Oncol. 2015, 122, 441–450. [Google Scholar] [CrossRef]
- Yu, Z.; Chen, Y.; Wang, S.; Li, P.; Zhou, G.; Yuan, Y. Inhibition of NF-κB results in anti-glioma activity and reduces temozolomide-induced chemoresistance by down-regulating MGMT gene expression. Cancer Lett. 2018, 428, 77–89. [Google Scholar] [CrossRef]
- Parsons, D.W.; Jones, S.; Zhang, X.; Lin, J.C.-H.; Leary, R.J.; Angenendt, P.; Mankoo, P.; Carter, H.; Siu, I.-M.; Gallia, G.L. An integrated genomic analysis of human glioblastoma multiforme. Science 2008, 321, 1807–1812. [Google Scholar] [CrossRef]
- Rajaratnam, V.; Islam, M.M.; Yang, M.; Slaby, R.; Ramirez, H.M.; Mirza, S.P. Glioblastoma: Pathogenesis and current status of chemotherapy and other novel treatments. Cancers 2020, 12, 937. [Google Scholar] [CrossRef]
- Venteicher, A.S.; Tirosh, I.; Hebert, C.; Yizhak, K.; Neftel, C.; Filbin, M.G.; Hovestadt, V.; Escalante, L.E.; Shaw, M.L.; Rodman, C. Decoupling genetics, lineages, and microenvironment in IDH-mutant gliomas by single-cell RNA-seq. Science 2017, 355, eaai8478. [Google Scholar] [CrossRef]
- Bleeker, F.E.; Atai, N.A.; Lamba, S.; Jonker, A.; Rijkeboer, D.; Bosch, K.S.; Tigchelaar, W.; Troost, D.; Vandertop, W.P.; Bardelli, A. The prognostic IDH1 R132 mutation is associated with reduced NADP+-dependent IDH activity in glioblastoma. Acta Neuropathol. 2010, 119, 487–494. [Google Scholar] [CrossRef]
- Noushmehr, H.; Weisenberger, D.J.; Diefes, K.; Phillips, H.S.; Pujara, K.; Berman, B.P.; Pan, F.; Pelloski, C.E.; Sulman, E.P.; Bhat, K.P. Identification of a CpG island methylator phenotype that defines a distinct subgroup of glioma. Cancer Cell 2010, 17, 510–522. [Google Scholar] [CrossRef] [Green Version]
- Flavahan, W.A.; Drier, Y.; Liau, B.B.; Gillespie, S.M.; Venteicher, A.S.; Stemmer-Rachamimov, A.O.; Suvà, M.L.; Bernstein, B.E. Insulator dysfunction and oncogene activation in IDH mutant gliomas. Nature 2016, 529, 110–114. [Google Scholar] [CrossRef]
- Chen, R.; Cohen, A.L.; Colman, H. Targeted therapeutics in patients with high-grade gliomas: Past, present, and future. Curr. Treat. Options Oncol. 2016, 17, 42. [Google Scholar] [CrossRef]
- Verhaak, R. Cancer Genome Atlas Research Network: Integrated genomic analysis identifies clinically relevant subtypes of glioblastoma characterized by abnormalities in PDGFRA, IDH1, EGFR, and NF1. Cancer Cell 2010, 17, 98–110. [Google Scholar] [CrossRef]
- Vickers, N.J. Animal communication: When i’m calling you, will you answer too? Curr. Biol. 2017, 27, R713–R715. [Google Scholar] [CrossRef]
- Mendez, F.; Kadiyala, P.; Nunez, F.J.; Carney, S.; Nunez, F.M.; Gauss, J.C.; Ravindran, R.; Pawar, S.; Edwards, M.; Garcia-Fabiani, M.B. Therapeutic Efficacy of Immune Stimulatory Thymidine Kinase and fms-like Tyrosine Kinase 3 Ligand (TK/Flt3L) Gene Therapy in a Mouse Model of High-Grade Brainstem GliomaImmune Stimulatory Gene Therapy in Brainstem Glioma. Clin. Cancer Res. 2020, 26, 4080–4092. [Google Scholar] [CrossRef]
- Fontebasso, A.M.; Papillon-Cavanagh, S.; Schwartzentruber, J.; Nikbakht, H.; Gerges, N.; Fiset, P.-O.; Bechet, D.; Faury, D.; De Jay, N.; Ramkissoon, L.A. Recurrent somatic mutations in ACVR1 in pediatric midline high-grade astrocytoma. Nat. Genet. 2014, 46, 462–466. [Google Scholar] [CrossRef]
- Kwiatkowska, A.; Nandhu, M.S.; Behera, P.; Chiocca, E.A.; Viapiano, M.S. Strategies in gene therapy for glioblastoma. Cancers 2013, 5, 1271–1305. [Google Scholar] [CrossRef]
- de Menezes, M.R.; Acioli, M.E.A.; da Trindade, A.C.L.; da Silva, S.P.; de Lima, R.E.; da Silva Teixeira, V.G.; Vasconcelos, L.R.S. Potential role of microRNAs as biomarkers in human glioblastoma: A mini systematic review from 2015 to 2020. Mol. Biol. Rep. 2021, 48, 4647–4658. [Google Scholar] [CrossRef]
- Katsila, T.; Kardamakis, D. The Role of microRNAs in Gliomas–Therapeutic Implications. Curr. Mol. Pharmacol. 2021, 14, 1004–1012. [Google Scholar] [CrossRef] [PubMed]
- Berindan-Neagoe, I.; Monroig, P.d.C.; Pasculli, B.; Calin, G.A. MicroRNAome genome: A treasure for cancer diagnosis and therapy. CA Cancer J. Clin. 2014, 64, 311–336. [Google Scholar] [CrossRef] [PubMed]
- Lakomy, R.; Sana, J.; Hankeova, S.; Fadrus, P.; Kren, L.; Lzicarova, E.; Svoboda, M.; Dolezelova, H.; Smrcka, M.; Vyzula, R. MiR-195, miR-196b, miR-181c, miR-21 expression levels and O-6-methylguanine-DNA methyltransferase methylation status are associated with clinical outcome in glioblastoma patients. Cancer Sci. 2011, 102, 2186–2190. [Google Scholar] [CrossRef] [PubMed]
- Wang, S.; Yin, Y.; Liu, S. Roles of microRNAs during glioma tumorigenesis and progression. Histol. Histopathol. 2019, 34, 213–222. [Google Scholar] [PubMed]
- Ghaemmaghami, A.B.; Mahjoubin-Tehran, M.; Movahedpour, A.; Morshedi, K.; Sheida, A.; Taghavi, S.P.; Mirzaei, H.; Hamblin, M.R. Role of exosomes in malignant glioma: microRNAs and proteins in pathogenesis and diagnosis. Cell Commun. Signal. 2020, 18, 120. [Google Scholar] [CrossRef] [PubMed]
- Zhang, C.; Zhang, J.; Hao, J.; Shi, Z.; Wang, Y.; Han, L.; Yu, S.; You, Y.; Jiang, T.; Wang, J. High level of miR-221/222 confers increased cell invasion and poor prognosis in glioma. J. Transl. Med. 2012, 10, 119. [Google Scholar] [CrossRef]
- Zang, L.; Kondengaden, S.M.; Che, F.; Wang, L.; Heng, X. Potential epigenetic-based therapeutic targets for glioma. Front. Mol. Neurosci. 2018, 11, 408. [Google Scholar] [CrossRef]
- Maggs, L.; Cattaneo, G.; Dal, A.E.; Moghaddam, A.S.; Ferrone, S. CAR T cell-based immunotherapy for the treatment of glioblastoma. Front. Neurosci. 2021, 15, 662064. [Google Scholar] [CrossRef]
- Kondo, Y.; Katsushima, K.; Ohka, F.; Natsume, A.; Shinjo, K. Epigenetic dysregulation in glioma. Cancer Sci. 2014, 105, 363–369. [Google Scholar] [CrossRef]
- Sesé, B.; Ensenyat-Mendez, M.; Iñiguez, S.; Llinàs-Arias, P.; Marzese, D.M. Chromatin insulation dynamics in glioblastoma: Challenges and future perspectives of precision oncology. Clin. Epigenet. 2021, 13, 150. [Google Scholar] [CrossRef]
- Filippova, G.N.; Qi, C.-F.; Ulmer, J.E.; Moore, J.M.; Ward, M.D.; Hu, Y.J.; Loukinov, D.I.; Pugacheva, E.M.; Klenova, E.M.; Grundy, P.E. Tumor-associated zinc finger mutations in the CTCF transcription factor selectively alter its DNA-binding specificity. Cancer Res. 2002, 62, 48–52. [Google Scholar]
- Katainen, R.; Dave, K.; Pitkänen, E.; Palin, K.; Kivioja, T.; Välimäki, N.; Gylfe, A.E.; Ristolainen, H.; Hänninen, U.A.; Cajuso, T. CTCF/cohesin-binding sites are frequently mutated in cancer. Nat. Genet. 2015, 47, 818–821. [Google Scholar] [CrossRef]
- Basta, J.; Rauchman, M. The nucleosome remodeling and deacetylase complex in development and disease. Transl. Epigenet. Clin. 2017, 37–72. [Google Scholar] [CrossRef]
- Marfella, C.G.; Henninger, N.; LeBlanc, S.E.; Krishnan, N.; Garlick, D.S.; Holzman, L.B.; Imbalzano, A.N. A mutation in the mouse Chd2 chromatin remodeling enzyme results in a complex renal phenotype. Kidney Blood Press. Res. 2008, 31, 421–432. [Google Scholar] [CrossRef]
- Choi, Y.J.; Yoo, N.J.; Lee, S.H. Mutation of HELLS, a chromatin remodeling gene, gastric and colorectal cancers. Pathol. Oncol. Res. 2015, 21, 851–852. [Google Scholar] [CrossRef]
- Fueyo, J.; Gomez-Manzano, C.; Yung, W.A.; Kyritsis, A.P. The functional role of tumor suppressor genes in gliomas: Clues for future therapeutic strategies. Neurology 1998, 51, 1250–1255. [Google Scholar] [CrossRef]
- Dahia, P. PTEN, a unique tumor suppressor gene. Endocr.-Relat. Cancer 2000, 7, 115–129. [Google Scholar] [CrossRef]
- Housman, G.; Byler, S.; Heerboth, S.; Lapinska, K.; Longacre, M.; Snyder, N.; Sarkar, S. Drug resistance in cancer: An overview. Cancers 2014, 6, 1769–1792. [Google Scholar] [CrossRef]
- Guo, L.; Lee, Y.-T.; Zhou, Y.; Huang, Y. Targeting epigenetic regulatory machinery to overcome cancer therapy resistance. Semin. Cancer Biol. 2022, 83, 487–502. [Google Scholar] [PubMed]
- Saini, A.; Gallo, J.M. Epigenetic instability may alter cell state transitions and anticancer drug resistance. PLoS Comput. Biol. 2021, 17, e1009307. [Google Scholar] [CrossRef]
- De Angelis, M.L.; Francescangeli, F.; La Torre, F.; Zeuner, A. Stem cell plasticity and dormancy in the development of cancer therapy resistance. Front. Oncol. 2019, 9, 626. [Google Scholar] [CrossRef] [PubMed]
- Uddin, M.S.; Al Mamun, A.; Alghamdi, B.S.; Tewari, D.; Jeandet, P.; Sarwar, M.S.; Ashraf, G.M. Epigenetics of glioblastoma multiforme: From molecular mechanisms to therapeutic approaches. Semin. Cancer Biol. 2022, 83, 100–120. [Google Scholar] [CrossRef] [PubMed]
- Krug, B.; De Jay, N.; Harutyunyan, A.S.; Deshmukh, S.; Marchione, D.M.; Guilhamon, P.; Bertrand, K.C.; Mikael, L.G.; McConechy, M.K.; Chen, C.C. Pervasive H3K27 acetylation leads to ERV expression and a therapeutic vulnerability in H3K27M gliomas. Cancer Cell 2019, 35, 782–797.e788. [Google Scholar] [CrossRef]
- Xiao, D.; Huang, J.; Pan, Y.; Li, H.; Fu, C.; Mao, C.; Cheng, Y.; Shi, Y.; Chen, L.; Jiang, Y. Chromatin remodeling factor LSH is upregulated by the LRP6-GSK3β-E2F1 axis linking reversely with survival in gliomas. Theranostics 2017, 7, 132. [Google Scholar] [CrossRef]
- Zemach, A.; Kim, M.Y.; Hsieh, P.-H.; Coleman-Derr, D.; Eshed-Williams, L.; Thao, K.; Harmer, S.L.; Zilberman, D. The Arabidopsis nucleosome remodeler DDM1 allows DNA methyltransferases to access H1-containing heterochromatin. Cell 2013, 153, 193–205. [Google Scholar] [CrossRef]
- Myant, K.; Termanis, A.; Sundaram, A.Y.; Boe, T.; Li, C.; Merusi, C.; Burrage, J.; Jose, I.; Stancheva, I. LSH and G9a/GLP complex are required for developmentally programmed DNA methylation. Genome Res. 2011, 21, 83–94. [Google Scholar] [CrossRef]
- Von Eyss, B.; Maaskola, J.; Memczak, S.; Möllmann, K.; Schuetz, A.; Loddenkemper, C.; Tanh, M.D.; Otto, A.; Muegge, K.; Heinemann, U. The SNF2-like helicase HELLS mediates E2F3-dependent transcription and cellular transformation. EMBO J. 2012, 31, 972–985. [Google Scholar] [CrossRef]
- Ruijter, A.J.d.; GENNIP, A.H.v.; Caron, H.N.; Kemp, S.; KUILENBURG, A.B.v. Histone deacetylases (HDACs): Characterization of the classical HDAC family. Biochem. J. 2003, 370, 737–749. [Google Scholar] [CrossRef]
- Liu, F.; Barsyte-Lovejoy, D.; Allali-Hassani, A.; He, Y.; Herold, J.M.; Chen, X.; Yates, C.M.; Frye, S.V.; Brown, P.J.; Huang, J. Optimization of cellular activity of G9a inhibitors 7-aminoalkoxy-quinazolines. J. Med. Chem. 2011, 54, 6139–6150. [Google Scholar] [CrossRef]
- Kim, Y.Z. Altered histone modifications in gliomas. Brain Tumor Res. Treat. 2014, 2, 7–21. [Google Scholar] [CrossRef]
- Ciechomska, I.A.; Jayaprakash, C.; Maleszewska, M.; Kaminska, B. Histone modifying enzymes and chromatin modifiers in glioma pathobiology and therapy responses. In Glioma Signaling; Springer: Cham, Switzerland, 2020; pp. 259–279. [Google Scholar]
- Chang, Y.; Zhang, X.; Horton, J.R.; Upadhyay, A.K.; Spannhoff, A.; Liu, J.; Snyder, J.P.; Bedford, M.T.; Cheng, X. Structural basis for G9a-like protein lysine methyltransferase inhibition by BIX-01294. Nat. Struct. Mol. Biol. 2009, 16, 312–317. [Google Scholar] [CrossRef] [PubMed]
- Cheung, H.C.; Yatsenko, S.A.; Kadapakkam, M.; Legay, H.; Su, J.; Lupski, J.R.; Plon, S.E. Constitutional tandem duplication of 9q34 that truncates EHMT1 in a child with ganglioglioma. Pediatr. Blood Cancer 2012, 58, 801–805. [Google Scholar] [CrossRef] [PubMed]
