Next Article in Journal
Knowledge, Perception, and Acceptance of HPV Vaccination and Screening for Cervical Cancer among Saudi Females: A Cross-Sectional Study
Previous Article in Journal
Coronavirus Disease 2019 (COVID-19) Reinfection Rates in Malawi: A Possible Tool to Guide Vaccine Prioritisation and Immunisation Policies
 
 
Search for Articles:
Title / Keyword
Author / Affiliation / Email
Journal
Article Type
 
 
Advanced Search
 
Section
Special Issue
Volume
Issue
Number
Page
 
Journals
Vaccines
Volume 11
Issue 7
10.3390/vaccines11071187
vaccines-logo
Submit to this Journal Review for this Journal Propose a Special Issue
► Article Menu

Article Menu

share Share announcement Help format_quote Cite question_answer Discuss in SciProfiles thumb_up
...
Endorse textsms
...
Comment
first_page
settings
Order Article Reprints
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Adenovirus Transcriptome in Human Cells Infected with  ChAdOx1-Vectored Candidate HIV-1 Vaccine Is Dominated by High Levels of Correctly Spliced HIVconsv1&62 Transgene RNA

by
David A. Matthews
1,*,
Rachel Milligan
1,
Edmund G. Wee
2 and
Tomáš Hanke
2,3,*
1
School of Cellular and Molecular Medicine, Faculty of Life Sciences, University of Bristol, Bristol BS8 1TD, UK
2
The Jenner Institute, Nuffield Department of Medicine, University of Oxford, Oxford OX3 7DQ, UK
3
Joint Research Center for Human Retrovirus Infection, Kumamoto University, Kumamoto 860-0811, Japan
*
Authors to whom correspondence should be addressed.
Vaccines 2023, 11(7), 1187; https://doi.org/10.3390/vaccines11071187
Submission received: 21 May 2023 / Revised: 25 June 2023 / Accepted: 28 June 2023 / Published: 1 July 2023
(This article belongs to the Section HIV Vaccines)
Browse Figures
Review Reports Versions Notes

Abstract

:
We develop candidate HIV-1 vaccines, of which two components, ChAdOx1.tHIVconsv1 (C1) and ChAdOx1.HIVconsv62 (C62), are delivered by the simian adenovirus-derived vaccine vector ChAdOx1. Aberrant adenovirus RNA splicing involving transgene(s) coding for the SARS-CoV-2 spike was suggested as an aetiology of rare adverse events temporarily associated with the initial deployment of adenovirus-vectored vaccines during the COVID-19 pandemic. Here, to eliminate this theoretically plausible splicing phenomenon from the list of possible pathomechanisms for our HIV-1 vaccine candidates, we directly sequenced mRNAs in C1- and C62-infected nonpermissive MRC-5 and A549 and permissive HEK293 human cell lines. Our two main observations in nonpermissive human cells, which are most similar to those which become infected after the intramuscular administration of vaccines into human volunteers, were that (i) the dominant adenovirus vector-derived mRNAs were the expected transcripts coding for the HIVconsvX immunogens and (ii) atypical splicing events within the synthetic open reading frame of the two transgenes are rare. We conclude that inadvertent RNA splicing is not a safety concern for the two tested candidate HIV-1 vaccines.

1. Introduction

The overall safety profile of licensed vaccines is typically thoroughly established, and their risk–benefit ratio is well in favor of the latter. As of January 2023, the administration of over 13.2 billion of vaccine doses against COVID-19 inevitably associated vaccines with undesirable rare adverse events (AEs) [1,2,3,4,5]. The background incidence rates of various conditions in the population and the large numbers of individuals being vaccinated placed some of these AEs in the post-vaccination time window by chance. However, determining causal links is inherently difficult. On an individual case report level, the close temporal relationship between vaccination and the presenting symptoms, biological plausibility and extensive diagnostic efforts aiming to exclude other causes often fulfil the World Health Organization’s criteria for causality and lead to the assessment of these AEs as likely to be due to the vaccination [6]. On a population level, establishing causal links requires large epidemiological studies [7]. Thus, a claim for a causal association between the treatment and AE is always strongly supported by a pathomechanistic explanation for the reported symptoms. The absence of such an explanation diminishes the tested possibilities and strengthens the vaccine safety profile.
Adenoviruses are genetically stable viruses with a linear double-stranded DNA genome, which have been explored as vaccine vectors for several decades [8,9]. ChAdOx1 is a purpose-engineered vaccine vector derived from simian adenovirus 23 (Y25) of Mastadenovirus group E [10,11]. Deletion in early region E1 of the adenovirus genome rendered ChAdOx1 growth-deficient and further deletion of the nonessential E3 locus enlarged the “cargo” space for an insert coding for the vaccine immunogen to approximately 7 kilobase pairs [12]. Growth, including the Good Manufacturing Practice preparation of ChAdOx1-vectored vaccines for use in humans, is only possible in cell lines providing the essential E1 transcription factor function in trans [13,14]. In contrast, the ChAdOx1 vector cannot replicate and produce infectious progeny in the infected cells of vaccine recipients. Thus, the main function of ChAdOx1 is to efficiently deliver the pathogen-derived transgene into the host cells for the production of the protein immunogen. Such one-cycle vaccines mimic natural virus infection and efficiently induce both pathogen-specific CD8 T cells and antibodies [9,11,15,16,17,18,19,20,21,22].
RNA splicing was first discovered during studies of human adenoviruses, which are known for their complex splicing patterns of transcribed virus-derived RNAs [23,24,25,26,27,28,29,30,31]. We recently published an analysis of the human adenovirus type 5 (HAdV-5) transcriptomic repertoire showing that a super complex array of splicing and polyadenylation events is possible in adenovirus-infected cells [32]. This observation has been confirmed [33] and expanded on by others including showing how this kind of analysis reveals previously unappreciated fusion proteins [34]. Indeed, this complexity of splicing has also been seen in fowl adenoviruses [35]. It is therefore not surprising that alternative splicing through splicing signals inadvertently generated during the design of the immunogen-coding inserts was suggested as a safety risk [36]. These novel splice RNA products may be the cause of the overproduction of unusual splice variants or chimeric protein(s), which theoretically may lead to presenting AEs [37,38]. To better understand this risk, we published an analysis of the widely used SARS-CoV-2 vaccine ChAdOx1 nCoV-19 and showed that the transgene was the dominant transcript in E1 noncomplementing human cell lines and that unwanted transcript variants were rare [39].
We are developing a candidate vaccine with the aim to induce protective killer T cells against HIV-1 [40,41]. Through iterative improvements informed mainly by human studies of the previous HIVA [42] and HIVconsv [43] vaccines, we have arrived at bi-valent immunogens collectively designated HIVconsvX, which utilize the six most functionally conserved regions of the HIV-1 proteome assembled into unique chimeric proteins [44]. Synthetic genes coding for the HIVconsvX immunogens are delivered by a heterologous prime-boost regimen of ChAdOx1 and poxvirus MVA. Hence, two computed, mutually complementing mosaic [45] immunogens, tHIVconsv1 and HIVconsv62, are expressed by the ChAdOx1 vector as a prime. This work is about the candidate HIV-1 vaccines. We set out to assess the transcriptomic repertoire associated with the ChAdOx1-carried transgenes to increase confidence in the vaccines’ safety. Because algorithms predicting splicing are notoriously unreliable, here we analyzed the transcriptomes of the ChAdOx1.tHIVconsv1 and ChAdOx1.HIVconsv62 vaccines in infected nonpermissive and permissive human cell lines using long-read direct RNA sequencing.