- Liu, X.; Li, G.; Su, Z.; Jiang, Z.; Chen, L.; Wang, J.; Yu, S.; Liu, Z. Poly (amido amine) is an ideal carrier of miR-7 for enhancing gene silencing effects on the EGFR pathway in U251 glioma cells. Oncol. Rep. 2013, 29, 1387–1394. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Heddleston, J.M.; Wu, Q.; Rivera, M.; Minhas, S.; Lathia, J.D.; Sloan, A.E.; Iliopoulos, O.; Hjelmeland, A.B.; Rich, J.N. Hypoxia-induced mixed-lineage leukemia 1 regulates glioma stem cell tumorigenic potential. Cell Death Differ. 2012, 19, 428–439. [Google Scholar] [CrossRef]
- Zhou, C.; Zhang, Y.; Dai, J.; Zhou, M.; Liu, M.; Wang, Y.; Chen, X.-Z.; Tang, J. Pygo2 functions as a prognostic factor for glioma due to its up-regulation of H3K4me3 and promotion of MLL1/MLL2 complex recruitment. Sci. Rep. 2016, 6, 22066. [Google Scholar] [CrossRef]
- Tao, H.; Li, H.; Su, Y.; Feng, D.; Wang, X.; Zhang, C.; Ma, H.; Hu, Q. Histone methyltransferase G9a and H3K9 dimethylation inhibit the self-renewal of glioma cancer stem cells. Mol. Cell. Biochem. 2014, 394, 23–30. [Google Scholar] [CrossRef]
- Kunadis, E.; Lakiotaki, E.; Korkolopoulou, P.; Piperi, C. Targeting post-translational histone modifying enzymes in glioblastoma. Pharmacol. Ther. 2021, 220, 107721. [Google Scholar] [CrossRef]
- McGrath, J.; Trojer, P. Targeting histone lysine methylation in cancer. Pharmacol. Ther. 2015, 150, 1–22. [Google Scholar] [CrossRef]
- Herz, H.-M.; Garruss, A.; Shilatifard, A. SET for life: Biochemical activities and biological functions of SET domain-containing proteins. Trends Biochem. Sci. 2013, 38, 621–639. [Google Scholar] [CrossRef]
- Min, J.; Feng, Q.; Li, Z.; Zhang, Y.; Xu, R.-M. Structure of the catalytic domain of human DOT1L, a non-SET domain nucleosomal histone methyltransferase. Cell 2003, 112, 711–723. [Google Scholar] [CrossRef]
- Chen, C.; Duan, Z.; Yuan, Y.; Li, R.; Pang, L.; Liang, J.; Xu, X.; Wang, J. Peptide-22 and cyclic RGD functionalized liposomes for glioma targeting drug delivery overcoming BBB and BBTB. ACS Appl. Mater. Interfaces 2017, 9, 5864–5873. [Google Scholar] [CrossRef]
- Berger, S.L. The complex language of chromatin regulation during transcription. Nature 2007, 447, 407–412. [Google Scholar] [CrossRef]
- Ghiaseddin, A.; Reardon, D.; Massey, W.; Mannerino, A.; Lipp, E.S.; Herndon, J.E.; McSherry, F.; Desjardins, A.; Randazzo, D.; Friedman, H.S. Phase II study of bevacizumab and vorinostat for patients with recurrent World Health Organization grade 4 malignant glioma. Oncologist 2018, 23, 157-e21. [Google Scholar] [CrossRef] [Green Version]
- Dammann, R.H.; Richter, A.M.; Jiménez, A.P.; Woods, M.; Küster, M.; Witharana, C. Impact of natural compounds on DNA methylation levels of the tumor suppressor gene RASSF1A in cancer. Int. J. Mol. Sci. 2017, 18, 2160. [Google Scholar] [CrossRef]
- Chu, B.; Karpenko, M.; Liu, Z.; Aimiuwu, J.; Villalona-Calero, M.; Chan, K.; Grever, M.; Otterson, G. Phase I study of 5-aza-2′-deoxycytidine in combination with valproic acid in non-small-cell lung cancer. Cancer Chemother. Pharmacol. 2013, 71, 115–121. [Google Scholar] [CrossRef]
- Hazane-Puch, F.; Arnaud, J.; Trocmé, C.; Faure, P.; Laporte, F.; Champelovier, P. Sodium selenite decreased HDAC activity, cell proliferation and induced apoptosis in three human glioblastoma cells. Anti-Cancer Agents Med. Chem. Former. Curr. Med. Chem.-Anti-Cancer Agents 2016, 16, 490–500. [Google Scholar] [CrossRef]
- Pei, Y.; Liu, K.-W.; Wang, J.; Garancher, A.; Tao, R.; Esparza, L.A.; Maier, D.L.; Udaka, Y.T.; Murad, N.; Morrissy, S. HDAC and PI3K antagonists cooperate to inhibit growth of MYC-driven medulloblastoma. Cancer Cell 2016, 29, 311–323. [Google Scholar] [CrossRef]
- Akasaki, Y.; Kikuchi, T.; Homma, S.; Koido, S.; Ohkusa, T.; Tasaki, T.; Hayashi, K.; Komita, H.; Watanabe, N.; Suzuki, Y.; et al. Phase I/II trial of combination of temozolomide chemotherapy and immunotherapy with fusions of dendritic and glioma cells in patients with glioblastoma. Cancer Immunol. Immunother. 2016, 65, 1499–1509. [Google Scholar] [CrossRef]
- Hummel, T.R.; Wagner, L.; Ahern, C.; Fouladi, M.; Reid, J.M.; McGovern, R.M.; Ames, M.M.; Gilbertson, R.J.; Horton, T.; Ingle, A.M. A pediatric phase 1 trial of vorinostat and temozolomide in relapsed or refractory primary brain or spinal cord tumors: A Children’s Oncology Group phase 1 consortium study. Pediatr. Blood Cancer 2013, 60, 1452–1457. [Google Scholar] [CrossRef]
- Galanis, E.; Jaeckle, K.A.; Maurer, M.J.; Reid, J.M.; Ames, M.M.; Hardwick, J.S.; Reilly, J.F.; Loboda, A.; Nebozhyn, M.; Fantin, V.R. Phase II trial of vorinostat in recurrent glioblastoma multiforme: A north central cancer treatment group study. J. Clin. Oncol. 2009, 27, 2052. [Google Scholar] [CrossRef]
- Lee, E.Q.; Reardon, D.A.; Schiff, D.; Drappatz, J.; Muzikansky, A.; Grimm, S.A.; Norden, A.D.; Nayak, L.; Beroukhim, R.; Rinne, M.L. Phase II study of panobinostat in combination with bevacizumab for recurrent glioblastoma and anaplastic glioma. Neuro-Oncology 2015, 17, 862–867. [Google Scholar] [CrossRef]
- Shi, W.; Palmer, J.D.; Werner-Wasik, M.; Andrews, D.W.; Evans, J.J.; Glass, J.; Kim, L.; Bar-Ad, V.; Judy, K.; Farrell, C. Phase I trial of panobinostat and fractionated stereotactic re-irradiation therapy for recurrent high grade gliomas. J. Neuro-Oncol. 2016, 127, 535–539. [Google Scholar] [CrossRef]
- Krauze, A.V.; Myrehaug, S.D.; Chang, M.G.; Holdford, D.J.; Smith, S.; Shih, J.; Tofilon, P.J.; Fine, H.A.; Camphausen, K. A phase 2 study of concurrent radiation therapy, temozolomide, and the histone deacetylase inhibitor valproic acid for patients with glioblastoma. Int. J. Radiat. Oncol. Biol. Phys. 2015, 92, 986–992. [Google Scholar] [CrossRef] [Green Version]
- Issa, J.-P.J.; Garcia-Manero, G.; Giles, F.J.; Mannari, R.; Thomas, D.; Faderl, S.; Bayar, E.; Lyons, J.; Rosenfeld, C.S.; Cortes, J. Phase 1 study of low-dose prolonged exposure schedules of the hypomethylating agent 5-aza-2′-deoxycytidine (decitabine) in hematopoietic malignancies. Blood 2004, 103, 1635–1640. [Google Scholar] [CrossRef]
- Wheeler, L.A.; Manzanera, A.G.; Bell, S.D.; Cavaliere, R.; McGregor, J.M.; Grecula, J.C.; Newton, H.B.; Lo, S.S.; Badie, B.; Portnow, J. Phase II multicenter study of gene-mediated cytotoxic immunotherapy as adjuvant to surgical resection for newly diagnosed malignant glioma. Neuro-Oncology 2016, 18, 1137–1145. [Google Scholar] [CrossRef]
- Maio, M.; Covre, A.; Fratta, E.; Di Giacomo, A.M.; Taverna, P.; Natali, P.G.; Coral, S.; Sigalotti, L. Molecular pathways: At the crossroads of cancer epigenetics and immunotherapy. Clin. Cancer Res. 2015, 21, 4040–4047. [Google Scholar] [CrossRef] [PubMed]
- Wu, W.; Klockow, J.L.; Zhang, M.; Lafortune, F.; Chang, E.; Jin, L.; Wu, Y.; Daldrup-Link, H.E. Glioblastoma multiforme (GBM): An overview of current therapies and mechanisms of resistance. Pharmacol. Res. 2021, 171, 105780. [Google Scholar] [CrossRef]
- Ohkuri, T.; Kosaka, A.; Ikeura, M.; Salazar, A.M.; Okada, H. IFN-γ-and IL-17-producing CD8+ T (Tc17-1) cells in combination with poly-ICLC and peptide vaccine exhibit antiglioma activity. J. Immunother. Cancer 2021, 9, e002426. [Google Scholar] [CrossRef]
- Hervey-Jumper, S.L.; Berger, M.S. Role of surgical resection in low-and high-grade gliomas. Curr. Treat. Options Neurol. 2014, 16, 284. [Google Scholar] [CrossRef]
- Chen, Z.; Hambardzumyan, D. Immune microenvironment in glioblastoma subtypes. Front. Immunol. 2018, 9, 1004. [Google Scholar] [CrossRef]
- Stupp, R.; Mason, W.P.; Van Den Bent, M.J.; Weller, M.; Fisher, B.; Taphoorn, M.J.; Belanger, K.; Brandes, A.A.; Marosi, C.; Bogdahn, U. Radiotherapy plus concomitant and adjuvant temozolomide for glioblastoma. N. Engl. J. Med. 2005, 352, 987–996. [Google Scholar] [CrossRef] [PubMed]
- Friedman, H.S.; Prados, M.D.; Wen, P.Y.; Mikkelsen, T.; Schiff, D.; Abrey, L.E.; Yung, W.A.; Paleologos, N.; Nicholas, M.K.; Jensen, R. Bevacizumab alone and in combination with irinotecan in recurrent glioblastoma. J. Clin. Oncol. 2009, 27, 4733–4740. [Google Scholar] [CrossRef] [PubMed]
- Baral, A.; Ye, H.X.; Jiang, P.C.; Yao, Y.; Mao, Y. B7-H3 and B7-H1 expression in cerebral spinal fluid and tumor tissue correlates with the malignancy grade of glioma patients. Oncol. Lett. 2014, 8, 1195–1201. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Zeng, J.; See, A.P.; Phallen, J.; Jackson, C.M.; Belcaid, Z.; Ruzevick, J.; Durham, N.; Meyer, C.; Harris, T.J.; Albesiano, E. Anti-PD-1 blockade and stereotactic radiation produce long-term survival in mice with intracranial gliomas. Int. J. Radiat. Oncol. Biol. Phys. 2013, 86, 343–349. [Google Scholar] [CrossRef]
- Jahan, N.; Talat, H.; Alonso, A.; Saha, D.; Curry, W.T. Triple combination immunotherapy with GVAX, anti-PD-1 monoclonal antibody, and agonist anti-OX40 monoclonal antibody is highly effective against murine intracranial glioma. Oncoimmunology 2019, 8, e1577108. [Google Scholar] [CrossRef]
- Omuro, A.; Vlahovic, G.; Lim, M.; Sahebjam, S.; Baehring, J.; Cloughesy, T.; Voloschin, A.; Ramkissoon, S.H.; Ligon, K.L.; Latek, R. Nivolumab with or without ipilimumab in patients with recurrent glioblastoma: Results from exploratory phase I cohorts of CheckMate 143. Neuro-Oncology 2018, 20, 674–686. [Google Scholar] [CrossRef]
- Hanihara, M.; Kawataki, T.; Oh-Oka, K.; Mitsuka, K.; Nakao, A.; Kinouchi, H. Synergistic antitumor effect with indoleamine 2, 3-dioxygenase inhibition and temozolomide in a murine glioma model. J. Neurosurg. 2016, 124, 1594–1601. [Google Scholar] [CrossRef]
- Vom Berg, J.; Vrohlings, M.; Haller, S.; Haimovici, A.; Kulig, P.; Sledzinska, A.; Weller, M.; Becher, B. Intratumoral IL-12 combined with CTLA-4 blockade elicits T cell–mediated glioma rejection. J. Exp. Med. 2013, 210, 2803–2811. [Google Scholar] [CrossRef]
- Grauer, O.M.; Nierkens, S.; Bennink, E.; Toonen, L.W.; Boon, L.; Wesseling, P.; Sutmuller, R.P.; Adema, G.J. CD4+ FoxP3+ regulatory T cells gradually accumulate in gliomas during tumor growth and efficiently suppress antiglioma immune responses in vivo. Int. J. Cancer 2007, 121, 95–105. [Google Scholar] [CrossRef]
- Garber, K. China approves world’s first oncolytic virus therapy for cancer treatment. J. Natl. Cancer Inst. 2006, 98, 298–300. [Google Scholar] [CrossRef]
- Andtbacka, R.H.; Kaufman, H.L.; Collichio, F.; Amatruda, T.; Senzer, N.; Chesney, J.; Delman, K.A.; Spitler, L.E.; Puzanov, I.; Agarwala, S.S. Talimogene laherparepvec improves durable response rate in patients with advanced melanoma. J. Clin. Oncol. 2015, 33, 2780–2788. [Google Scholar] [CrossRef]
- Bischoff, J.R.; Kirn, D.H.; Williams, A.; Heise, C.; Horn, S.; Muna, M.; Ng, L.; Nye, J.A.; Sampson-Johannes, A.; Fattaey, A. An adenovirus mutant that replicates selectively in p53-deficient human tumor cells. Science 1996, 274, 373–376. [Google Scholar] [CrossRef] [PubMed]
- Palu, G.; Cavaggioni, A.; Calvi, P.; Franchin, E.; Pizzato, M.; Boschetto, R.; Parolin, C.; Chilosi, M.; Ferrini, S.; Zanusso, A. Gene therapy of glioblastoma multiforme via combined expression of suicide and cytokine genes: A pilot study in humans. Gene Ther. 1999, 6, 330–337. [Google Scholar] [CrossRef] [Green Version]
- Puntel, M.; Muhammad, A.; Candolfi, M.; Salem, A.; Yagiz, K.; Farrokhi, C.; Kroeger, K.M.; Xiong, W.; Curtin, J.F.; Liu, C. A novel bicistronic high-capacity gutless adenovirus vector that drives constitutive expression of herpes simplex virus type 1 thymidine kinase and tet-inducible expression of Flt3L for glioma therapeutics. J. Virol. 2010, 84, 6007–6017. [Google Scholar] [CrossRef]
- Dranoff, G. Cytokines in cancer pathogenesis and cancer therapy. Nat. Rev. Cancer 2004, 4, 11–22. [Google Scholar] [CrossRef]
- Coventry, B.J.; Ashdown, M.L. The 20th anniversary of interleukin-2 therapy: Bimodal role explaining longstanding random induction of complete clinical responses. Cancer Manag. Res. 2012, 4, 215. [Google Scholar] [CrossRef]
- Okada, H.; Lieberman, F.S.; Walter, K.A.; Lunsford, L.D.; Kondziolka, D.S.; Bejjani, G.K.; Hamilton, R.L.; Torres-Trejo, A.; Kalinski, P.; Cai, Q. Autologous glioma cell vaccine admixed with interleukin-4 gene transfected fibroblasts in the treatment of patients with malignant gliomas. J. Transl. Med. 2007, 5, 67. [Google Scholar] [CrossRef]
- Esiri, M.M.; Morris, C.S. Immunocytochemical study of macrophages and microglial cells and extracellular matrix components in human CNS disease: 2. Non-neoplastic diseases. J. Neurol. Sci. 1991, 101, 59–72. [Google Scholar] [CrossRef]
- Mieczkowski, J.; Kocyk, M.; Nauman, P.; Gabrusiewicz, K.; Sielska, M.; Przanowski, P.; Maleszewska, M.; Rajan, W.D.; Pszczolkowska, D.; Tykocki, T. Down-regulation of IKKβ expression in glioma-infiltrating microglia/macrophages is associated with defective inflammatory/immune gene responses in glioblastoma. Oncotarget 2015, 6, 33077. [Google Scholar] [CrossRef]
- Hu, F.; Ku, M.C.; Markovic, D.; Dzaye, O.; Lehnardt, S.; Synowitz, M.; Wolf, S.A.; Kettenmann, H. Glioma-associated microglial MMP9 expression is upregulated by TLR2 signaling and sensitive to minocycline. Int. J. Cancer 2014, 135, 2569–2578. [Google Scholar] [CrossRef]
- Cohen, A.L.; Anker, C.J.; Salzman, K.; Jensen, R.L.; Shrieve, D.C.; Colman, H. A Phase 1 Study of Repeat Radiation, Minocycline, and Bevacizumab in Patients with Recurrent Glioma (RAMBO); American Society of Clinical Oncology: Alexandria, VA, USA, 2014. [Google Scholar]
- Gabrusiewicz, K.; Ellert-Miklaszewska, A.; Lipko, M.; Sielska, M.; Frankowska, M.; Kaminska, B. Characteristics of the alternative phenotype of microglia/macrophages and its modulation in experimental gliomas. PLoS ONE 2011, 6, e23902. [Google Scholar] [CrossRef]
- Bagley, S.J.; Desai, A.S.; Linette, G.P.; June, C.H.; O’Rourke, D.M. CAR T-cell therapy for glioblastoma: Recent clinical advances and future challenges. Neuro-Oncology 2018, 20, 1429–1438. [Google Scholar] [CrossRef] [PubMed]
- Nehama, D.; Di Ianni, N.; Musio, S.; Du, H.; Patané, M.; Pollo, B.; Finocchiaro, G.; Park, J.J.; Dunn, D.E.; Edwards, D.S. B7-H3-redirected chimeric antigen receptor T cells target glioblastoma and neurospheres. EBioMedicine 2019, 47, 33–43. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Brown, C.E.; Alizadeh, D.; Starr, R.; Weng, L.; Wagner, J.R.; Naranjo, A.; Ostberg, J.R.; Blanchard, M.S.; Kilpatrick, J.; Simpson, J. Regression of glioblastoma after chimeric antigen receptor T-cell therapy. N. Engl. J. Med. 2016, 375, 2561–2569. [Google Scholar] [CrossRef]
- Ahmed, N.; Brawley, V.; Hegde, M.; Bielamowicz, K.; Kalra, M.; Landi, D.; Robertson, C.; Gray, T.L.; Diouf, O.; Wakefield, A. HER2-specific chimeric antigen receptor–modified virus-specific T cells for progressive glioblastoma: A phase 1 dose-escalation trial. JAMA Oncol. 2017, 3, 1094–1101. [Google Scholar] [CrossRef]
- Sampson, J.H.; Choi, B.D.; Sanchez-Perez, L.; Suryadevara, C.M.; Snyder, D.J.; Flores, C.T.; Schmittling, R.J.; Nair, S.K.; Reap, E.A.; Norberg, P.K. EGFRvIII mCAR-Modified T-Cell Therapy Cures Mice with Established Intracerebral Glioma and Generates Host Immunity against Tumor-Antigen LossEGFRvIII mCARs for Malignant Glioma. Clin. Cancer Res. 2014, 20, 972–984. [Google Scholar] [CrossRef]
- Shen, C.-J.; Yang, Y.-X.; Han, E.Q.; Cao, N.; Wang, Y.-F.; Wang, Y.; Zhao, Y.-Y.; Zhao, L.-M.; Cui, J.; Gupta, P. Chimeric antigen receptor containing ICOS signaling domain mediates specific and efficient antitumor effect of T cells against EGFRvIII expressing glioma. J. Hematol. Oncol. 2013, 6, 33. [Google Scholar] [CrossRef]
- Sampson, J.H.; Schmittling, R.J.; Archer, G.E.; Congdon, K.L.; Nair, S.K.; Reap, E.A.; Desjardins, A.; Friedman, A.H.; Friedman, H.S.; Herndon, J.E. A pilot study of IL-2Rα blockade during lymphopenia depletes regulatory T-cells and correlates with enhanced immunity in patients with glioblastoma. PLoS ONE 2012, 7, e31046. [Google Scholar]
- Mishima, K.; Johns, T.G.; Luwor, R.B.; Scott, A.M.; Stockert, E.; Jungbluth, A.A.; Ji, X.-D.; Suvarna, P.; Voland, J.R.; Old, L.J. Growth suppression of intracranial xenografted glioblastomas overexpressing mutant epidermal growth factor receptors by systemic administration of monoclonal antibody (mAb) 806, a novel monoclonal antibody directed to the receptor. Cancer Res. 2001, 61, 5349–5354. [Google Scholar]
- Crane, C.A.; Han, S.J.; Ahn, B.; Oehlke, J.; Kivett, V.; Fedoroff, A.; Butowski, N.; Chang, S.M.; Clarke, J.; Berger, M.S. Individual Patient-Specific Immunity against High-Grade Glioma after Vaccination with Autologous Tumor Derived Peptides Bound to the 96 KD Chaperone ProteinLong-term Immunity against High-Grade Glioma. Clin. Cancer Res. 2013, 19, 205–214. [Google Scholar] [CrossRef]
- Ishikawa, E.; Muragaki, Y.; Yamamoto, T.; Maruyama, T.; Tsuboi, K.; Ikuta, S.; Hashimoto, K.; Uemae, Y.; Ishihara, T.; Matsuda, M. Phase I/IIa trial of fractionated radiotherapy, temozolomide, and autologous formalin-fixed tumor vaccine for newly diagnosed glioblastoma. J. Neurosurg. 2014, 121, 543–553. [Google Scholar] [CrossRef]
- Kikuchi, T.; Akasaki, Y.; Irie, M.; Homma, S.; Abe, T.; Ohno, T. Results of a phase I clinical trial of vaccination of glioma patients with fusions of dendritic and glioma cells. Cancer Immunol. Immunother. 2001, 50, 337–344. [Google Scholar] [CrossRef]
- Yu, J.S.; Wheeler, C.J.; Zeltzer, P.M.; Ying, H.; Finger, D.N.; Lee, P.K.; Yong, W.H.; Incardona, F.; Thompson, R.C.; Riedinger, M.S. Vaccination of malignant glioma patients with peptide-pulsed dendritic cells elicits systemic cytotoxicity and intracranial T-cell infiltration. Cancer Res. 2001, 61, 842–847. [Google Scholar]
- Ardon, H.; Van Gool, S.; Lopes, I.S.; Maes, W.; Sciot, R.; Wilms, G.; Demaerel, P.; Bijttebier, P.; Claes, L.; Goffin, J. Integration of autologous dendritic cell-based immunotherapy in the primary treatment for patients with newly diagnosed glioblastoma multiforme: A pilot study. J. Neuro-Oncol. 2010, 99, 261–272. [Google Scholar] [CrossRef]
- Megías-Vericat, J.E.; Ballesta-Lopez, O.; Barragan, E.; Montesinos, P. IDH1-mutated relapsed or refractory AML: Current challenges and future prospects. Blood Lymphat. Cancer Targets Ther. 2019, 9, 19. [Google Scholar] [CrossRef]
- Wen, P.Y.; Reardon, D.A.; Armstrong, T.S.; Phuphanich, S.; Aiken, R.D.; Landolfi, J.C.; Curry, W.T.; Zhu, J.-J.; Glantz, M.; Peereboom, D.M. A Randomized Double-Blind Placebo-Controlled Phase II Trial of Dendritic Cell Vaccine ICT-107 in Newly Diagnosed Patients with GlioblastomaICT-107 Vaccine for Newly Diagnosed Glioblastoma. Clin. Cancer Res. 2019, 25, 5799–5807. [Google Scholar]
- Wainwright, D.A.; Chang, A.L.; Dey, M.; Balyasnikova, I.V.; Kim, C.K.; Tobias, A.; Cheng, Y.; Kim, J.W.; Qiao, J.; Zhang, L. Durable Therapeutic Efficacy Utilizing Combinatorial Blockade against IDO, CTLA-4, and PD-L1 in Mice with Brain TumorsIDO, CTLA-4, PD-L1 Synergistic Blockade in Brain Tumors. Clin. Cancer Res. 2014, 20, 5290–5301. [Google Scholar] [CrossRef] [Green Version]
- Wolchok, J.D.; Kluger, H.; Callahan, M.K.; Postow, M.A.; Rizvi, N.A.; Lesokhin, A.M.; Segal, N.H.; Ariyan, C.E.; Gordon, R.-A.; Reed, K. Nivolumab plus ipilimumab in advanced melanoma. N. Engl. J. Med. 2013, 369, 122–133. [Google Scholar] [CrossRef] [PubMed]
- Agarwalla, P.; Barnard, Z.; Fecci, P.; Dranoff, G.; Curry Jr, W.T. Sequential immunotherapy by vaccination with GM-CSF expressing glioma cells and CTLA-4 blockade effectively treats established murine intracranial tumors. J. Immunother. 2012, 35, 385. [Google Scholar] [CrossRef]
- Cherkassky, L.; Morello, A.; Villena-Vargas, J.; Feng, Y.; Dimitrov, D.S.; Jones, D.R.; Sadelain, M.; Adusumilli, P.S. Human CAR T cells with cell-intrinsic PD-1 checkpoint blockade resist tumor-mediated inhibition. J. Clin. Investig. 2016, 126, 3130–3144. [Google Scholar] [CrossRef] [PubMed]
- Sengupta, S.; Mao, G.; Gokaslan, Z.; Sampath, P. Chimeric antigen receptors for treatment of glioblastoma: A practical review of challenges and ways to overcome them. Cancer Gene Ther. 2017, 24, 121–129. [Google Scholar] [CrossRef] [PubMed]
- Yasuda, S.; Sho, M.; Yamato, I.; Yoshiji, H.; Wakatsuki, K.; Nishiwada, S.; Yagita, H.; Nakajima, Y. Simultaneous blockade of programmed death 1 and vascular endothelial growth factor receptor 2 (VEGFR2) induces synergistic anti-tumour effect in vivo. Clin. Exp. Immunol. 2013, 172, 500–506. [Google Scholar] [CrossRef] [PubMed]
- Kosaka, A.; Ohkuri, T.; Okada, H. Combination of an agonistic anti-CD40 monoclonal antibody and the COX-2 inhibitor celecoxib induces anti-glioma effects by promotion of type-1 immunity in myeloid cells and T-cells. Cancer Immunol. Immunother. 2014, 63, 847–857. [Google Scholar] [CrossRef] [PubMed]
- Moertel, C.L.; Xia, J.; LaRue, R.; Waldron, N.N.; Andersen, B.M.; Prins, R.M.; Okada, H.; Donson, A.M.; Foreman, N.K.; Hunt, M.A. CD200 in CNS tumor-induced immunosuppression: The role for CD200 pathway blockade in targeted immunotherapy. J. Immunother. Cancer 2014, 2, 46. [Google Scholar] [CrossRef]
- Candolfi, M.; Kroeger, K.M.; Muhammad, A.; Yagiz, K.; Farrokhi, C.; Pechnick, R.N.; Lowenstein, P.R.; Castro, M.G. Gene therapy for brain cancer: Combination therapies provide enhanced efficacy and safety. Curr. Gene Ther. 2009, 9, 409–421. [Google Scholar] [CrossRef]
- Kamran, N.; Kadiyala, P.; Saxena, M.; Candolfi, M.; Li, Y.; Moreno-Ayala, M.A.; Raja, N.; Shah, D.; Lowenstein, P.R.; Castro, M.G. Immunosuppressive myeloid cells’ blockade in the glioma microenvironment enhances the efficacy of immune-stimulatory gene therapy. Mol. Ther. 2017, 25, 232–248. [Google Scholar] [CrossRef]
- Mineharu, Y.; King, G.D.; Muhammad, A.; Bannykh, S.; Kroeger, K.M.; Liu, C.; Lowenstein, P.R.; Castro, M.G. Engineering the Brain Tumor Microenvironment Enhances the Efficacy of Dendritic Cell Vaccination: Implications for Clinical Trial DesignImmunotherapy for Brain Cancer. Clin. Cancer Res. 2011, 17, 4705–4718. [Google Scholar] [CrossRef] [Green Version]
- Ohkuri, T.; Ghosh, A.; Kosaka, A.; Sarkar, S.N.; Okada, H. Protective role of STING against gliomagenesis: Rational use of STING agonist in anti-glioma immunotherapy. Oncoimmunology 2015, 4, e999523. [Google Scholar] [CrossRef]
- Rampling, R.; Peoples, S.; Mulholland, P.J.; James, A.; Al-Salihi, O.; Twelves, C.J.; McBain, C.; Jefferies, S.; Jackson, A.; Stewart, W. A Cancer Research UK First Time in Human Phase I Trial of IMA950 (Novel Multipeptide Therapeutic Vaccine) in Patients with Newly Diagnosed GlioblastomaIMA950 Phase I Trial Final Results. Clin. Cancer Res. 2016, 22, 4776–4785. [Google Scholar] [CrossRef]