2. Materials and Methods

2.1. A Brief Description of the Vector and Vaccine Inserts

The ChAdOx1 vector is derived from simian adenovirus 23 (Y25) and has deletions of the E1 and E3 early regions. In addition, E4 region open reading frames (ORFs) 4, 6 and 6/7 were replaced by the corresponding regions of HAdV-5 to improve virus yield. The vaccine inserts were designed as follows. First, curated HIV-1 proteomes of full-size proteins within group M (major) of global isolates present in the Los Alamos National Laboratory HIV Sequence Database in September 2013 were aligned and computed into two mutually complementing amino acid sequences using the Mosaic Algorithm [45]. Then, the six most-conserved regions in the HIV-1 Gag and Pol proteins were selected and assembled into tHIVconsv1 (mosaic 1) and HIVconsv62 (mosaic 2) proteins (Figure 1). These differ in approximately 10% of amino acids and together reach a perfect match of 80% of potential 9-mer T-cell epitopes (PTEs) [46,47] between the bi-valent vaccine and all the input HIV-1 isolates. This is an important feature of HIV-1 vaccines, which must effectively tackle HIV-1 variability. A small “t” in the tHIVconsv1 name indicates the presence of the human tissue plasminogen activator signal sequence [48]. Both ORFs use humanized codons [49,50] and, with adjustments, code for 895 (tHIVconsv1) and 884 (HIVconsv62) amino acids. These are inserted into the E1 locus of the adenovirus genome and are under the control of the strong early cytomegalovirus promoter [51] without the addition of upstream intron A (which was used in ChAdOx1 nCoV-19). The codon optimization for expression in human cells and reshuffle of the six conserved regions into unique chimeric proteins provide ample possibilities for newly generated features [52] including splicing signals. The ChAdOx1.tHIVconsv1 (C1) vaccine was safe and immunogenic in recently completed clinical trials (NCT04586673 and NCT04553016). ChAdOx1.HIVconsv62 (C62) entered the first-in-human trial in 2022 (NCT05604209) and there are several further trials in the clinical development program of HIVconsvX vaccines. Nevertheless, it was prudent to interrogate the C1 and C62 transcriptome in human cells to reinforce confidence in the vaccine’s safety.

2.2. Preparation of the ChAdOx1.tHIVconsv1 and ChAdOx1.HIVconsv62 Vaccine Stocks

The rescue and preparation of the adenovirus stocks of vaccines ChAdOx1.tHIVconsv1 (C1) and ChAdOx1.HIVconsv62 (C62) were described before [44,53]. Briefly, the C1 and C62 vaccines were grown in HEK293-derived T-REX cells (ThermoFisher, Horsham, UK), purified in a multistep process involving equilibrium ultracentrifugation through a CsCl density gradient or by anion exchange chromatography on Source 15Q resin, respectively, the presence of the transgene was confirmed by indicative PCRs, and the virus stocks were titred and stored at −80 °C until use.

2.3. Cell Lines and Virus Infection

The adenovirus transcriptome was analyzed in human MRC-5 cells [56], which is a genetically normal male human lung fibroblast-like cell line isolated from a 14-week-old embryo, A549 cells [57], which are a human male lung epithelial-like continuous cell line derived from carcinomatous tissue, and HEK293 cells [13], which are a human embryonic kidney epithelial cell line immortalized by the integrated HAdV-5 E1 region. All cell lines were obtained from the European Collection of Authenticated Cell Cultures (ECACC). The cells were cultured in the DMEM-10 medium (DMEM supplemented with 10% foetal bovine serum (FBS), 100 U/mL penicillin and 100 µg/mL streptomycin), infected at the confluence with each of the ChAdOx1-vectored viruses at a multiplicity of infection (MOI) of 10 to achieve synchronous infection and harvested for the extraction of RNA at 48 h post-infection for the MRC-5 and A549 cell lines and 24 h post-infection from the HEK293 cell line.

2.4. RNA Preparation and Sequencing

Total cellular RNA was extracted from harvested infected cells using the TRIzolTM reagent (Cat. No. 15596026, Ambion, ThermoFisher, Horsham, UK) at 1 mL per 107 cells, washed twice with 70% ice-cold ethanol and stored at –80 °C under 70% ethanol until use. On the day of sequencing, RNA was resuspended in sterile water, enriched for polyadenylated RNA and sequenced as described previously using the SQK-RNA002 kit and MINI06D R9 version of the flow cells (Oxford Nanopore Technologies, Oxford, UK) according to the vendors’ protocols [32].

2.5. Viral Transcriptome and Data Analysis

Open-reading-frame-centric data analysis of the transcriptome was described before [32]. Briefly, minimap2 [58] was used to map the transcripts to the adenoviral genome. The data were used to link the transcripts to the commonly used adenovirus transcription starts and termination locations together with the splice acceptor and donor sites. Based on these parameters, each transcript was assigned to a transcript group and its frequency was registered. These data were then used to assess the transcriptomic repertoire based on the genomic sequences, transcription start sites and features predicted to be present in the vaccine genomes and analyzed for each transcription group. The structure of each transcript group and its dominant transcript type coding for each ORF were detailed in the table of features provided. Finally, this workflow also produces a list of ORFs of proteins “not known” that are 5′ proximal for any given transcript group. Raw sequence files in fastq format, genome sequences and feature files are available at Zenodo (https://doi.org/10.5281/zenodo.36102480).

3. Results

3.1. The HIVconsvX mRNAs Dominate Vaccine Transcriptomes in Nonpermissive Cell Lines

Human A549 and MRC-5 cell lines are nonpermissive to the E1-deficient ChAdOx1 vector replication and were used to interrogate the vaccine-derived transcriptome. Cells were infected for 48 h and their total polyA RNA was enriched and sequenced using the nanopore technology. The overall sequence reads data are summarized in Table 1. In C1 vaccine-infected MRC-5 cells, the tHIVconsv1 transgene transcripts were dominant and there were no other detectable adenovirus-derived transcripts (Figure 2 and Table 2). In A549 infected cells, we were able to detect some evidence of vector backbone-derived transcripts, but these were relatively low in number (Figure 2 and Table 2). For the C62 virus-infected MRC-5 cells, again, we did not observe any full-length transcripts from the vector backbone (Figure 3 and Table 3). Similarly, in C62-infected A549 cells, we detected a range of low-level expressions of adenovirus-derived full-length transcripts. These were representative of a wide range of transcripts comparable to the C1 virus infection, but, again, they were all at low to very low levels (Figure 3 and Table 3). Low levels of rare mRNAs were detected with aberrant splicing or alternative polyadenylation site usage, but these were much below the levels of the dominant tHIVconsv1 or HIVconsv62 mRNA (Table 2 and Table 3). In contrast, there was essentially no adenovirus transcript in the MRC-5 cells (Figure 2 and Figure 3 and Table 2 and Table 3). Importantly, there was no evidence of an intron in either of the conserved mosaic transgenes. We can also confirm no detection of transcripts matching the HAdV-5 E1 transcription factors, thus confirming the absence of detectable replication-competent adenovirus (RCA) in the stock preparation.