- Park, M.-Y.; Kim, C.-H.; Sohn, H.-J.; Oh, S.-T.; Kim, S.-G.; Kim, T.-G. The optimal interval for dendritic cell vaccination following adoptive T cell transfer is important for boosting potent anti-tumor immunity. Vaccine 2007, 25, 7322–7330. [Google Scholar] [CrossRef]
- Shankar, G.M.; Kirtane, A.R.; Miller, J.J.; Mazdiyasni, H.; Rogner, J.; Tai, T.; Williams, E.A.; Higuchi, F.; Juratli, T.A.; Tateishi, K. Genotype-targeted local therapy of glioma. Proc. Natl. Acad. Sci. USA 2018, 115, E8388–E8394. [Google Scholar] [CrossRef]
- Yu, D.; Khan, O.F.; Suvà, M.L.; Dong, B.; Panek, W.K.; Xiao, T.; Wu, M.; Han, Y.; Ahmed, A.U.; Balyasnikova, I.V. Multiplexed RNAi therapy against brain tumor-initiating cells via lipopolymeric nanoparticle infusion delays glioblastoma progression. Proc. Natl. Acad. Sci. USA 2017, 114, E6147–E6156. [Google Scholar] [CrossRef]
- Idbaih, A.; Canney, M.; Belin, L.; Desseaux, C.; Vignot, A.; Bouchoux, G.; Asquier, N.; Law-Ye, B.; Leclercq, D.; Bissery, A. Safety and Feasibility of Repeated and Transient Blood–Brain Barrier Disruption by Pulsed Ultrasound in Patients with Recurrent GlioblastomaBlood–Brain Barrier Disruption by Ultrasound in GBM. Clin. Cancer Res. 2019, 25, 3793–3801. [Google Scholar] [CrossRef]
- Ding, X.; Xu, L.; Sun, X.; Zhao, X.; Gao, B.; Cheng, Y.; Liu, D.; Zhao, J.; Zhang, X.; Xu, L. Human bone marrow-derived mesenchymal stem cell-secreted exosomes overexpressing microrna-124-3p inhibit DLBCL progression by downregulating NFATc1. Res. Sq. 2020. [Google Scholar] [CrossRef]
- Katakowski, M.; Buller, B.; Zheng, X.; Lu, Y.; Rogers, T.; Osobamiro, O.; Shu, W.; Jiang, F.; Chopp, M. Exosomes from marrow stromal cells expressing miR-146b inhibit glioma growth. Cancer Lett. 2013, 335, 201–204. [Google Scholar] [CrossRef]
- Stazi, G.; Taglieri, L.; Nicolai, A.; Romanelli, A.; Fioravanti, R.; Morrone, S.; Sabatino, M.; Ragno, R.; Taurone, S.; Nebbioso, M. Dissecting the role of novel EZH2 inhibitors in primary glioblastoma cell cultures: Effects on proliferation, epithelial-mesenchymal transition, migration, and on the pro-inflammatory phenotype. Clin. Epigenet. 2019, 11, 173. [Google Scholar] [CrossRef]
- Kim, K.H.; Roberts, C.W. Targeting EZH2 in cancer. Nat. Med. 2016, 22, 128–134. [Google Scholar] [CrossRef]
- Orzan, F.; Pellegatta, S.; Poliani, P.; Pisati, F.; Caldera, V.; Menghi, F.; Kapetis, D.; Marras, C.; Schiffer, D.; Finocchiaro, G. Enhancer of Zeste 2 (EZH2) is up-regulated in malignant gliomas and in glioma stem-like cells. Neuropathol. Appl. Neurobiol. 2011, 37, 381–394. [Google Scholar] [CrossRef]
- Sharma, V.; Malgulwar, P.B.; Purkait, S.; Patil, V.; Pathak, P.; Agrawal, R.; Kulshreshtha, R.; Mallick, S.; Julka, P.K.; Suri, A. Genome-wide ChIP-seq analysis of EZH2-mediated H3K27me3 target gene profile highlights differences between low-and high-grade astrocytic tumors. Carcinogenesis 2017, 38, 152–161. [Google Scholar] [CrossRef]
- Zeng, J.; Zhang, J.; Sun, Y.; Wang, J.; Ren, C.; Banerjee, S.; Ouyang, L.; Wang, Y. Targeting EZH2 for cancer therapy: From current progress to novel strategies. Eur. J. Med. Chem. 2022, 238, 114419. [Google Scholar] [CrossRef]
- Romanelli, A.; Stazi, G.; Fioravanti, R.; Zwergel, C.; Di Bello, E.; Pomella, S.; Perrone, C.; Battistelli, C.; Strippoli, R.; Tripodi, M. Design of first-in-class dual EZH2/HDAC inhibitor: Biochemical activity and biological evaluation in cancer cells. ACS Med. Chem. Lett. 2020, 11, 977–983. [Google Scholar] [CrossRef]
- Bhaskaran, V.; Nowicki, M.O.; Idriss, M.; Jimenez, M.A.; Lugli, G.; Hayes, J.L.; Mahmoud, A.B.; Zane, R.E.; Passaro, C.; Ligon, K.L. The functional synergism of microRNA clustering provides therapeutically relevant epigenetic interference in glioblastoma. Nat. Commun. 2019, 10, 442. [Google Scholar] [CrossRef]
- Fu, L.-l.; Tian, M.; Li, X.; Li, J.-j.; Huang, J.; Ouyang, L.; Zhang, Y.; Liu, B. Inhibition of BET bromodomains as a therapeutic strategy for cancer drug discovery. Oncotarget 2015, 6, 5501. [Google Scholar] [CrossRef]
- Yu, L.; Wang, Z.; Zhang, Z.; Ren, X.; Lu, X.; Ding, K. Small-molecule BET inhibitors in clinical and preclinical development and their therapeutic potential. Curr. Top. Med. Chem. 2015, 15, 776–794. [Google Scholar] [CrossRef]
- Giardina, S.F.; Valdambrini, E.; Warren, J.D.; Barany, F. PROTACs: Promising approaches for epigenetic strategies to overcome drug resistance. Curr. Cancer Drug Targets 2021, 21, 306–325. [Google Scholar] [CrossRef]
- Nguyen, M.V.; Loof, L.; Falchook, G.S. Bromodomain and extra-terminal (BET) domain protein inhibitors for solid tumor cancers. J. Immunother. Precis. Oncol. 2020, 3, 16–22. [Google Scholar] [CrossRef] [PubMed]
- Smith, C.R.; Aranda, R.; Bobinski, T.P.; Briere, D.M.; Burns, A.C.; Christensen, J.G.; Clarine, J.; Engstrom, L.D.; Gunn, R.J.; Ivetac, A. Fragment-based discovery of MRTX1719, a synthetic lethal inhibitor of the PRMT5• MTA complex for the treatment of MTAP-deleted cancers. J. Med. Chem. 2022, 65, 1749–1766. [Google Scholar] [CrossRef]
- Köhnke, T.; Krupka, C.; Tischer, J.; Knösel, T.; Subklewe, M. Increase of PD-L1 expressing B-precursor ALL cells in a patient resistant to the CD19/CD3-bispecific T cell engager antibody blinatumomab. J. Hematol. Oncol. 2015, 8, 111. [Google Scholar] [CrossRef]
- Xin, H.; Jiang, X.; Gu, J.; Sha, X.; Chen, L.; Law, K.; Chen, Y.; Wang, X.; Jiang, Y.; Fang, X. Angiopep-conjugated poly (ethylene glycol)-co-poly (ε-caprolactone) nanoparticles as dual-targeting drug delivery system for brain glioma. Biomaterials 2011, 32, 4293–4305. [Google Scholar] [CrossRef]
- Xin, H.; Sha, X.; Jiang, X.; Zhang, W.; Chen, L.; Fang, X. Anti-glioblastoma efficacy and safety of paclitaxel-loading Angiopep-conjugated dual targeting PEG-PCL nanoparticles. Biomaterials 2012, 33, 8167–8176. [Google Scholar] [CrossRef]
- Regberg, J.; Vasconcelos, L.; Madani, F.; Langel, Ü.; Hällbrink, M. pH-responsive PepFect cell-penetrating peptides. Int. J. Pharm. 2016, 501, 32–38. [Google Scholar] [CrossRef]
- Liu, F.; Shollenberger, L.M.; Huang, L. Non-immunostimulatory nonviral vectors. FASEB J. 2004, 18, 1779–1781. [Google Scholar] [CrossRef]
- Ewert, K.K.; Ahmad, A.; Bouxsein, N.F.; Evans, H.M.; Safinya, C.R. Non-viral gene delivery with cationic liposome–DNA complexes. In Gene Therapy Protocols; Springer: Berlin/Heidelberg, Germany, 2008; pp. 159–175. [Google Scholar]
- Ren, J.; Shen, S.; Wang, D.; Xi, Z.; Guo, L.; Pang, Z.; Qian, Y.; Sun, X.; Jiang, X. The targeted delivery of anticancer drugs to brain glioma by PEGylated oxidized multi-walled carbon nanotubes modified with angiopep-2. Biomaterials 2012, 33, 3324–3333. [Google Scholar] [CrossRef] [PubMed]
- Han, L.; Zhang, A.; Wang, H.; Pu, P.; Jiang, X.; Kang, C.; Chang, J. Tat-BMPs-PAMAM conjugates enhance therapeutic effect of small interference RNA on U251 glioma cells in vitro and in vivo. Hum. Gene Ther. 2010, 21, 417–426. [Google Scholar] [CrossRef] [PubMed]
- Zhang, Y.; Yang, L.; Yang, C.; Liu, J. Recent advances of smart acid-responsive gold nanoparticles in tumor therapy. Wiley Interdiscip. Rev. Nanomed. Nanobiotechnol. 2020, 12, e1619. [Google Scholar] [CrossRef] [PubMed]
- Kievit, F.M.; Veiseh, O.; Fang, C.; Bhattarai, N.; Lee, D.; Ellenbogen, R.G.; Zhang, M. Chlorotoxin labeled magnetic nanovectors for targeted gene delivery to glioma. Acs Nano 2010, 4, 4587–4594. [Google Scholar] [CrossRef] [PubMed]
- Sattiraju, A.; Solingapuram Sai, K.K.; Xuan, A.; Pandya, D.N.; Almaguel, F.G.; Wadas, T.J.; Herpai, D.M.; Debinski, W.; Mintz, A. IL13RA2 targeted alpha particle therapy against glioblastomas. Oncotarget 2017, 8, 42997–43007. [Google Scholar] [CrossRef] [Green Version]
- Wang, B.; Lv, L.; Wang, Z.; Jiang, Y.; Lv, W.; Liu, X.; Wang, Z.; Zhao, Y.; Xin, H.; Xu, Q. Improved anti-glioblastoma efficacy by IL-13Rα2 mediated copolymer nanoparticles loaded with paclitaxel. Sci. Rep. 2015, 5, 16589. [Google Scholar] [CrossRef]
- Feng, X.; Gao, X.; Kang, T.; Jiang, D.; Yao, J.; Jing, Y.; Song, Q.; Jiang, X.; Liang, J.; Chen, J. Mammary-derived growth inhibitor targeting peptide-modified PEG–PLA nanoparticles for enhanced targeted glioblastoma therapy. Bioconjug. Chem. 2015, 26, 1850–1861. [Google Scholar] [CrossRef]
- Ayo, A.; Figueras, E.; Schachtsiek, T.; Budak, M.; Sewald, N.; Laakkonen, P. Tumor-Targeting Peptides: The Functional Screen of Glioblastoma Homing Peptides to the Target Protein FABP3 (MDGI). Cancers 2020, 12, 1836. [Google Scholar] [CrossRef]
- Park, S.H.; Yoon, Y.I.; Moon, H.; Lee, G.H.; Lee, B.H.; Yoon, T.J.; Lee, H.J. Development of a novel microbubble-liposome complex conjugated with peptide ligands targeting IL4R on brain tumor cells. Oncol. Rep 2016, 36, 131–136. [Google Scholar] [CrossRef]
- Shteinfer-Kuzmine, A.; Arif, T.; Krelin, Y.; Tripathi, S.S.; Paul, A.; Shoshan-Barmatz, V. Mitochondrial VDAC1-based peptides: Attacking oncogenic properties in glioblastoma. Oncotarget 2017, 8, 31329. [Google Scholar] [CrossRef]
- Friedmann-Morvinski, D.; Narasimamurthy, R.; Xia, Y.; Myskiw, C.; Soda, Y.; Verma, I.M. Targeting NF-κB in glioblastoma: A therapeutic approach. Sci. Adv. 2016, 2, e1501292. [Google Scholar] [CrossRef] [PubMed]
- Bidwell III, G.L.; Perkins, E.; Hughes, J.; Khan, M.; James, J.R.; Raucher, D. Thermally targeted delivery of a c-Myc inhibitory polypeptide inhibits tumor progression and extends survival in a rat glioma model. PLoS ONE 2013, 8, e55104. [Google Scholar] [CrossRef]
- Reifenberger, G.; Wirsching, H.-G.; Knobbe-Thomsen, C.B.; Weller, M. Advances in the molecular genetics of gliomas—implications for classification and therapy. Nat. Rev. Clin. Oncol. 2017, 14, 434–452. [Google Scholar] [CrossRef]
- Gupta, B.; Levchenko, T.S.; Torchilin, V.P. TAT peptide-modified liposomes provide enhanced gene delivery to intracranial human brain tumor xenografts in nude mice. Oncol. Res. Featur. Preclin. Clin. Cancer Ther. 2006, 16, 351–359. [Google Scholar] [CrossRef]
- Rousselle, C.; Clair, P.; Lefauconnier, J.-M.; Kaczorek, M.; Scherrmann, J.-M.; Temsamani, J. New advances in the transport of doxorubicin through the blood-brain barrier by a peptide vector-mediated strategy. Mol. Pharmacol. 2000, 57, 679–686. [Google Scholar] [CrossRef] [Green Version]
- Rousselle, C.; Clair, P.; Temsamani, J.; Scherrmann, J.-M. Improved brain delivery of benzylpenicillin with a peptide-vector-mediated strategy. J. Drug Target. 2002, 10, 309–315. [Google Scholar] [CrossRef]
- Gettinger, S.; Rizvi, N.A.; Chow, L.Q.; Borghaei, H.; Brahmer, J.; Ready, N.; Gerber, D.E.; Shepherd, F.A.; Antonia, S.; Goldman, J.W. Nivolumab monotherapy for first-line treatment of advanced non–small-cell lung cancer. J. Clin. Oncol. 2016, 34, 2980. [Google Scholar] [CrossRef]
- Ivashko, I.N.; Kolesar, J.M. Pembrolizumab and nivolumab: PD-1 inhibitors for advanced melanoma. Am. J. Health-Syst. Pharm. 2016, 73, 193–201. [Google Scholar] [CrossRef]
- Huang, B.Y.; Zhan, Y.P.; Zong, W.J.; Yu, C.J.; Li, J.F.; Qu, Y.M.; Han, S. The PD-1/B7-H1 pathway modulates the natural killer cells versus mouse glioma stem cells. PLoS ONE 2015, 10, e0134715. [Google Scholar] [CrossRef] [PubMed]
- Finck, A.; Gill, S.I.; June, C.H. Cancer immunotherapy comes of age and looks for maturity. Nat. Commun. 2020, 11, 3325. [Google Scholar] [CrossRef] [PubMed]
- Pardoll, D.M. The blockade of immune checkpoints in cancer immunotherapy. Nat. Rev. Cancer 2012, 12, 252–264. [Google Scholar] [CrossRef]