3.2. HIVconsvX Vaccines Produce a Full Range of Adenovirus Transcripts in Permissive HEK293 Cells

In the HEK293 cells supplying the HAdV-5 E1 function in trans to the ChAdOx1 E1-deficient vector, a full range of adenovirus transcripts were detected (Figure 2 and Figure 3). Our ORF-centric pipeline confirmed a wide range of adenovirus transcripts and showed that the viral backbone transcripts dominate in this cell line (Table 4). Moreover, as expected, we were also able to detect adenovirus transcripts from the E1 region of the HAdV-5 genome that is integrated onto the HEK293 genome.

3.3. Minor Transcripts

There is a wide range of minor transcripts with unusual promoters, splicing pat-terns and/or polyadenylation sites derived from both C1 and C62 vaccines grown in HEK293 cells (Table S1). These are usually very rare in the A549 datasets (i.e., fewer than 10 transcripts per example) (Table S2) and typically not found at all in the MRC-5 infected cells (Table S3). We assessed the per cent of transcripts coming from the transgene promoter with unintended splice sites to be between 2.4% and 3.4% of the total transcripts from that promoter with no splicing (Tables S2 and S3). We did observe some unusual transcripts in HEK293 cells, which included a novel promoter driving the expression of pIX from a spliced transcript (Figure 4a,b). In addition, we noted a substantial number of transcripts driven from another promoter further upstream (Figure 4c,d), which could lead to the expression of a protein with no known homology (MLGMRWALWLLRRKEPAGARGGIDPSRYLDPAFLYKVVIDSTDRDRTS). This transcript is only present in the HEK293-derived dataset. A retrospective analysis of our published data from ChAdOx1 nCoV-19 transcripts in HEK293 cells [39] revealed the presence of this transcript in that dataset too. Without matching proteomics data, it is uncertain whether this protein is made in HEK293 cells or if it plays any role during viral infection, but there are no known homologues and this transcript was not present in the HAdV-5-infected HEK293 transcriptome [32].

4. Discussion

In the present work, we examined RNA transcriptomes of two candidate HIV-1 vaccines, ChAdOx1.tHIVconsv1 (C1) and ChAdOx1.HIVconsv62 (C62), using direct RNA sequencing to preempt any possible safety concerns about inadvertent splicing involving the engineered synthetic transgene ORFs, which could lead to the expression of unusual protein products and cause AEs [37,38,59,60]. Our first and most important conclusion is that unintended transcripts from the transgene region are very rare and therefore unlikely to be biologically significant. For both vaccines in nonpermissive MRC-5 cells, transcription was dominated by the correct desired tHIVconsv1 and HIVconsv62 mRNAs driven by a strong eukaryotic promoter of the inserted transgene expression cassette, while there was almost a complete absence of transcription from the viral backbone. We expect that this is the most likely scenario for the C1 and C62 vaccines injected intramuscularly into human volunteers. In A549 cells, there was some low-level transcription across the vector backbone with most vector-encoded genes represented by a few but less than 5% of total transcripts. Why the A549 cell line is more permissive for vector genome transcription is unclear but may have to do with a deletion in the CDKN2A locus and loss of cell cycle control [57]. However, a direct association between this deletion and adenovirus transcription in the absence of the E1 function remains to be formally proven. In contrast, a full range of well-described and abundant viral transcripts was readily detected in the E1-transcomplementing HEK293 cell line [61]. In this cell line, transcripts with novel irregular splice patterns and no known function were also found.
The presence of these very low-level transcripts should be seen in the context of the recent advances in RNA sequencing technologies. The short-read deep sequencing of fragmented RNA (RNAseq) has generated an accurate high-resolution image of the adenovirus transcriptome [27,31]; however, quantifying individual multiply spliced RNA molecules is problematic. In contrast, direct Nanopore sequencing (dRNAseq) pulls individual RNA molecules from their polyA tail to their 5′ end and reads the sequence as the nucleotides cross the nanopore [62,63,64,65]. Importantly, both technologies matched very well on the joint splice donor and acceptor sites and cross-validated each other [32]. dRNAseq not only revealed a much greater complexity of splicing in adenoviruses [31] but also found aberrant splicing even in the human cell and herpes simplex virus transcriptomes, as well as discontinuous transcription in coronaviruses [62,63,64,65]. Our previous analysis of the wild-type HAdV-5 transcriptome showed a broad range of extremely rare transcripts made during productive viral replication amounting to up to 11,000 unique species [32]. Nevertheless, despite the vast array of low-level transcriptional “junk”, the Mastadenovirus genus of viruses remains relatively innocuous from a pathological or public health standpoint [66].
Further reassurance of the safety of the C1 and C62 vaccines comes from the fact that the transcriptomes of these vaccines were very similar to ChAdOx1 nCOV-19 [36]. During the SARS-CoV-2 pandemic, we undertook a similar analysis of the ChAdOx1 nCOV-19 vaccine’s transcriptomic repertoire [39]. Concurrent with the results reported here, SARS-CoV-2 spike mRNA by far dominated any adenovirus transcripts, which was particularly obvious in nonpermissive cell lines. Aberrant splice patterns and polyadenylation site usage were very low and judged as biologically insignificant [39]. However, comparisons between the HIV-1 vaccines in this work and the COVID-19 vaccine are not straightforward as ChAdOx1 nCOV-19 was designed with intron A upstream of the spike ORF in addition to having different ORF DNA sequences. Re-analysis of the ChAdOx1 nCOV-19 data showed that only 3.6% of the transcripts derived from the transgene promoter had unexpected splicing events that would prevent the expression of the SARS-CoV-2 S protein. This is similar to the 2.4–3.4% of unexpected splicing events we observed for the C1 and C62 transcriptomes in this work. Since its first use, over 2 billion doses of the ChAdOx1 nCOV-19 vaccine have been administered, particularly in India, South America and Africa, without any reported evidence that rare aberrant splice variants of the spike transcript caused ill effects in vaccine recipients [67,68,69].
Direct sequencing of viral mRNA is above and beyond any previous or current regulatory licensing requirements for recombinant adenovirus-vectored vaccines. We believe that this approach to studying transcription from viral vaccines is a useful additional tool to increase our understanding of the transcriptomic repertoire of experimental engineered viral vectors and provide additional assurance regarding their safety profiles.

5. Conclusions

The ChAdOx1-vectored C1 and C62 vaccine components are administered with a heterologous MVA HIVconsvX boost for the induction of protective T cells [43]. This HIVconsvX T-cell vaccine strategy alone and in combination with other cutting-edge tools to stop or eradicate HIV-1 is tested in a comprehensive and growing developmental clinical program encompassing a series of trials in healthy uninfected individuals for prevention and people already living with HIV-1 for a cure. The results obtained in the present work enhance the safety profile of simian adenovirus-based vaccine components C1 and C62 by eliminating, or at least significantly diminishing, one potential, previously questioned pathological mechanism and increase the confidence in these vaccines should they be widely deployed as one of the tools for HIV-1 prevention and cure.