- Rotte, A. Combination of CTLA-4 and PD-1 blockers for treatment of cancer. J. Exp. Clin. Cancer Res. 2019, 38, 255. [Google Scholar] [CrossRef]
- Yi, M.; Jiao, D.; Xu, H.; Liu, Q.; Zhao, W.; Han, X.; Wu, K. Biomarkers for predicting efficacy of PD-1/PD-L1 inhibitors. Mol. Cancer 2018, 17, 129. [Google Scholar] [CrossRef]
- Mulati, K.; Hamanishi, J.; Matsumura, N.; Chamoto, K.; Mise, N.; Abiko, K.; Baba, T.; Yamaguchi, K.; Horikawa, N.; Murakami, R. VISTA expressed in tumour cells regulates T cell function. Br. J. Cancer 2019, 120, 115–127. [Google Scholar] [CrossRef]
- Borggrewe, M.; Grit, C.; Den Dunnen, W.F.; Burm, S.M.; Bajramovic, J.J.; Noelle, R.J.; Eggen, B.J.; Laman, J.D. VISTA expression by microglia decreases during inflammation and is differentially regulated in CNS diseases. GLIA 2018, 66, 2645–2658. [Google Scholar] [CrossRef] [Green Version]
- Flies, D.B.; Han, X.; Higuchi, T.; Zheng, L.; Sun, J.; Ye, J.J.; Chen, L. Coinhibitory receptor PD-1H preferentially suppresses CD4+ T cell–mediated immunity. J. Clin. Investig. 2014, 124, 1966–1975. [Google Scholar] [CrossRef]
- Brunet, J.-F.; Denizot, F.; Luciani, M.-F.; Roux-Dosseto, M.; Suzan, M.; Mattei, M.-G.; Golstein, P. A new member of the immunoglobulin superfamily—CTLA-4. Nature 1987, 328, 267–270. [Google Scholar] [CrossRef]
- Fecci, P.E.; Ochiai, H.; Mitchell, D.A.; Grossi, P.M.; Sweeney, A.E.; Archer, G.E.; Cummings, T.; Allison, J.P.; Bigner, D.D.; Sampson, J.H. Systemic CTLA-4 blockade ameliorates glioma-induced changes to the CD4+ T cell compartment without affecting regulatory T-cell function. Clin. Cancer Res. 2007, 13, 2158–2167. [Google Scholar] [CrossRef]
- Reardon, D.A.; Gokhale, P.C.; Klein, S.R.; Ligon, K.L.; Rodig, S.J.; Ramkissoon, S.H.; Jones, K.L.; Conway, A.S.; Liao, X.; Zhou, J. Glioblastoma Eradication Following Immune Checkpoint Blockade in an Orthotopic, Immunocompetent ModelImmune Checkpoint Blockade for Glioblastoma. Cancer Immunol. Res. 2016, 4, 124–135. [Google Scholar] [CrossRef]
- Belcaid, Z.; Phallen, J.A.; Zeng, J.; See, A.P.; Mathios, D.; Gottschalk, C.; Nicholas, S.; Kellett, M.; Ruzevick, J.; Jackson, C. Focal radiation therapy combined with 4-1BB activation and CTLA-4 blockade yields long-term survival and a protective antigen-specific memory response in a murine glioma model. PLoS ONE 2014, 9, e101764. [Google Scholar]
- Genoud, V.; Marinari, E.; Nikolaev, S.I.; Castle, J.C.; Bukur, V.; Dietrich, P.-Y.; Okada, H.; Walker, P.R. Responsiveness to anti-PD-1 and anti-CTLA-4 immune checkpoint blockade in SB28 and GL261 mouse glioma models. Oncoimmunology 2018, 7, e1501137. [Google Scholar] [CrossRef]
- Munn, D.H.; Mellor, A.L. Indoleamine 2, 3 dioxygenase and metabolic control of immune responses. Trends Immunol. 2013, 34, 137–143. [Google Scholar] [CrossRef]
- Yu, C.-P.; Fu, S.-F.; Chen, X.; Ye, J.; Ye, Y.; Kong, L.-D.; Zhu, Z. The clinicopathological and prognostic significance of IDO1 expression in human solid tumors: Evidence from a systematic review and meta-analysis. Cell. Physiol. Biochem. 2018, 49, 134–143. [Google Scholar] [CrossRef]
- Li, M.; Bolduc, A.R.; Hoda, M.N.; Gamble, D.N.; Dolisca, S.-B.; Bolduc, A.K.; Hoang, K.; Ashley, C.; McCall, D.; Rojiani, A.M. The indoleamine 2, 3-dioxygenase pathway controls complement-dependent enhancement of chemo-radiation therapy against murine glioblastoma. J. Immunother. Cancer 2014, 2, 21. [Google Scholar] [CrossRef]
- Sun, S.; Du, G.; Xue, J.; Ma, J.; Ge, M.; Wang, H.; Tian, J. PCC0208009 enhances the anti-tumor effects of temozolomide through direct inhibition and transcriptional regulation of indoleamine 2, 3-dioxygenase in glioma models. Int. J. Immunopathol. Pharmacol. 2018, 32, 2058738418787991. [Google Scholar] [CrossRef]
- Günther, J.; Däbritz, J.; Wirthgen, E. Limitations and off-target effects of tryptophan-related IDO inhibitors in cancer treatment. Front. Immunol. 2019, 10, 1801. [Google Scholar] [CrossRef]
- Long, G.V.; Dummer, R.; Hamid, O.; Gajewski, T.F.; Caglevic, C.; Dalle, S.; Arance, A.; Carlino, M.S.; Grob, J.-J.; Kim, T.M. Epacadostat plus pembrolizumab versus placebo plus pembrolizumab in patients with unresectable or metastatic melanoma (ECHO-301/KEYNOTE-252): A phase 3, randomised, double-blind study. Lancet Oncol. 2019, 20, 1083–1097. [Google Scholar] [CrossRef]
- Del Bano, J.; Chames, P.; Baty, D.; Kerfelec, B. Taking up cancer immunotherapy challenges: Bispecific antibodies, the path forward? Antibodies 2015, 5, 1. [Google Scholar] [CrossRef]
- Scott, L.J.; Kim, E.S. Emicizumab-kxwh: First global approval. Drugs 2018, 78, 269–274. [Google Scholar] [CrossRef] [PubMed]
- Nie, S.; Wang, Z.; Moscoso-Castro, M.; D’Souza, P.; Lei, C.; Xu, J.; Gu, J. Biology drives the discovery of bispecific antibodies as innovative therapeutics. Antib. Ther. 2020, 3, 18–62. [Google Scholar] [CrossRef] [PubMed]
- Chauchet, X.; Cons, L.; Chatel, L.; Daubeuf, B.; Didelot, G.; Moine, V.; Chollet, D.; Malinge, P.; Pontini, G.; Masternak, K. CD47xCD19 bispecific antibody triggers recruitment and activation of innate immune effector cells in a B-cell lymphoma xenograft model. Exp. Hematol. Oncol. 2022, 11, 26. [Google Scholar] [CrossRef] [PubMed]
- Lo, A.A.; Johnston, J.; Li, J.; Mandikian, D.; Hristopoulos, M.; Clark, R.; Nickles, D.; Liang, W.-C.; Hötzel, K.; Dunlap, D. Anti-LYPD1/CD3 T-cell-dependent bispecific antibody for the treatment of ovarian cancer. Mol. Cancer Ther. 2021, 20, 716–725. [Google Scholar] [CrossRef]
- Sadelain, M. Chimeric antigen receptors: Driving immunology towards synthetic biology. Curr. Opin. Immunol. 2016, 41, 68–76. [Google Scholar] [CrossRef]
- Chandran, S.S.; Klebanoff, C.A. T cell receptor-based cancer immunotherapy: Emerging efficacy and pathways of resistance. Immunol. Rev. 2019, 290, 127–147. [Google Scholar] [CrossRef]
- Dotti, G.; Gottschalk, S.; Savoldo, B.; Brenner, M.K. Design and development of therapies using chimeric antigen receptor-expressing T cells. Immunol. Rev. 2014, 257, 107–126. [Google Scholar] [CrossRef]
- Brown, C.E.; Badie, B.; Barish, M.E.; Weng, L.; Ostberg, J.R.; Chang, W.-C.; Naranjo, A.; Starr, R.; Wagner, J.; Wright, C. Bioactivity and Safety of IL13Rα2-Redirected Chimeric Antigen Receptor CD8+ T Cells in Patients with Recurrent GlioblastomaActivity and Safety of IL13Rα2-Specific CAR T Cells in GBM. Clin. Cancer Res. 2015, 21, 4062–4072. [Google Scholar] [CrossRef] [Green Version]
- Brown, C.E.; Aguilar, B.; Starr, R.; Yang, X.; Chang, W.C.; Weng, L.; Chang, B.; Sarkissian, A.; Brito, A.; Sanchez, J.F.; et al. Optimization of IL13Rα2-Targeted Chimeric Antigen Receptor T Cells for Improved Anti-tumor Efficacy against Glioblastoma. Mol. 2018, 26, 31–44. [Google Scholar] [CrossRef]
- Ahmed, N.; Salsman, V.S.; Kew, Y.; Shaffer, D.; Powell, S.; Zhang, Y.J.; Grossman, R.G.; Heslop, H.E.; Gottschalk, S. HER2-Specific T Cells Target Primary Glioblastoma Stem Cells and Induce Regression of Autologous Experimental TumorsTargeting Stem Cells in Glioblastoma. Clin. Cancer Res. 2010, 16, 474–485. [Google Scholar] [CrossRef]
- Hegde, M.; Mukherjee, M.; Grada, Z.; Pignata, A.; Landi, D.; Navai, S.A.; Wakefield, A.; Fousek, K.; Bielamowicz, K.; Chow, K.K. Tandem CAR T cells targeting HER2 and IL13Rα2 mitigate tumor antigen escape. J. Clin. Investig. 2016, 126, 3036–3052. [Google Scholar] [CrossRef]
- Bullain, S.S.; Sahin, A.; Szentirmai, O.; Sanchez, C.; Lin, N.; Baratta, E.; Waterman, P.; Weissleder, R.; Mulligan, R.C.; Carter, B.S. Genetically engineered T cells to target EGFRvIII expressing glioblastoma. J. Neuro-Oncol. 2009, 94, 373–382. [Google Scholar] [CrossRef]
- Hong, J.; Peng, Y.; Liao, Y.; Jiang, W.; Wei, R.; Huo, L.; Han, Z.; Duan, C.; Zhong, M. Nimotuzumab prolongs survival in patients with malignant gliomas: A phase I/II clinical study of concomitant radiochemotherapy with or without nimotuzumab. Exp. Ther. Med. 2012, 4, 151–157. [Google Scholar] [CrossRef]
- Jin, L.; Ge, H.; Long, Y.; Yang, C.; Chang, Y.; Mu, L.; Sayour, E.J.; De Leon, G.; Wang, Q.J.; Yang, J.C. CD70, a novel target of CAR T-cell therapy for gliomas. Neuro-Oncology 2018, 20, 55–65. [Google Scholar] [CrossRef]
- Tang, X.; Zhao, S.; Zhang, Y.; Wang, Y.; Zhang, Z.; Yang, M.; Zhu, Y.; Zhang, G.; Guo, G.; Tong, A. B7-H3 as a novel CAR-T therapeutic target for glioblastoma. Mol. Ther.-Oncolytics 2019, 14, 279–287. [Google Scholar] [CrossRef]
- Rupp, L.J.; Schumann, K.; Roybal, K.T.; Gate, R.E.; Ye, C.J.; Lim, W.A.; Marson, A. CRISPR/Cas9-mediated PD-1 disruption enhances anti-tumor efficacy of human chimeric antigen receptor T cells. Sci. Rep. 2017, 7, 737. [Google Scholar] [CrossRef]
- Zhang, L.; Morgan, R.A.; Beane, J.D.; Zheng, Z.; Dudley, M.E.; Kassim, S.H.; Nahvi, A.V.; Ngo, L.T.; Sherry, R.M.; Phan, G.Q. Tumor-Infiltrating Lymphocytes Genetically Engineered with an Inducible Gene Encoding Interleukin-12 for the Immunotherapy of Metastatic MelanomaNFAT–IL12 in TIL Trial. Clin. Cancer Res. 2015, 21, 2278–2288. [Google Scholar] [CrossRef] [PubMed]
- Banerjee, K.; Núñez, F.J.; Haase, S.; McClellan, B.L.; Faisal, S.M.; Carney, S.V.; Yu, J.; Alghamri, M.S.; Asad, A.S.; Candia, A.J.N. Current approaches for glioma gene therapy and virotherapy. Front. Mol. Neurosci. 2021, 14, 621831. [Google Scholar] [CrossRef]
- Tobias, A.; Ahmed, A.; Moon, K.-S.; Lesniak, M.S. The art of gene therapy for glioma: A review of the challenging road to the bedside. J. Neurol. Neurosurg. Psychiatry 2013, 84, 213–222. [Google Scholar] [CrossRef]
- Shergalis, A.; Bankhead, A.; Luesakul, U.; Muangsin, N.; Neamati, N. Current challenges and opportunities in treating glioblastoma. Pharmacol. Rev. 2018, 70, 412–445. [Google Scholar] [CrossRef]
- Kamimura, K.; Suda, T.; Zhang, G.; Liu, D. Advances in gene delivery systems. Pharm. Med. 2011, 25, 293–306. [Google Scholar] [CrossRef]
- Luiz, M.T.; Tofani, L.B.; Araújo, V.H.; Di Filippo, L.D.; Duarte, J.L.; Marchetti, J.M.; Chorilli, M. Gene therapy based on lipid nanoparticles as non-viral vectors for Glioma treatment. Curr. Gene Ther. 2021, 21, 452–463. [Google Scholar] [CrossRef] [PubMed]
- Inagaki, A.; Collins, S.; Freedman, A.; Montoya, M.; Haddad, A.; Barcova, M.; Kasahara, N. EXTH-33. Retroviral replicating vectors pseudotyped with gibbon ape leukemia virus envelope for prodrug activator gene therapy in preclinical glioma models. Neuro-Oncology 2021, 23, vi170. [Google Scholar] [CrossRef]
- Ding, G.; Wang, T.; Han, Z.; Tian, L.; Cheng, Q.; Luo, L.; Zhao, B.; Wang, C.; Feng, S.; Wang, L. Substance P containing peptide gene delivery vectors for specifically transfecting glioma cells mediated by a neurokinin-1 receptor. J. Mater. Chem. B 2021, 9, 6347–6356. [Google Scholar] [CrossRef] [PubMed]
- Alphandéry, E. Nano-therapies for glioblastoma treatment. Cancers 2020, 12, 242. [Google Scholar] [CrossRef]
- Marelli, G.; Howells, A.; Lemoine, N.R.; Wang, Y. Oncolytic viral therapy and the immune system: A double-edged sword against cancer. Front. Immunol. 2018, 9, 866. [Google Scholar] [CrossRef] [PubMed]
- Jensen, S.A.; Day, E.S.; Ko, C.H.; Hurley, L.A.; Luciano, J.P.; Kouri, F.M.; Merkel, T.J.; Luthi, A.J.; Patel, P.C.; Cutler, J.I.; et al. Spherical nucleic acid nanoparticle conjugates as an RNAi-based therapy for glioblastoma. Sci. Transl. Med. 2013, 5, 209ra152. [Google Scholar] [CrossRef] [PubMed]