Supplementary Materials

The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/vaccines11071187/s1. Table S1: Transcriptome datasets of C1 and C62 in HEK293 cells; Table S2: Transcriptome datasets of C1 and C62 in A549 cells; Table S3: Transcriptome datasets of C1 and C62 in MRC-5 cells.

Author Contributions

Conceptualization, T.H. and D.A.M.; methodology, D.A.M. and R.M.; software, D.A.M.; validation, D.A.M. and R.M.; formal analysis, D.A.M. and R.M.; investigation, D.A.M., R.M. and E.G.W.; resources, D.A.M. and T.H.; data curation, D.A.M.; writing—original draft preparation, T.H. and D.A.M.; supervision, T.H. and D.A.M.; project administration, T.H. and D.A.M.; funding acquisition, T.H. All authors have read and agreed to the published version of the manuscript.

Funding

This research was jointly funded by the Medical Research Council U.K. and the U.K. Department for International Development under the MRC/DFID Concordat agreements (MR/N023668/1); the European and Developing Countries Clinical Trials Partnership (SRIA2015-1066); and the European Union’s Horizon 2020 Research and Innovation programme (grant agreement no. 681137-EAVI2020).

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

All data are provided with the manuscript.

Conflicts of Interest

The authors have no conflict of interest except for T.H., who is a co-inventor of the HIVconsvX immunogens protected under EP14846993.5 and PCT/US14/58422 (WO2015048785).