- Lee, T.J.; Yoo, J.Y.; Shu, D.; Li, H.; Zhang, J.; Yu, J.-G.; Jaime-Ramirez, A.C.; Acunzo, M.; Romano, G.; Cui, R. RNA nanoparticle-based targeted therapy for glioblastoma through inhibition of oncogenic miR-21. Mol. Ther. 2017, 25, 1544–1555. [Google Scholar] [CrossRef] [Green Version]
- Costa, P.M.; Cardoso, A.L.; Custódia, C.; Cunha, P.; de Almeida, L.P.; de Lima, M.C.P. MiRNA-21 silencing mediated by tumor-targeted nanoparticles combined with sunitinib: A new multimodal gene therapy approach for glioblastoma. J. Control. Release 2015, 207, 31–39. [Google Scholar] [CrossRef]
- Shu, Y.; Pi, F.; Sharma, A.; Rajabi, M.; Haque, F.; Shu, D.; Leggas, M.; Evers, B.M.; Guo, P. Stable RNA nanoparticles as potential new generation drugs for cancer therapy. Adv. Drug Deliv. Rev. 2014, 66, 74–89. [Google Scholar] [CrossRef]
- Kim, S.-S.; Rait, A.; Kim, E.; Pirollo, K.F.; Chang, E.H. A tumor-targeting p53 nanodelivery system limits chemoresistance to temozolomide prolonging survival in a mouse model of glioblastoma multiforme. Nanomed. Nanotechnol. Biol. Med. 2015, 11, 301–311. [Google Scholar] [CrossRef]
- Lawler, S.E.; Speranza, M.-C.; Cho, C.-F.; Chiocca, E.A. Oncolytic viruses in cancer treatment: A review. JAMA Oncol. 2017, 3, 841–849. [Google Scholar] [CrossRef]
- Castro, M.G.; Candolfi, M.; Wilson, T.J.; Calinescu, A.; Paran, C.; Kamran, N.; Koschmann, C.; Moreno-Ayala, M.A.; Assi, H.; Lowenstein, P.R. Adenoviral vector-mediated gene therapy for gliomas: Coming of age. Expert Opin. Biol. Ther. 2014, 14, 1241–1257. [Google Scholar] [CrossRef]
- Lang, F.F.; Conrad, C.; Gomez-Manzano, C.; Yung, W.A.; Sawaya, R.; Weinberg, J.S.; Prabhu, S.S.; Rao, G.; Fuller, G.N.; Aldape, K.D. Phase I study of DNX-2401 (Delta-24-RGD) oncolytic adenovirus: Replication and immunotherapeutic effects in recurrent malignant glioma. J. Clin. Oncol. 2018, 36, 1419. [Google Scholar] [CrossRef]
- Tejada, S.; Díez-Valle, R.; Domínguez, P.D.; Patiño-García, A.; González-Huarriz, M.; Fueyo, J.; Gomez-Manzano, C.; Idoate, M.A.; Peterkin, J.; Alonso, M.M. DNX-2401, an oncolytic virus, for the treatment of newly diagnosed diffuse intrinsic pontine gliomas: A case report. Front. Oncol. 2018, 8, 61. [Google Scholar] [CrossRef]
- Chiocca, E.A.; Abbed, K.M.; Tatter, S.; Louis, D.N.; Hochberg, F.H.; Barker, F.; Kracher, J.; Grossman, S.A.; Fisher, J.D.; Carson, K. A phase I open-label, dose-escalation, multi-institutional trial of injection with an E1B-Attenuated adenovirus, ONYX-015, into the peritumoral region of recurrent malignant gliomas, in the adjuvant setting. Mol. Ther. 2004, 10, 958–966. [Google Scholar] [CrossRef]
- Alessandrini, F.; Menotti, L.; Avitabile, E.; Appolloni, I.; Ceresa, D.; Marubbi, D.; Campadelli-Fiume, G.; Malatesta, P. Eradication of glioblastoma by immuno-virotherapy with a retargeted oncolytic HSV in a preclinical model. Oncogene 2019, 38, 4467–4479. [Google Scholar] [CrossRef]
- Markert, J.M.; Razdan, S.N.; Kuo, H.-C.; Cantor, A.; Knoll, A.; Karrasch, M.; Nabors, L.B.; Markiewicz, M.; Agee, B.S.; Coleman, J.M. A phase 1 trial of oncolytic HSV-1, G207, given in combination with radiation for recurrent GBM demonstrates safety and radiographic responses. Mol. Ther. 2014, 22, 1048–1055. [Google Scholar] [CrossRef] [Green Version]
- Todo, T. ATIM-14. Results of phase II clinical trial of oncolytic herpes virus G47Δ in patients with glioblastoma. Neuro-Oncology 2019, 21, vi4. [Google Scholar] [CrossRef]
- Desjardins, A.; Gromeier, M.; Herndon, J.E.; Beaubier, N.; Bolognesi, D.P.; Friedman, A.H.; Friedman, H.S.; McSherry, F.; Muscat, A.M.; Nair, S. Recurrent glioblastoma treated with recombinant poliovirus. N. Engl. J. Med. 2018, 379, 150–161. [Google Scholar] [CrossRef]
- Del Vecchio, C.; Calistri, A.; Parolin, C.; Mucignat-Caretta, C. Lentiviral vectors as tools for the study and treatment of glioblastoma. Cancers 2019, 11, 417. [Google Scholar] [CrossRef]
- Tome-Garcia, J.; Erfani, P.; Nudelman, G.; Tsankov, A.M.; Katsyv, I.; Tejero, R.; Zhang, B.; Walsh, M.; Friedel, R.H.; Zaslavsky, E. Analysis of chromatin accessibility uncovers TEAD1 as a regulator of migration in human glioblastoma. Nat. Commun. 2018, 9, 4020. [Google Scholar] [CrossRef] [PubMed]
- Schirrmacher, V.; van Gool, S.; Stuecker, W. Breaking therapy resistance: An update on oncolytic newcastle disease virus for improvements of cancer therapy. Biomedicines 2019, 7, 66. [Google Scholar] [CrossRef] [PubMed]
- Bai, Y.; Chen, Y.; Hong, X.; Liu, X.; Su, X.; Li, S.; Dong, X.; Zhao, G.; Li, Y. Newcastle disease virus enhances the growth-inhibiting and proapoptotic effects of temozolomide on glioblastoma cells in vitro and in vivo. Sci. Rep. 2018, 8, 11470. [Google Scholar] [CrossRef]
- Hardcastle, J.; Mills, L.; Malo, C.S.; Jin, F.; Kurokawa, C.; Geekiyanage, H.; Schroeder, M.; Sarkaria, J.; Johnson, A.J.; Galanis, E. Immunovirotherapy with measles virus strains in combination with anti–PD-1 antibody blockade enhances antitumor activity in glioblastoma treatment. Neuro-Oncology 2017, 19, 493–502. [Google Scholar] [CrossRef] [PubMed]
- Tamura, R.; Miyoshi, H.; Morimoto, Y.; Oishi, Y.; Sampetrean, O.; Iwasawa, C.; Mine, Y.; Saya, H.; Yoshida, K.; Okano, H. Gene therapy using neural stem/progenitor cells derived from human induced pluripotent stem cells: Visualization of migration and bystander killing effect. Hum. Gene Ther. 2020, 31, 352–366. [Google Scholar] [CrossRef] [PubMed]
- Jiang, T.; Zhou, C.; Ren, S. Role of IL-2 in cancer immunotherapy. Oncoimmunology 2016, 5, e1163462. [Google Scholar] [CrossRef] [PubMed]
- Colombo, F.; Barzon, L.; Franchin, E.; Pacenti, M.; Pinna, V.; Danieli, D.; Zanusso, M.; Palu, G. Combined HSV-TK/IL-2 gene therapy in patients with recurrent glioblastoma multiforme: Biological and clinical results. Cancer Gene Ther. 2005, 12, 835–848. [Google Scholar] [CrossRef]
- Weber, F.; Asher, A.; Bucholz, R.; Berger, M.; Prados, M.; Chang, S.; Bruce, J.; Hall, W.; Rainov, N.G.; Westphal, M. Safety, tolerability, and tumor response of IL4-Pseudomonas exotoxin (NBI-3001) in patients with recurrent malignant glioma. J. Neuro-Oncol. 2003, 64, 125–137. [Google Scholar] [CrossRef]
- Kunwar, S.; Prados, M.D.; Chang, S.M.; Berger, M.S.; Lang, F.F.; Piepmeier, J.M.; Sampson, J.H.; Ram, Z.; Gutin, P.H.; Gibbons, R.D. Direct intracerebral delivery of cintredekin besudotox (IL13-PE38QQR) in recurrent malignant glioma: A report by the Cintredekin Besudotox Intraparenchymal Study Group. J. Clin. Oncol. 2007, 25, 837–844. [Google Scholar] [CrossRef]
- Kunwar, S.; Chang, S.; Westphal, M.; Vogelbaum, M.; Sampson, J.; Barnett, G.; Shaffrey, M.; Ram, Z.; Piepmeier, J.; Prados, M. Phase III randomized trial of CED of IL13-PE38QQR vs. Gliadel wafers for recurrent glioblastoma. Neuro-Oncology 2010, 12, 871–881. [Google Scholar] [CrossRef]
- Zhang, L.; Tai, Y.-T.; Ho, M.Z.G.; Qiu, L.; Anderson, K.C. Interferon-alpha-based immunotherapies in the treatment of B cell-derived hematologic neoplasms in today’s treat-to-target era. Exp. Hematol. Oncol. 2017, 6, 20. [Google Scholar] [CrossRef]
- Groves, M.; Puduvalli, V.; Gilbert, M.; Levin, V.; Conrad, C.; Liu, V.; Hunter, K.; Meyers, C.; Hess, K.; Alfred Yung, W. Two phase II trials of temozolomide with interferon-α2b (pegylated and non-pegylated) in patients with recurrent glioblastoma multiforme. Br. J. Cancer 2009, 101, 615–620. [Google Scholar] [CrossRef]
- Lasfar, A.; Abushahba, W.; Balan, M.; Cohen-Solal, K.A. Interferon lambda: A new sword in cancer immunotherapy. Clin. Dev. Immunol. 2011, 2011, 349575. [Google Scholar] [CrossRef]
- Natsume, A.; Wakabayashi, T.; Ishii, D.; Maruta, H.; Fujii, M.; Shimato, S.; Ito, M.; Yoshida, J. A combination of IFN-β and temozolomide in human glioma xenograft models: Implication of p53-mediated MGMT downregulation. Cancer Chemother. Pharmacol. 2008, 61, 653–659. [Google Scholar] [CrossRef]
- Wakabayashi, T.; Natsume, A.; Hashizume, Y.; Fujii, M.; Mizuno, M.; Yoshida, J. A phase I clinical trial of interferon-beta gene therapy for high-grade glioma: Novel findings from gene expression profiling and autopsy. J. Gene Med. Cross-Discip. J. Res. Sci. Gene Transf. Clin. Appl. 2008, 10, 329–339. [Google Scholar] [CrossRef] [PubMed]
- Wolff, J.E.; Wagner, S.; Reinert, C.; Gnekow, A.; Kortmann, R.-D.; Kühl, J.; Van Gool, S.W. Maintenance treatment with interferon-gamma and low-dose cyclophosphamide for pediatric high-grade glioma. J. Neuro-Oncol. 2006, 79, 315–321. [Google Scholar] [CrossRef]
- Chen, L.; Yuan, W.; Chen, Z.; Wu, S.; Ge, J.; Chen, J.; Chen, Z. Vasoactive intestinal peptide represses activation of tumor-associated macrophages in gastric cancer via regulation of TNFα, IL-6, IL-12 and iNOS. Int. J. Oncol. 2015, 47, 1361–1370. [Google Scholar] [CrossRef] [Green Version]
- Singh, S.; Mehta, N.; Lilan, J.; Budhthoki, M.B.; Chao, F.; Yong, L. Initiative action of tumor-associated macrophage during tumor metastasis. Biochim. Open 2017, 4, 8–18. [Google Scholar] [CrossRef]
- Badie, B.; Schartner, J.M. Flow cytometric characterization of tumor-associated macrophages in experimental gliomas. Neurosurgery 2000, 46, 957–962. [Google Scholar]
- Kaminska, B.; Mota, M.; Pizzi, M. Signal transduction and epigenetic mechanisms in the control of microglia activation during neuroinflammation. Biochim. Biophys. Acta (BBA)-Mol. Basis Dis. 2016, 1862, 339–351. [Google Scholar] [CrossRef] [PubMed]
- Vauléon, E.; Tony, A.; Hamlat, A.; Etcheverry, A.; Chiforeanu, D.C.; Menei, P.; Mosser, J.; Quillien, V.; Aubry, M. Immune genes are associated with human glioblastoma pathology and patient survival. BMC Med. Genom. 2012, 5, 41. [Google Scholar] [CrossRef] [PubMed]
- Wesolowska, A.; Kwiatkowska, A.; Slomnicki, L.; Dembinski, M.; Master, A.; Sliwa, M.; Franciszkiewicz, K.; Chouaib, S.; Kaminska, B. Microglia-derived TGF-β as an important regulator of glioblastoma invasion—An inhibition of TGF-β-dependent effects by shRNA against human TGF-β type II receptor. Oncogene 2008, 27, 918–930. [Google Scholar] [CrossRef]
- Ye, X.-z.; Xu, S.-l.; Xin, Y.-h.; Yu, S.-c.; Ping, Y.-f.; Chen, L.; Xiao, H.-l.; Wang, B.; Yi, L.; Wang, Q.-l. Tumor-associated microglia/macrophages enhance the invasion of glioma stem-like cells via TGF-β1 signaling pathway. J. Immunol. 2012, 189, 444–453. [Google Scholar] [CrossRef]
- Ding, A.S.; Routkevitch, D.; Jackson, C.; Lim, M. Targeting myeloid cells in combination treatments for glioma and other tumors. Front. Immunol. 2019, 10, 1715. [Google Scholar] [CrossRef]
- Pyonteck, S.M.; Akkari, L.; Schuhmacher, A.J.; Bowman, R.L.; Sevenich, L.; Quail, D.F.; Olson, O.C.; Quick, M.L.; Huse, J.T.; Teijeiro, V. CSF-1R inhibition alters macrophage polarization and blocks glioma progression. Nat. Med. 2013, 19, 1264–1272. [Google Scholar] [CrossRef]
- Quail, D.F.; Bowman, R.L.; Akkari, L.; Quick, M.L.; Schuhmacher, A.J.; Huse, J.T.; Holland, E.C.; Sutton, J.C.; Joyce, J.A. The tumor microenvironment underlies acquired resistance to CSF-1R inhibition in gliomas. Science 2016, 352, aad3018. [Google Scholar] [CrossRef]
- Coniglio, S.J.; Eugenin, E.; Dobrenis, K.; Stanley, E.R.; West, B.L.; Symons, M.H.; Segall, J.E. Microglial stimulation of glioblastoma invasion involves epidermal growth factor receptor (EGFR) and colony stimulating factor 1 receptor (CSF-1R) signaling. Mol. Med. 2012, 18, 519–527. [Google Scholar] [CrossRef]
- Butowski, N.; Colman, H.; De Groot, J.F.; Omuro, A.M.; Nayak, L.; Wen, P.Y.; Cloughesy, T.F.; Marimuthu, A.; Haidar, S.; Perry, A. Orally administered colony stimulating factor 1 receptor inhibitor PLX3397 in recurrent glioblastoma: An Ivy Foundation Early Phase Clinical Trials Consortium phase II study. Neuro-Oncology 2015, 18, 557–564. [Google Scholar] [CrossRef] [Green Version]
- Jacobs, V.L.; Landry, R.P.; Liu, Y.; Romero-Sandoval, E.A.; De Leo, J.A. Propentofylline decreases tumor growth in a rodent model of glioblastoma multiforme by a direct mechanism on microglia. Neuro-Oncology 2011, 14, 119–131. [Google Scholar] [CrossRef]
- Chen, X.; Zhang, L.; Zhang, I.Y.; Liang, J.; Wang, H.; Ouyang, M.; Wu, S.; da Fonseca, A.C.C.; Weng, L.; Yamamoto, Y. RAGE expression in tumor-associated macrophages promotes angiogenesis in glioma. Cancer Res. 2014, 74, 7285–7297. [Google Scholar] [CrossRef]
- Agnihotri, S.; Yang, K.; Mitchell, D.A.; Rich, J.N. A vaccine for glioma. Nat. Cancer 2021, 2, 584–586. [Google Scholar] [CrossRef] [PubMed]
- AZhang, L.; Xie, X.; Xie, P.; Yi, C.; Wang, Y. Immunotherapy for Glioma. J. Oncol. 2022, 2, 1023. [Google Scholar]
- Kantoff, P.W.; Higano, C.S.; Shore, N.D.; Berger, E.R.; Small, E.J.; Penson, D.F.; Redfern, C.H.; Ferrari, A.C.; Dreicer, R.; Sims, R.B. Sipuleucel-T immunotherapy for castration-resistant prostate cancer. N. Engl. J. Med. 2010, 363, 411–422. [Google Scholar] [CrossRef]
- Wheeler, C.J.; Black, K.L.; Liu, G.; Mazer, M.; Zhang, X.-x.; Pepkowitz, S.; Goldfinger, D.; Ng, H.; Irvin, D.; Yu, J.S. Vaccination elicits correlated immune and clinical responses in glioblastoma multiforme patients. Cancer Res. 2008, 68, 5955–5964. [Google Scholar] [CrossRef]
- Weller, M.; Butowski, N.; Tran, D.D.; Recht, L.D.; Lim, M.; Hirte, H.; Ashby, L.; Mechtler, L.; Goldlust, S.A.; Iwamoto, F. Rindopepimut with temozolomide for patients with newly diagnosed, EGFRvIII-expressing glioblastoma (ACT IV): A randomised, double-blind, international phase 3 trial. Lancet Oncol. 2017, 18, 1373–1385. [Google Scholar] [CrossRef]
- McNamara, M.A.; Nair, S.K.; Holl, E.K. RNA-based vaccines in cancer immunotherapy. J. Immunol. Res. 2015, 2015, 794528. [Google Scholar] [CrossRef]
- Shamshiripour, P.; Nikoobakht, M.; Mansourinejad, Z.; Ahmadvand, D.; Akbarpour, M. A comprehensive update to Dendritic Cell therapy for glioma: A systematic review and meta-analysis. Expert Rev. Vaccines 2022, 21, 513–531. [Google Scholar] [CrossRef]
- Yang, K.; Wu, Z.; Zhang, H.; Zhang, N.; Wu, W.; Wang, Z.; Dai, Z.; Zhang, X.; Zhang, L.; Peng, Y. Glioma targeted therapy: Insight into future of molecular approaches. Mol. Cancer 2022, 21, 39. [Google Scholar] [CrossRef]
- Oh, T.; Sayegh, E.T.; Fakurnejad, S.; Oyon, D.; Lamano, J.B.; DiDomenico, J.D.; Bloch, O.; Parsa, A.T. Vaccine therapies in malignant glioma. Curr. Neurol. Neurosci. Rep. 2015, 15, 508. [Google Scholar] [CrossRef] [Green Version]
- Sobhani, N.; Scaggiante, B.; Morris, R.; Chai, D.; Catalano, M.; Tardiel-Cyril, D.R.; Neeli, P.; Roviello, G.; Mondani, G.; Li, Y. Therapeutic cancer vaccines: From biological mechanisms and engineering to ongoing clinical trials. Cancer Treat. Rev. 2022, 109, 102429. [Google Scholar] [CrossRef] [PubMed]
- Chen, Z.; Wang, X.; Yan, Z.; Zhang, M. Identification of tumor antigens and immune subtypes of glioma for mRNA vaccine development. Cancer Med. 2022, 11, 2711–2726. [Google Scholar] [CrossRef] [PubMed]
- Wu, C.; Qin, C.; Long, W.; Wang, X.; Xiao, K.; Liu, Q. Tumor antigens and immune subtypes of glioblastoma: The fundamentals of mRNA vaccine and individualized immunotherapy development. J. Big Data 2022, 9, 92. [Google Scholar] [CrossRef] [PubMed]
- Mohme, M.; Neidert, M.C.; Regli, L.; Weller, M.; Martin, R. Immunological challenges for peptide-based immunotherapy in glioblastoma. Cancer Treat. Rev. 2014, 40, 248–258. [Google Scholar] [CrossRef]
- Weller, M.; Roth, P.; Preusser, M.; Wick, W.; Reardon, D.A.; Platten, M.; Sampson, J.H. Vaccine-based immunotherapeutic approaches to gliomas and beyond. Nat. Rev. Neurol. 2017, 13, 363–374. [Google Scholar] [CrossRef]
- Dutoit, V.; Herold-Mende, C.; Hilf, N.; Schoor, O.; Beckhove, P.; Bucher, J.; Dorsch, K.; Flohr, S.; Fritsche, J.; Lewandrowski, P. Exploiting the glioblastoma peptidome to discover novel tumour-associated antigens for immunotherapy. Brain 2012, 135, 1042–1054. [Google Scholar] [CrossRef]
- Ueda, R.; Fujita, M.; Zhu, X.; Sasaki, K.; Kastenhuber, E.R.; Kohanbash, G.; McDonald, H.A.; Harper, J.; Lonning, S.; Okada, H. Systemic Inhibition of Transforming Growth Factor-β in Glioma-Bearing Mice Improves the Therapeutic Efficacy of Glioma-Associated Antigen Peptide VaccinesTGF-β Blockade Enhances Efficacy of Glioma Vaccines. Clin. Cancer Res. 2009, 15, 6551–6559. [Google Scholar] [CrossRef]
- Antonios, J.P.; Soto, H.; Everson, R.G.; Orpilla, J.; Moughon, D.; Shin, N.; Sedighim, S.; Yong, W.H.; Li, G.; Cloughesy, T.F. PD-1 blockade enhances the vaccination-induced immune response in glioma. JCI Insight 2016, 1, e87059. [Google Scholar] [CrossRef]
- Jahan, N.; Talat, H.; Curry, W.T. Agonist OX40 immunotherapy improves survival in glioma-bearing mice and is complementary with vaccination with irradiated GM-CSF–expressing tumor cells. Neuro-Oncology 2018, 20, 44–54. [Google Scholar] [CrossRef]
- Schaller, T.H.; Sampson, J.H. Advances and challenges: Dendritic cell vaccination strategies for glioblastoma. Expert Rev. Vaccines 2017, 16, 27–36. [Google Scholar] [CrossRef] [Green Version]
- Lim, M.; Xia, Y.; Bettegowda, C.; Weller, M. Current state of immunotherapy for glioblastoma. Nat. Rev. Clin. Oncol. 2018, 15, 422–442. [Google Scholar] [CrossRef]
- Eagles, M.E.; Nassiri, F.; Badhiwala, J.H.; Suppiah, S.; Almenawer, S.A.; Zadeh, G.; Aldape, K.D. Dendritic cell vaccines for high-grade gliomas. Ther. Clin. Risk Manag. 2018, 14, 1299. [Google Scholar] [CrossRef]
- Ashley, D.M.; Faiola, B.; Nair, S.; Hale, L.P.; Bigner, D.D.; Gilboa, E. Bone marrow–generated dendritic cells pulsed with tumor extracts or tumor RNA induce antitumor immunity against central nervous system tumors. J. Exp. Med. 1997, 186, 1177–1182. [Google Scholar] [CrossRef]
- Sampson, J.H.; Archer, G.E.; Mitchell, D.A.; Heimberger, A.B.; Herndon, J.E.; Lally-Goss, D.; McGehee-Norman, S.; Paolino, A.; Reardon, D.A.; Friedman, A.H. An epidermal growth factor receptor variant III–targeted vaccine is safe and immunogenic in patients with glioblastoma multiforme. Mol. Cancer Ther. 2009, 8, 2773–2779. [Google Scholar] [CrossRef]
- Srinivasan, V.M.; Ferguson, S.D.; Lee, S.; Weathers, S.-P.; Kerrigan, B.C.P.; Heimberger, A.B. Tumor vaccines for malignant gliomas. Neurotherapeutics 2017, 14, 345–357. [Google Scholar] [CrossRef]
- Okada, H.; Kalinski, P.; Ueda, R.; Hoji, A.; Kohanbash, G.; Donegan, T.E.; Mintz, A.H.; Engh, J.A.; Bartlett, D.L.; Brown, C.K. Induction of CD8+ T-cell responses against novel glioma–associated antigen peptides and clinical activity by vaccinations with α-type 1 polarized dendritic cells and polyinosinic-polycytidylic acid stabilized by lysine and carboxymethylcellulose in patients with recurrent malignant glioma. J. Clin. Oncol. 2011, 29, 330. [Google Scholar]
- Phuphanich, S.; Wheeler, C.J.; Rudnick, J.D.; Mazer, M.; Wang, H.; Nuno, M.A.; Richardson, J.E.; Fan, X.; Ji, J.; Chu, R.M. Phase I trial of a multi-epitope-pulsed dendritic cell vaccine for patients with newly diagnosed glioblastoma. Cancer Immunol. Immunother. 2013, 62, 125–135. [Google Scholar] [CrossRef]
- Yamanaka, R.; Homma, J.; Yajima, N.; Tsuchiya, N.; Sano, M.; Kobayashi, T.; Yoshida, S.; Abe, T.; Narita, M.; Takahashi, M. Clinical evaluation of dendritic cell vaccination for patients with recurrent glioma: Results of a clinical phase I/II trial. Clin. Cancer Res. 2005, 11, 4160–4167. [Google Scholar] [CrossRef]
- Tanaka, S.; Louis, D.N.; Curry, W.T.; Batchelor, T.T.; Dietrich, J. Diagnostic and therapeutic avenues for glioblastoma: No longer a dead end? Nat. Rev. Clin. Oncol. 2013, 10, 14–26. [Google Scholar] [CrossRef]
- Hdeib, A.; Sloan, A.E. Dendritic cell immunotherapy for solid tumors: Evaluation of the DCVax® platform in the treatment of glioblastoma multiforme. CNS Oncol. 2015, 4, 63–69. [Google Scholar] [CrossRef]
- Liau, L.M.; Ashkan, K.; Tran, D.D.; Campian, J.L.; Trusheim, J.E.; Cobbs, C.S.; Heth, J.A.; Salacz, M.; Taylor, S.; D’Andre, S.D. First results on survival from a large Phase 3 clinical trial of an autologous dendritic cell vaccine in newly diagnosed glioblastoma. J. Transl. Med. 2018, 16, 142. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Ardon, H.; De Vleeschouwer, S.; Van Calenbergh, F.; Claes, L.; Kramm, C.M.; Rutkowski, S.; Wolff, J.E.; Van Gool, S.W. Adjuvant dendritic cell-based tumour vaccination for children with malignant brain tumours. Pediatr. Blood Cancer 2010, 54, 519–525. [Google Scholar] [CrossRef] [PubMed]
- Ardon, H.; Van Gool, S.W.; Verschuere, T.; Maes, W.; Fieuws, S.; Sciot, R.; Wilms, G.; Demaerel, P.; Goffin, J.; Van Calenbergh, F. Integration of autologous dendritic cell-based immunotherapy in the standard of care treatment for patients with newly diagnosed glioblastoma: Results of the HGG-2006 phase I/II trial. Cancer Immunol. Immunother. 2012, 61, 2033–2044. [Google Scholar] [CrossRef]
- De Vleeschouwer, S.; Fieuws, S.; Rutkowski, S.; Van Calenbergh, F.; Van Loon, J.; Goffin, J.; Sciot, R.; Wilms, G.; Demaerel, P.; Warmuth-Metz, M. Postoperative adjuvant dendritic cell–based immunotherapy in patients with relapsed glioblastoma multiforme. Clin. Cancer Res. 2008, 14, 3098–3104. [Google Scholar] [CrossRef] [PubMed]
- Walker, D.G.; Laherty, R.; Tomlinson, F.H.; Chuah, T.; Schmidt, C. Results of a phase I dendritic cell vaccine trial for malignant astrocytoma: Potential interaction with adjuvant chemotherapy. J. Clin. Neurosci. 2008, 15, 114–121. [Google Scholar] [CrossRef] [PubMed]
- Chang, C.-N.; Huang, Y.-C.; Yang, D.-M.; Kikuta, K.; Wei, K.-J.; Kubota, T.; Yang, W.-K. A phase I/II clinical trial investigating the adverse and therapeutic effects of a postoperative autologous dendritic cell tumor vaccine in patients with malignant glioma. J. Clin. Neurosci. 2011, 18, 1048–1054. [Google Scholar] [CrossRef] [PubMed]
- Parajuli, P.; Mathupala, S.; Sloan, A.E. Systematic comparison of dendritic cell-based immunotherapeutic strategies for malignant gliomas: In vitro induction of cytolytic and natural killer-like T cells. Neurosurgery 2004, 55, 1194–1204. [Google Scholar] [CrossRef]
- Qiu, S.-J.; Lu, L.; Qiao, C.; Wang, L.; Wang, Z.; Xiao, X.; Qian, S.; Fung, J.J.; Ye, S.-L.; Bonham, C.A. Induction of tumor immunity and cytotoxic t lymphocyte responses using dendritic cells transduced by adenoviral vectors encoding HBsAg: Comparison to protein immunization. J. Cancer Res. Clin. Oncol. 2005, 131, 429–438. [Google Scholar] [CrossRef]
- Vik-Mo, E.O.; Nyakas, M.; Mikkelsen, B.V.; Moe, M.C.; Due-Tønnesen, P.; Suso, E.M.I.; Sæbøe-Larssen, S.; Sandberg, C.; Brinchmann, J.E.; Helseth, E. Therapeutic vaccination against autologous cancer stem cells with mRNA-transfected dendritic cells in patients with glioblastoma. Cancer Immunol. Immunother. 2013, 62, 1499–1509. [Google Scholar] [CrossRef]
- Batich, K.A.; Reap, E.A.; Archer, G.E.; Sanchez-Perez, L.; Nair, S.K.; Schmittling, R.J.; Norberg, P.; Xie, W.; Herndon, J.E.; Healy, P. Long-term survival in glioblastoma with cytomegalovirus pp65-targeted vaccination. Clin. Cancer Res. 2017, 23, 1898–1909. [Google Scholar] [CrossRef]