References

  1. Aleem, A.; Nadeem, A.J. Coronavirus (COVID-19) Vaccine-Induced Immune Thrombotic Thrombocytopenia (VITT). In StatPearls; StatPearls Publishing: Treasure Island, FL, USA, 2023. [Google Scholar]
  2. Greinacher, A.; Selleng, K.; Mayerle, J.; Palankar, R.; Wesche, J.; Reiche, S.; Aebischer, A.; Warkentin, T.E.; Muenchhoff, M.; Hellmuth, J.C.; et al. Anti-Platelet Factor 4 Antibodies Causing VITT do not Cross-React with SARS-CoV-2 Spike Protein. Blood 2021, 138, 1269–1277. [Google Scholar] [CrossRef] [PubMed]
  3. Greinacher, A.; Thiele, T.; Warkentin, T.E.; Weisser, K.; Kyrle, P.A.; Eichinger, S. Thrombotic Thrombocytopenia after ChAdOx1 nCov-19 Vaccination. N. Engl. J. Med. 2021, 384, 2092–2101. [Google Scholar] [CrossRef]
  4. Milevoj Kopcinovic, L.; Unic, A.; Nikolac Gabaj, N.; Miler, M.; Vrtaric, A.; Bozovic, M.; Stefanovic, M. Reactogenicity and Peak Anti-RBD-S1 IgG Concentrations in Individuals with No Prior COVID-19 Infection Vaccinated with Different SARS-CoV-2 Vaccines. Lab Med. 2023, lmad044. [Google Scholar] [CrossRef]
  5. Petito, E.; Gresele, P. VITT two years later: Should it still be in the scientific agenda? Thromb Haemost. 2023. [Google Scholar] [CrossRef] [PubMed]
  6. WHO. WHO Timeline-COVID-19. 2021. Available online: https://www.who.int/news/item/27-04-2020-who-timeline---covid-19 (accessed on 26 June 2023).
  7. Fernandes, J.; Jaggernauth, S.; Ramnarine, V.; Mohammed, S.R.; Khan, C.; Panday, A. Neurological Conditions Following COVID-19 Vaccinations: Chance or Association? Cureus 2022, 14, e21919. [Google Scholar] [CrossRef] [PubMed]
  8. Hanke, T.; Graham, F.L.; Rosenthal, K.L.; Johnson, D.C. Identification of an immunodominant cytotoxic T-lymphocyte recognition site in glycoprotein B of herpes simplex virus by using recombinant adenovirus vectors and synthetic peptides. J. Virol. 1991, 65, 1177–1186. [Google Scholar] [CrossRef] [Green Version]
  9. Tatsis, N.; Ertl, H.C. Adenoviruses as vaccine vectors. Mol. Ther. 2004, 10, 616–629. [Google Scholar] [CrossRef]
  10. Davison, A.J.; Benko, M.; Harrach, B. Genetic content and evolution of adenoviruses. J. Gen. Virol. 2003, 84, 2895–2908. [Google Scholar] [CrossRef]
  11. Dicks, M.D.J.; Spencer, A.J.; Edwards, N.J.; Wadell, G.; Bojang, K.; Gilbert, S.C.; Hill, A.V.S.; Cottingham, M.G. A novel chimpanzee adenovirus vector with low human seroprevalence: Improved systems for vector derivation and comparative immunogenicity. PLoS ONE 2012, 7, e40385. [Google Scholar] [CrossRef] [Green Version]
  12. Wold, W.S.; Toth, K. Adenovirus vectors for gene therapy, vaccination and cancer gene therapy. Curr. Gene Ther. 2013, 13, 421–433. [Google Scholar] [CrossRef] [Green Version]
  13. Graham, F.L.; Smiley, J.; Russell, W.C.; Nairn, R. Characteristics of a human cell line transformed by DNA from human adenovirus type 5. J. Gen. Virol. 1977, 36, 59–74. [Google Scholar] [CrossRef]
  14. Sanders, B.P.; Edo-Matas, D.; Custers, J.H.; Koldijk, M.H.; Klaren, V.; Turk, M.; Luitjens, A.; Bakker, W.A.; Uytdehaag, F.; Goudsmit, J.; et al. PER.C6((R)) cells as a serum-free suspension cell platform for the production of high titer poliovirus: A potential low cost of goods option for world supply of inactivated poliovirus vaccine. Vaccine 2013, 31, 850–856. [Google Scholar] [CrossRef] [PubMed]
  15. Antrobus, R.D.; Coughlan, L.; Berthoud, T.K.; Dicks, M.D.; Hill, A.V.; Lambe, T.; Gilbert, S.C. Clinical Assessment of a Novel Recombinant Simian Adenovirus ChAdOx1 as a Vectored Vaccine Expressing Conserved Influenza A Antigens. Mol. Ther. 2013, 22, 668–674. [Google Scholar] [CrossRef] [Green Version]
  16. Draper, S.J.; Biswas, S.; Spencer, A.J.; Remarque, E.J.; Capone, S.; Naddeo, M.; Dicks, M.D.; Faber, B.W.; de Cassan, S.C.; Folgori, A.; et al. Enhancing blood-stage malaria subunit vaccine immunogenicity in rhesus macaques by combining adenovirus, poxvirus, and protein-in-adjuvant vaccines. J. Immunol. 2012, 185, 7583–7595. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  17. Ewer, K.; Rampling, T.; Venkatraman, N.; Bowyer, G.; Wright, D.; Lambe, T.; Imoukhuede, E.B.; Payne, R.; Fehling, S.K.; Strecker, T.; et al. A Monovalent Chimpanzee Adenovirus Ebola Vaccine Boosted with MVA. N. Engl. J. Med. 2016, 374, 1635–1646. [Google Scholar] [CrossRef] [PubMed]
  18. Ewer, K.J.; O’Hara, G.A.; Duncan, C.J.; Collins, K.A.; Sheehy, S.H.; Reyes-Sandoval, A.; Goodman, A.L.; Edwards, N.J.; Elias, S.C.; Halstead, F.D.; et al. Protective CD8(+) T-cell immunity to human malaria induced by chimpanzee adenovirus-MVA immunisation. Nat. Commun. 2013, 4, 2836. [Google Scholar] [CrossRef] [Green Version]
  19. Madhavan, M.; Ritchie, A.J.; Aboagye, J.; Jenkin, D.; Provstgaad-Morys, S.; Tarbet, I.; Woods, D.; Davies, S.; Baker, M.; Platt, A.; et al. Tolerability and immunogenicity of an intranasally-administered adenovirus-vectored COVID-19 vaccine: An open-label partially-randomised ascending dose phase I trial. EBioMedicine 2022, 85, 104298. [Google Scholar] [CrossRef]
  20. O’Hara, G.A.; Duncan, C.J.; Ewer, K.J.; Collins, K.A.; Elias, S.C.; Halstead, F.D.; Goodman, A.L.; Edwards, N.J.; Reyes-Sandoval, A.; Bird, P.; et al. Clinical assessment of a recombinant simian adenovirus ChAd63: A potent new vaccine vector. J. Infect. Dis. 2012, 205, 772–781. [Google Scholar] [CrossRef]
  21. Rampling, T.; Ewer, K.J.; Bowyer, G.; Bliss, C.M.; Edwards, N.J.; Wright, D.; Payne, R.O.; Venkatraman, N.; de Barra, E.; Snudden, C.M.; et al. Safety and High Level Efficacy of the Combination Malaria Vaccine Regimen of RTS,S/AS01B With Chimpanzee Adenovirus 63 and Modified Vaccinia Ankara Vectored Vaccines Expressing ME-TRAP. J. Infect. Dis. 2016, 214, 772–781. [Google Scholar] [CrossRef] [Green Version]
  22. Sheehy, S.H.; Duncan, C.J.; Elias, S.C.; Choudhary, P.; Biswas, S.; Halstead, F.D.; Collins, K.A.; Edwards, N.J.; Douglas, A.D.; Anagnostou, N.A.; et al. ChAd63-MVA-vectored blood-stage malaria vaccines targeting MSP1 and AMA1: Assessment of efficacy against mosquito bite challenge in humans. Mol. Ther. 2013, 20, 2355–2368. [Google Scholar] [CrossRef] [Green Version]
  23. Berget, S.M.; Moore, C.; Sharp, P.A. Spliced segments at the 5′ terminus of adenovirus 2 late mRNA. Proc. Natl. Acad. Sci. USA 1977, 74, 3171–3175. [Google Scholar] [CrossRef] [PubMed]
  24. Berget, S.M.; Sharp, P.A. A spliced sequence at the 5′-terminus of adenovirus late mRNA. Brookhaven Symp. Biol. 1977, 332–344. [Google Scholar]
  25. Chow, L.T.; Broker, T.R. The spliced structures of adenovirus 2 fiber message and the other late mRNAs. Cell 1978, 15, 497–510. [Google Scholar] [CrossRef]
  26. Chow, L.T.; Gelinas, R.E.; Broker, T.R.; Roberts, R.J. An amazing sequence arrangement at the 5′ ends of adenovirus 2 messenger RNA. Cell 1977, 12, 1–8. [Google Scholar] [CrossRef]
  27. Evans, V.C.; Barker, G.; Heesom, K.J.; Fan, J.; Bessant, C.; Matthews, D.A. De novo derivation of proteomes from transcriptomes for transcript and protein identification. Nat. Methods 2012, 9, 1207–1211. [Google Scholar] [CrossRef]
  28. Falvey, E.; Ziff, E. Sequence arrangement and protein coding capacity of the adenovirus type 2 “I” leader. J. Virol. 1983, 45, 185–191. [Google Scholar] [CrossRef] [Green Version]
  29. Ramke, M.; Lee, J.Y.; Dyer, D.W.; Seto, D.; Rajaiya, J.; Chodosh, J. The 5′UTR in human adenoviruses: Leader diversity in late gene expression. Sci. Rep. 2017, 7, 618. [Google Scholar] [CrossRef] [Green Version]
  30. Thomas, G.P.; Mathews, M.B. DNA replication and the early to late transition in adenovirus infection. Cell 1980, 22, 523–533. [Google Scholar] [CrossRef] [PubMed]
  31. Zhao, H.; Chen, M.; Pettersson, U. A new look at adenovirus splicing. Virology 2014, 456, 329–341. [Google Scholar] [CrossRef] [Green Version]
  32. Donovan-Banfield, I.; Turnell, A.S.; Hiscox, J.A.; Leppard, K.N.; Matthews, D.A. Deep splicing plasticity of the human adenovirus type 5 transcriptome drives virus evolution. Commun. Biol. 2020, 3, 124. [Google Scholar] [CrossRef] [Green Version]
  33. Westergren Jakobsson, A.; Segerman, B.; Wallerman, O.; Lind, S.B.; Zhao, H.; Rubin, C.J.; Pettersson, U.; Akusjarvi, G. The Human Adenovirus Type 2 Transcriptome: An Amazing Complexity of Alternatively Spliced mRNAs. J. Virol. 2021, 95, e01869-20. [Google Scholar] [CrossRef]
  34. Price, A.M.; Steinbock, R.T.; Lauman, R.; Charman, M.; Hayer, K.E.; Kumar, N.; Halko, E.; Lum, K.K.; Wei, M.; Wilson, A.C.; et al. Novel viral splicing events and open reading frames revealed by long-read direct RNA sequencing of adenovirus transcripts. PLoS Pathog. 2022, 18, e1010797. [Google Scholar] [CrossRef] [PubMed]
  35. Lu, Z.; Wang, Y.; Zou, X.; Hung, T. Analysis of Fowl Adenovirus 4 Transcriptome by De Novo ORF Prediction Based on Corrected Nanopore Full-Length cDNA Sequencing Data. Viruses 2023, 15, 529. [Google Scholar] [CrossRef] [PubMed]
  36. Folegatti, P.M.; Ewer, K.J.; Aley, P.K.; Angus, B.; Becker, S.; Belij-Rammerstorfer, S.; Bellamy, D.; Bibi, S.; Bittaye, M.; Clutterbuck, E.A.; et al. Safety and immunogenicity of the ChAdOx1 nCoV-19 vaccine against SARS-CoV-2: A preliminary report of a phase 1/2, single-blind, randomised controlled trial. Lancet 2020, 396, 467–478. [Google Scholar] [CrossRef] [PubMed]
  37. Kowarz, E.; Krutzke, L.; Kulp, M.; Streb, P.; Larghero, P.; Reis, J.; Bracharz, S.; Engler, T.; Kochanek, S.; Marschalek, R. Vaccine-induced COVID-19 mimicry syndrome. Elife 2022, 11, e74974. [Google Scholar] [CrossRef]
  38. Lundstrom, K.; Barh, D.; Uhal, B.D.; Takayama, K.; Aljabali, A.A.A.; Abd El-Aziz, T.M.; Lal, A.; Redwan, E.M.; Adadi, P.; Chauhan, G.; et al. COVID-19 Vaccines and Thrombosis-Roadblock or Dead-End Street? Biomolecules 2021, 11, 1020. [Google Scholar] [CrossRef]
  39. Almuqrin, A.; Davidson, A.D.; Williamson, M.K.; Lewis, P.A.; Heesom, K.J.; Morris, S.; Gilbert, S.C.; Matthews, D.A. SARS-CoV-2 vaccine ChAdOx1 nCoV-19 infection of human cell lines reveals low levels of viral backbone gene transcription alongside very high levels of SARS-CoV-2 S glycoprotein gene transcription. Genome Med. 2021, 13, 43. [Google Scholar] [CrossRef]
  40. McMichael, A.J.; Haynes, B.F. Lessons learned from HIV-1 vaccine trials: New priorities and directions. Nat. Immunol. 2012, 13, 423–427. [Google Scholar] [CrossRef] [Green Version]
  41. McMichael, A.J.; Koff, W.C. Vaccines that stimulate T cell immunity to HIV-1: The next step. Nat. Immunol. 2014, 15, 319–322. [Google Scholar] [CrossRef] [Green Version]
  42. Hanke, T.; Goonetilleke, N.; McMichael, A.J.; Dorrell, L. Clinical experience with plasmid DNA- and modified vaccinia vaccine Ankara (MVA)-vectored HIV-1 clade A vaccine inducing T cells. J. Gen. Virol. 2007, 88, 1–12. [Google Scholar] [CrossRef]
  43. Hanke, T. Aiming for protective T-cell responses: A focus on the first generation conserved-region HIVconsv vaccines in preventive and therapeutic clinical trials. Expert Rev. Vaccines 2019, 18, 1029–1041. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  44. Ondondo, B.; Murakoshi, H.; Clutton, G.; Abdul-Jawad, S.; Wee, E.G.; Gatanaga, H.; Oka, S.; McMichael, A.J.; Takiguchi, M.; Korber, B.; et al. Novel Conserved-region T-cell Mosaic Vaccine With High Global HIV-1 Coverage Is Recognized by Protective Responses in Untreated Infection. Mol. Ther. 2016, 24, 832–842. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  45. Fischer, W.; Perkins, S.; Theiler, J.; Bhattacharya, T.; Yusim, K.; Funkhouser, R.; Kuiken, C.; Haynes, B.; Letvin, N.L.; Walker, B.D.; et al. Polyvalent vaccines for optimal coverage of potential T-cell epitopes in global HIV-1 variants. Nat. Med. 2007, 13, 100–106. [Google Scholar] [CrossRef] [PubMed]
  46. Li, F.; Malhotra, U.; Gilbert, P.B.; Hawkins, N.R.; Duerr, A.C.; McElrath, J.M.; Corey, L.; Self, S.G. Peptide selection for human immunodeficiency virus type 1 CTL-based vaccine evaluation. Vaccine 2006, 24, 6893–6904. [Google Scholar] [CrossRef]
  47. Malhotra, U.; Li, F.; Nolin, J.; Allison, M.; Zhao, H.; Mullins, J.I.; Self, S.; McElrath, M.J. Enhanced detection of human immunodeficiency virus type 1 (HIV-1) Nef-specific T cells recognizing multiple variants in early HIV-1 infection. J. Virol. 2007, 81, 5225–5237. [Google Scholar] [CrossRef] [Green Version]
  48. Wang, J.Y.; Song, W.T.; Li, Y.; Chen, W.J.; Yang, D.; Zhong, G.C.; Zhou, H.Z.; Ren, C.Y.; Yu, H.T.; Ling, H. Improved expression of secretory and trimeric proteins in mammalian cells via the introduction of a new trimer motif and a mutant of the tPA signal sequence. Appl. Microbiol. Biotechnol. 2011, 91, 731–740. [Google Scholar] [CrossRef]
  49. Andre, S.; Seed, B.; Eberle, J.; Schraut, W.; Bultmann, A.; Haas, J. Increased immune response elicited by DNA vaccination with a synthetic gp120 sequence with optimized codon usage. J. Virol. 1998, 72, 1497–1503. [Google Scholar] [CrossRef] [Green Version]
  50. Castro-Chavez, F. Most Used Codons per Amino Acid and per Genome in the Code of Man Compared to Other Organisms According to the Rotating Circular Genetic Code. Neuroquantology 2011, 9, 500. [Google Scholar] [CrossRef] [Green Version]
  51. Thomsen, D.R.; Stenberg, R.M.; Goins, W.F.; Stinski, M.F. Promoter-regulatory region of the major immediate early gene of human cytomegalovirus. Proc. Natl. Acad. Sci. USA 1984, 81, 659–663. [Google Scholar] [CrossRef]
  52. Hannoun, Z.; Wee, E.G.; Crook, A.; Colloca, S.; Di Marco, S.; Hanke, T. Adenovirus DNA Polymerase Loses Fidelity on a Stretch of Eleven Homocytidines during Pre-GMP Vaccine Preparation. Vaccines 2022, 10, 960. [Google Scholar] [CrossRef]
  53. Wee, E.G.; Moyo, N.; Hannoun, Z.; Giorgi, E.; Korber, B.; Hanke, T. Effect of Epitope Variant Co-delivery on the Depth of CD8 T-cell responses Induced by HIV-1 Conserved Mosaic Vaccines. Mol. Ther. Methods Clin. Dev. 2021, 21, 741–753. [Google Scholar] [CrossRef] [PubMed]
  54. Borthwick, N.; Ahmed, T.; Ondondo, B.; Hayes, P.; Rose, A.; Ebrahimsa, U.; Hayton, E.J.; Black, A.; Bridgeman, A.; Rosario, M.; et al. Vaccine-elicited human T cells recognizing conserved protein regions inhibit HIV-1. Mol. Ther. 2014, 22, 464–475. [Google Scholar] [CrossRef] [Green Version]
  55. Hanke, T.; Szawlowski, P.; Randall, R.E. Construction of solid matrix-antibody-antigen complexes containing simian immunodeficiency virus p27 using tag-specific monoclonal antibody and tag-linked antigen. J. Gen. Virol. 1992, 73, 653–660. [Google Scholar] [CrossRef] [PubMed]
  56. Jacobs, J.P.; Jones, C.M.; Baille, J.P. Characteristics of a human diploid cell designated MRC-5. Nature 1970, 227, 168–170. [Google Scholar] [CrossRef] [PubMed]
  57. Giard, D.J.; Aaronson, S.A.; Todaro, G.J.; Arnstein, P.; Kersey, J.H.; Dosik, H.; Parks, W.P. In vitro cultivation of human tumors: Establishment of cell lines derived from a series of solid tumors. J. Natl. Cancer Inst. 1973, 51, 1417–1423. [Google Scholar] [CrossRef]
  58. Li, H. Minimap2: Pairwise alignment for nucleotide sequences. Bioinformatics 2018, 34, 3094–3100. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  59. Bilotta, C.; Perrone, G.; Adelfio, V.; Spatola, G.F.; Uzzo, M.L.; Argo, A.; Zerbo, S. COVID-19 Vaccine-Related Thrombosis: A Systematic Review and Exploratory Analysis. Front. Immunol. 2021, 12, 729251. [Google Scholar] [CrossRef]
  60. Marietta, M.; Coluccio, V.; Luppi, M. Potential mechanisms of vaccine-induced thrombosis. Eur. J. Intern. Med. 2022, 105, 1–7. [Google Scholar] [CrossRef]
  61. Graves, D.; Akkerman, N.; Bachus, S.; Pelka, P. Differential Splicing of Human Adenovirus 5 E1A RNA Expressed in cis versus in trans. J. Virol. 2021, 95, e02081-20. [Google Scholar] [CrossRef]
  62. Depledge, D.P.; Srinivas, K.P.; Sadaoka, T.; Bready, D.; Mori, Y.; Placantonakis, D.G.; Mohr, I.; Wilson, A.C. Direct RNA sequencing on nanopore arrays redefines the transcriptional complexity of a viral pathogen. Nat. Commun. 2019, 10, 754. [Google Scholar] [CrossRef] [Green Version]
  63. Garalde, D.R.; Snell, E.A.; Jachimowicz, D.; Sipos, B.; Lloyd, J.H.; Bruce, M.; Pantic, N.; Admassu, T.; James, P.; Warland, A.; et al. Highly parallel direct RNA sequencing on an array of nanopores. Nat. Methods 2018, 15, 201–206. [Google Scholar] [CrossRef] [PubMed]
  64. Soneson, C.; Yao, Y.; Bratus-Neuenschwander, A.; Patrignani, A.; Robinson, M.D.; Hussain, S. A comprehensive examination of Nanopore native RNA sequencing for characterization of complex transcriptomes. Nat. Commun. 2019, 10, 3359. [Google Scholar] [CrossRef] [Green Version]
  65. Viehweger, A.; Krautwurst, S.; Lamkiewicz, K.; Madhugiri, R.; Ziebuhr, J.; Holzer, M.; Marz, M. Direct RNA nanopore sequencing of full-length coronavirus genomes provides novel insights into structural variants and enables modification analysis. Genome Res. 2019, 29, 1545–1554. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  66. Fields, B.N. Fields Virology, 5th ed.; Lippincott Williams & Wilkins: Philadelphia, PA, USA, 2007; Volume II. [Google Scholar]
  67. Joudeh, A.I.; Lutf, A.Q.; Mahdi, S.; Tran, G. Efficacy and safety of mRNA and AstraZeneca COVID-19 vaccines in patients with autoimmune rheumatic diseases: A systematic review. Vaccine 2023, 41, 3801–3812. [Google Scholar] [CrossRef]
  68. Mengstu, S.; Beyene Berha, A. Safety and Efficacy of COVID-19 Vaccine in Africa: Systematic Review. Infect. Drug Resist. 2023, 16, 3085–3100. [Google Scholar] [CrossRef] [PubMed]