- Chen, R.; Nishimura, M.C.; Bumbaca, S.M.; Kharbanda, S.; Forrest, W.F.; Kasman, I.M.; Greve, J.M.; Soriano, R.H.; Gilmour, L.L.; Rivers, C.S. A hierarchy of self-renewing tumor-initiating cell types in glioblastoma. Cancer Cell 2010, 17, 362–375. [Google Scholar] [CrossRef] [Green Version]
- Dziurzynski, K.; Chang, S.M.; Heimberger, A.B.; Kalejta, R.F.; McGregor Dallas, S.R.; Smit, M.; Soroceanu, L.; Cobbs, C.S. Consensus on the role of human cytomegalovirus in glioblastoma. Neuro-Oncology 2012, 14, 246–255. [Google Scholar] [CrossRef]
- Ayo, A.; Laakkonen, P. Peptide-based strategies for targeted tumor treatment and imaging. Pharmaceutics 2021, 13, 481. [Google Scholar] [CrossRef]
- Mathew, E.N.; Berry, B.C.; Yang, H.W.; Carroll, R.S.; Johnson, M.D. Delivering Therapeutics to Glioblastoma: Overcoming Biological Constraints. Int. J. Mol. Sci. 2022, 23, 1711. [Google Scholar] [CrossRef]
- Li, L.; Chen, J.; Ming, Y.; Li, B.; Fu, R.; Duan, D.; Li, Z.; Ni, R.; Wang, X.; Zhou, Y. The Application of Peptides in Glioma: A Novel Tool for Therapy. Curr. Pharm. Biotechnol. 2022, 23, 620–633. [Google Scholar] [CrossRef]
- Ahmed, S.; Hasan, M.M.; Aschner, M.; Mirzaei, H.; Alam, W.; Shah, S.M.M.; Khan, H. Therapeutic potential of marine peptides in glioblastoma: Mechanistic insights. Cell. Signal. 2021, 87, 110142. [Google Scholar] [CrossRef]
- Rosca, E.V.; Koskimaki, J.E.; Rivera, C.G.; Pandey, N.B.; Tamiz, A.P.; Popel, A.S. Anti-angiogenic peptides for cancer therapeutics. Curr. Pharm. Biotechnol. 2011, 12, 1101–1116. [Google Scholar] [CrossRef]
- Raucher, D. Tumor targeting peptides: Novel therapeutic strategies in glioblastoma. Curr. Opin. Pharmacol. 2019, 47, 14–19. [Google Scholar] [CrossRef]
- Dmitrieva, M.D.; Voitova, A.A.; Dymova, M.A.; Richter, V.A.; Kuligina, E.V. Tumor-targeting peptides search strategy for the delivery of therapeutic and diagnostic molecules to tumor cells. Int. J. Mol. Sci. 2020, 22, 314. [Google Scholar] [CrossRef]
- Boohaker, R.J.; Lee, M.W.; Vishnubhotla, P.; Perez, J.M.; Khaled, A.R. The use of therapeutic peptides to target and to kill cancer cells. Curr. Med. Chem. 2012, 19, 3794–3804. [Google Scholar] [CrossRef]
- Ellert-Miklaszewska, A.; Poleszak, K.; Kaminska, B. Short peptides interfering with signaling pathways as new therapeutic tools for cancer treatment. Future Med. Chem. 2017, 9, 199–221. [Google Scholar] [CrossRef] [PubMed]
- Seidi, K.; Neubauer, H.A.; Moriggl, R.; Jahanban-Esfahlan, R.; Javaheri, T. Tumor target amplification: Implications for nano drug delivery systems. J. Control. Release 2018, 275, 142–161. [Google Scholar] [CrossRef] [PubMed]
- Dissanayake, S.; Denny, W.A.; Gamage, S.; Sarojini, V. Recent developments in anticancer drug delivery using cell penetrating and tumor targeting peptides. J. Control. Release 2017, 250, 62–76. [Google Scholar] [CrossRef] [PubMed]
- Shin, M.C.; Zhang, J.; Min, K.A.; Lee, K.; Byun, Y.; David, A.E.; He, H.; Yang, V.C. Cell-penetrating peptides: Achievements and challenges in application for cancer treatment. J. Biomed. Mater. Res. Part A Off. J. Soc. Biomater. Jpn. Soc. Biomater. Aust. Soc. Biomater. Korean Soc. Biomater. 2014, 102, 575–587. [Google Scholar] [CrossRef]
- Schwarze, S.R.; Dowdy, S.F. In vivo protein transduction: Intracellular delivery of biologically active proteins, compounds and DNA. Trends Pharmacol. Sci. 2000, 21, 45–48. [Google Scholar] [CrossRef]
- Lindgren, M.; Hällbrink, M.; Prochiantz, A.; Langel, Ü. Cell-penetrating peptides. Trends Pharmacol. Sci. 2000, 21, 99–103. [Google Scholar] [CrossRef]
- Stupp, R.; Hegi, M.E.; Mason, W.P.; Van Den Bent, M.J.; Taphoorn, M.J.; Janzer, R.C.; Ludwin, S.K.; Allgeier, A.; Fisher, B.; Belanger, K. Effects of radiotherapy with concomitant and adjuvant temozolomide versus radiotherapy alone on survival in glioblastoma in a randomised phase III study: 5-Year analysis of the EORTC-NCIC trial. Lancet Oncol. 2009, 10, 459–466. [Google Scholar] [CrossRef]
- O’Rourke, D.M.; Nasrallah, M.P.; Desai, A.; Melenhorst, J.J.; Mansfield, K.; Morrissette, J.J.; Martinez-Lage, M.; Brem, S.; Maloney, E.; Shen, A. A single dose of peripherally infused EGFRvIII-directed CAR T cells mediates antigen loss and induces adaptive resistance in patients with recurrent glioblastoma. Sci. Transl. Med. 2017, 9, eaaa0984. [Google Scholar] [CrossRef] [Green Version]
Standard Management | |||
---|---|---|---|
Category | Therapy | Mechanisms of Action | References |
Current treatments | Surgical resection | Removing the possible amount of tumor in almost all types of gliomas. | [121] |
Radiation | Using high-energy beams after surgery, mainly in high-grade gliomas. | [122] | |
Chemotherapy with Temozolomide (TMZ) | Binding to the genome, preventing the tumor cell growth and division. | [123] | |
Tumor-treating fields (TTF) with bevacizumab | Selectively using an electromagnetic field with bevacizumab targeting vascular endothelial growth factor (VEGF). | [124] | |
Future Directions | |||
Therapy (Study Numbers) | Mechanisms of Action | References | |
Checkpoint inhibitors | Immune checkpoint inhibitors Programmed cell death protein 1 (PD-1/CD279)
|
| [125,126,127,128,129,130,131] |
Immunostimulatory gene therapy | Oncolytic viral (OV) therapy
|
| [132,133,134] |
Suicide gene therapy
|
| [135,136] | |
Cytokine therapy
|
| [137,138,139] | |
Adjuvant therapy | Tumor-associated macrophages (TAMs) therapy
|
| [140,141,142,143,144] |
Passive immunotherapy | Chimeric antigen receptors (CARs) therapy
|
| [145,146,147,148,149,150] |
Antibodies
|
| [151] | |
Active immunotherapy | EGFRvIII-mediated vaccine
|
| [152] |
Tumor cell vaccines
|
| [153,154] | |
Dendritic cell vaccines (DCVs)
|
| [155,156,157] | |
Epigenome therapy | Inhibitors of mutant IDH (mtIDHi)
|
| [158,159] |
Combinational therapy | Combinations of multiple checkpoint inhibitors
|
| [160,161] |
Checkpoint inhibitors combined with other immunotherapies
|
| [162,163,164,165] | |
Targeting immunosuppression in the tumor microenvironment
|
| [166,167] | |
Combinations of multiple immunostimulatory gene therapies
|
| [168] | |
Immunostimulatory gene therapy combined with other immunotherapies
|
| [169,170] | |
Vaccination combined with immune stimulatory adjuvants
|
| [171,172] | |
Vaccination combined with other immunotherapies
|
| [173] | |
Miscellaneous | Nanoparticle formulations
|
| [174,175] |
BBB disruptive therapies
|
| [176] | |
Exosomes
|
| [177,178] |
Peptide Name | Peptide Category | Sequence | Target | Carrier/Conjugate | Cargo/Drug | Ref |
---|---|---|---|---|---|---|
Angiopep-2 (ANG) | Tumor-homing peptides | TFFYGGSRGKRNNFKTEEY | Low density lipoprotein receptor | poly (ethylene glycol)-co-poly(ε-caprolactone) nanoparticles (PEG-PCL) copolymer nanoparticles (ANG-NP) | Paclitaxel (ANG1005) | [192,193] |
Angiopep-2 (ANG) | Tumor-homing peptides | TFFYGGSRGKRNNFKTEEY | Low density lipoprotein receptor | Cell penetrating peptides: PepFect 14 (PF14) (PF14:TG1) | siRNA | [194] |
Angiopep-2 (ANG) | Tumor-homing peptides | TFFYGGSRGKRNNFKTEEY | Low density lipoprotein receptor | Angiopep-conjugated liposome (ANG-CLP) | human tumor necrosis factor-related apoptosis-inducing ligand (pEGFP-hTRAIL) and paclitaxel (PTX) | [195,196] |
Angiopep-2 (ANG) | Tumor-homing peptides | TFFYGGSRGKRNNFKTEEY | Low density lipoprotein receptor | PEGylated oxidized multi-walled carbon nanotubes (O-MWNTs) | doxorubicin | [197] |
Angiopep-2 (ANG) | Tumor-homing peptides | TFFYGGSRGKRNNFKTEEY | Low density lipoprotein receptor | PAMAM dendrimers | Combination of Doxorubicin and borneol | [198] |
Angiopep-2 (ANG) | Tumor-homing peptides | TFFYGGSRGKRNNFKTEEY | Low density lipoprotein receptor | Gold nanoparticles (PEG-DOX-AuNPs) | doxorubicin | [199] |
Chlorotoxin | Tumor-homing peptides | MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR | Matrix metalloproteinase-2 (MMP-2) | nanovector | Green fluorescent protein (GFP) encoding DNA | [200] |
Chlorotoxin | Tumor-homing peptides | MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR | Matrix metalloproteinase-2 (MMP-2) | Loaded liposomes | Doxorubicin | |
Pep-1L | Tumor-homing peptides | ACGEMGWGWVRCGGSLCW | interleukin 13 receptor a2 (IL13Ra2) | Direct conjugation | Actinium-225, an alpha particle emitter | [201] |
Pep-1L | Tumor-homing peptides | ACGEMGWGWVRCGGSLCW | interleukin 13 receptor a2 (IL13Ra2) | PEGylated nanoparticles | Paclitaxel | [202] |
CooP | Tumor-homing peptides | CGLSGLGVA | FABP3/MDGI | PEG–PLA nanoparticles | paclitaxel | [203] |
ACooPK | Tumor-homing peptides | ACGLSGLGVAK | FABP3/MDGI | [204] | ||
T12 | Tumor-homing peptides | THRPPMWSPVWP | Transferrin receptor (TRf) | |||
AP | Tumor-homing peptides | CRKRLDRNC | Interleukin-4 Receptor (IL-4R) | Gas (SF6)-filled microbubbles (MBs) | doxorubicin (Dox)-loaded nano-sized liposome | [205] |
LP4 | Peptides targeting aberrant cellular signaling pathways | SWTWEKKLETAVNLAW TAGNSNKWTWK | voltage-dependent anion channel 1 (VDAC1) | Cell-penetrating peptide Antp (Antp-LP4) | Direct inhibition | [206] |
NBD | Peptides targeting aberrant cellular signaling pathways | TALDWSWLQTE | NEMO-binding domain (NBD)] | Cell-penetrating peptide Antp (Antp-LP4) | Direct inhibition of NF-kB | [207] |
H1 | Peptides targeting aberrant cellular signaling pathways | WPGSGNELKRAFAALRDQI | c-Myc | Elastin-like polypeptide (ELP) and penetrating peptide (Bac-ELP-H1) | Direct inhibition of c-Myc transcriptional activity | [208] |
TAT peptide | Cell-penetrating peptides | GRKKRRQRRRPQ | Transactivator of transcription (TAT) | Polyamidoamine (PAMAM) | siRNA suppression of EGFR expression | [209] |
TAT peptide | Cell-penetrating peptides | GRKKRRQRRRPQ | Transactivator of transcription (TAT) of human immunodeficiency virus | Liposomes | plasmid encoding green fluorescent protein (pEGFP-N1) | [210] |
Syn B | Cell-penetrating peptides | RGGRLSYSRRRFSTSTGR | Antimicrobial peptide protegrin 1 (PG-1) | Direct conjugation | Doxorubicin Benzylpenicillin (B-Pc) | [211,212] |
Penetratin peptide (Antp) | Cell-penetrating peptides | RQIKIWFQNRRMKWKK | Transcription factor antennapedia | Direct conjugation | Doxorubicin | [211] |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Karami Fath, M.; Babakhaniyan, K.; Anjomrooz, M.; Jalalifar, M.; Alizadeh, S.D.; Pourghasem, Z.; Abbasi Oshagh, P.; Azargoonjahromi, A.; Almasi, F.; Manzoor, H.Z.; et al. Recent Advances in Glioma Cancer Treatment: Conventional and Epigenetic Realms. Vaccines 2022, 10, 1448. https://doi.org/10.3390/vaccines10091448
Karami Fath M, Babakhaniyan K, Anjomrooz M, Jalalifar M, Alizadeh SD, Pourghasem Z, Abbasi Oshagh P, Azargoonjahromi A, Almasi F, Manzoor HZ, et al. Recent Advances in Glioma Cancer Treatment: Conventional and Epigenetic Realms. Vaccines. 2022; 10(9):1448. https://doi.org/10.3390/vaccines10091448
Chicago/Turabian StyleKarami Fath, Mohsen, Kimiya Babakhaniyan, Mehran Anjomrooz, Mohammadrasoul Jalalifar, Seyed Danial Alizadeh, Zeinab Pourghasem, Parisa Abbasi Oshagh, Ali Azargoonjahromi, Faezeh Almasi, Hafza Zahira Manzoor, and et al. 2022. "Recent Advances in Glioma Cancer Treatment: Conventional and Epigenetic Realms" Vaccines 10, no. 9: 1448. https://doi.org/10.3390/vaccines10091448