  69. Tiozzo, G.; Louwsma, T.; Konings, S.R.A.; Vondeling, G.T.; Perez Gomez, J.; Postma, M.J.; Freriks, R.D. Evaluating the reactogenicity of COVID-19 vaccines from network-meta analyses. Expert Rev. Vaccines 2023, 22, 410–418. [Google Scholar] [CrossRef]
Vaccines 11 01187 g001 550
Figure 1. Derivation of the tHIVconsv1 and HIVconsv62 immunogens. Regions of the HIV-1 proteome selected based on their functional conservation (top) for inclusion in candidate T-cell vaccines ChAdOx1.tHIVconsv1 (C1) [44] and ChAdOx1.HIVconsv62 (C62) [53] were computed into mosaic 1 and mosaic 2 [45] (middle), which differ in about 10% of amino acids. Mosaics 1 and 2 are intended to be used together for vaccination to maximize the match of the vaccines to global group M HIV-1 isolates in terms of potential T-cell epitopes (a 9-mer amino acid window moving by 1 residue across the conserved regions). For each vaccine C1 and C62, the regions were ordered in a unique sequence to minimize induction of irrelevant junction-specific T-cell responses detected in a previous trial of a similar vaccine [54] (bottom) and the codons of the ORF nucleotides were humanized to enhance expression in vaccine recipients [49]. Regions derived from Gag are coloured purple and those from Pol are coloured green. N-terminal small “t”—human tPA signal sequence (in red); Pk—a C-terminal epitope (aka Pk or SV5 tag, in cyan) recognized by mAb SV5-P-k [55].
Figure 1. Derivation of the tHIVconsv1 and HIVconsv62 immunogens. Regions of the HIV-1 proteome selected based on their functional conservation (top) for inclusion in candidate T-cell vaccines ChAdOx1.tHIVconsv1 (C1) [44] and ChAdOx1.HIVconsv62 (C62) [53] were computed into mosaic 1 and mosaic 2 [45] (middle), which differ in about 10% of amino acids. Mosaics 1 and 2 are intended to be used together for vaccination to maximize the match of the vaccines to global group M HIV-1 isolates in terms of potential T-cell epitopes (a 9-mer amino acid window moving by 1 residue across the conserved regions). For each vaccine C1 and C62, the regions were ordered in a unique sequence to minimize induction of irrelevant junction-specific T-cell responses detected in a previous trial of a similar vaccine [54] (bottom) and the codons of the ORF nucleotides were humanized to enhance expression in vaccine recipients [49]. Regions derived from Gag are coloured purple and those from Pol are coloured green. N-terminal small “t”—human tPA signal sequence (in red); Pk—a C-terminal epitope (aka Pk or SV5 tag, in cyan) recognized by mAb SV5-P-k [55].
Vaccines 11 01187 g001
Vaccines 11 01187 g002 550
Figure 2. ChAdOx1.tHIVconsv1 (C1) transcriptomes in infected nonpermissive and permissive cell lines. The ChAdOx1 vector is missing adenovirus essential early region E1 and is, therefore, replication-defective in normal cells, such as MRC-5 and A549, which do not supply this function in trans. HEK293 cells carry an integrated HAdV-5 genome fragment, which supplies the E1 function and allows for the production of the full adenovirus transcriptome. A simplified schematic shows black transcripts originating from the top strand of the dsDNA viral genome (left to right) and blue RNA transcribed from the complementary strand (right to left). *, p < 0.05.
Figure 2. ChAdOx1.tHIVconsv1 (C1) transcriptomes in infected nonpermissive and permissive cell lines. The ChAdOx1 vector is missing adenovirus essential early region E1 and is, therefore, replication-defective in normal cells, such as MRC-5 and A549, which do not supply this function in trans. HEK293 cells carry an integrated HAdV-5 genome fragment, which supplies the E1 function and allows for the production of the full adenovirus transcriptome. A simplified schematic shows black transcripts originating from the top strand of the dsDNA viral genome (left to right) and blue RNA transcribed from the complementary strand (right to left). *, p < 0.05.
Vaccines 11 01187 g002
Vaccines 11 01187 g003 550
Figure 3. ChAdOx1.HIVconsv62 (C62) transcription maps in infected nonpermissive MRC-5 and A549 and permissive HEK293 cell lines. Please see the Figure 2 legend for details.
Figure 3. ChAdOx1.HIVconsv62 (C62) transcription maps in infected nonpermissive MRC-5 and A549 and permissive HEK293 cell lines. Please see the Figure 2 legend for details.
Vaccines 11 01187 g003
Vaccines 11 01187 g004 550
Figure 4. Unusual transcripts in C1- and C62-infected permissive E1-complementing HEK293 cells. A novel promoter was found to drive the expression of pIX from a spliced transcript in HEK293 cells infected with C1 (a) and C62 (b) with the main transcript highlighted in red. Several hundreds of transcripts were driven from another promoter further upstream as depicted in (c,d). Above, the schemes are the nucleotide positions in the C1 and C62 genomes. Three reading frames show the start (green) and stop (red) codon positions.
Figure 4. Unusual transcripts in C1- and C62-infected permissive E1-complementing HEK293 cells. A novel promoter was found to drive the expression of pIX from a spliced transcript in HEK293 cells infected with C1 (a) and C62 (b) with the main transcript highlighted in red. Several hundreds of transcripts were driven from another promoter further upstream as depicted in (c,d). Above, the schemes are the nucleotide positions in the C1 and C62 genomes. Three reading frames show the start (green) and stop (red) codon positions.
Vaccines 11 01187 g004
Table
Table 1. Number of reads for dRNAseq datasets.
Table 1. Number of reads for dRNAseq datasets.
SampleTotal ReadsLongest ReadAverage Read LengthMapped to Human TranscriptomeMapped to Vaccine Transcriptome—Average Length of Mapped Read:
Reads Mapped to E1 (HEK293 Cells Only)		Vaccine Mapped Reads as % of Human Mapped Reads
MRC-5C1 2d * 774,68723,3761510698,6706006:26310.9
C62 2d947,09525,7541557844,4372802:25860.3
A549C1 2d1064,85418,9311277961,9788899:25420.9
C62 2d552,20118,5221240482,8127015:24021.5
HEK293C1 1d992,84119,0321615487,145343,747:2011:78270.6
C62 1d1101,82723,9311637505,580460,727:2062:61791.1
* 1d or 2d—cells were infected for either one or two days, respectively, prior to the transcriptome analyses.
Table
Table 2. Gene transcription data for the C1 vaccine in nonpermissive MRC-5 and A549 cells.
Table 2. Gene transcription data for the C1 vaccine in nonpermissive MRC-5 and A549 cells.
FeatureCell Count MRC-5 Cells% Total MRC-5 CellsCell Count A549 Cells% Total A549 Cells
tHIVconsv1 399485.6569887.66
None from the list992.11572.42
DBP (E2A)00520.80
E4 orf300150.23
E4 orf20070.11
pIX0030.05
E4 orf40030.05
IVa20010.02
E4 orf10010.02
i-leader protein0010.02
100K (L4)0010.02
Table
Table 3. Gene transcription data for the C62 vaccine in nonpermissive MRC-5 and A549 cells.
Table 3. Gene transcription data for the C62 vaccine in nonpermissive MRC-5 and A549 cells.
FeatureCell Count MRC-5% of Total MRC-5 CellsCell Count A549 Cells% of Total A549 Cells
HIVconsv62180486.3371280.1
None from the list371.81042.2
DBP (E2A)00671.5
i-leader protein00160.4
E4 orf30080.2
Hexon (L3)0070.2
22K (L4)0060.1
E4 orf20040.1
52/55K (L1)0040.1
33K (L4)0040.1
pIX0040.09
IVa20030.06
Fibre (L5)0030.06
preVIII (L4)0020.04
E4 orf40020.04
Penton (L2)0020.04
UXP0010.02
preVII (L2)0010.02
100K (L4)0010.02
23K protease (L3)0010.02
preTP (E2B)0010.02
pV (L2)0010.02
Table
Table 4. Gene transcription data for the C1 and C62 vaccines in permissive HEK293 cells.
Table 4. Gene transcription data for the C1 and C62 vaccines in permissive HEK293 cells.
FeatureC1 VirusC62 Virus
Count% of TotalCount% of Total
Total of all reads186,526 275,053
Fibre (L5)20,31810.8938,68114.06
Hexon (L3)18,76310.0642,16015.33
preVII (L2)17,4599.3627,0619.84
tHIconsv1/HIVconsv6214,4427.7466172.41
33K full-length (L4)13,5987.2914,5695.30
None from list11,9606.4113,6764.97
pV (L2)92244.9413,0754.75
preX (L2)80524.3218,2376.63
100K (L4)71033.8182593.00
preVI (L3)56853.0592423.36
i-leader protein50822.7240931.49
IVa247092.5247021.71
DBP (E2A)45382.4338161.39
preVIII (L4)41512.2378382.85
52/55K (L1)40732.1840811.48
22K (L4)38722.0836361.32
penton base (L2)27461.4750771.85
preIIIa (L1)18591.0031441.14
pIX9110.4914270.52
23K protease (L3)5710.319590.35
E1b 19K3720.203090.11
E4 orf22850.151480.05
E4 orf31710.091320.05
E4 orf6/orf71140.06900.03
E4 orf41040.06570.02
E1a 13S780.04670.02
E4 orf1310.02210.01
E1a 12S240.01240.01
UXP190.013150.11
pIX ad5110.01100.004
E1b 22S (E1b 55K)30.00280.003
E1a 10S (171R)30.00230.001
E1a 9S20.00120.0007
E1b 13S (E1b-84R)10.000510.0003
E1b novel-84R10.000510.0003
preTP (E2B)00130.005
Pol (E2B)0090.003
E4 orf60040.001
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content.

Share and Cite

MDPI and ACS Style

Matthews, D.A.; Milligan, R.; Wee, E.G.; Hanke, T. Adenovirus Transcriptome in Human Cells Infected with  ChAdOx1-Vectored Candidate HIV-1 Vaccine Is Dominated by High Levels of Correctly Spliced HIVconsv1&62 Transgene RNA. Vaccines 2023, 11, 1187. https://doi.org/10.3390/vaccines11071187

AMA Style

Matthews DA, Milligan R, Wee EG, Hanke T. Adenovirus Transcriptome in Human Cells Infected with  ChAdOx1-Vectored Candidate HIV-1 Vaccine Is Dominated by High Levels of Correctly Spliced HIVconsv1&62 Transgene RNA. Vaccines. 2023; 11(7):1187. https://doi.org/10.3390/vaccines11071187

Chicago/Turabian Style

Matthews, David A., Rachel Milligan, Edmund G. Wee, and Tomáš Hanke. 2023. "Adenovirus Transcriptome in Human Cells Infected with  ChAdOx1-Vectored Candidate HIV-1 Vaccine Is Dominated by High Levels of Correctly Spliced HIVconsv1&62 Transgene RNA" Vaccines 11, no. 7: 1187. https://doi.org/10.3390/vaccines11071187

APA Style

Matthews, D. A., Milligan, R., Wee, E. G., & Hanke, T. (2023). Adenovirus Transcriptome in Human Cells Infected with  ChAdOx1-Vectored Candidate HIV-1 Vaccine Is Dominated by High Levels of Correctly Spliced HIVconsv1&62 Transgene RNA. Vaccines, 11(7), 1187. https://doi.org/10.3390/vaccines11071187

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop