Evaluation of the Safety and Immunogenicity of a Multiple Epitope Polypeptide from Canine Distemper Virus (CDV) in Mice
Abstract
:1. Introduction
2. Materials and Methods
2.1. Ethical Approval
2.2. Peptides and Reagents
2.3. Animals, Clinical Signs, and Safety
2.4. Mouse Immunization and Sacrifice
2.5. Splenocyte Isolation and Stimulation
2.6. Evaluation of the Splenocyte Population by Flow Cytometry
2.7. Cytokine Quantification by Cytometric Bead Assay (CBA)
2.8. In-House ELISA
2.9. Statistical Analysis
3. Results
3.1. Clinical Signs, Weight Loss and Clinical Following
3.2. Mice Immunized with the Multiepitope CDV Polypeptide Presented Increased Antigen-Specific IgG
3.3. The Multiepitope CDV Polypeptide Induces a Cellular Immune Response
3.4. Cytokine Production in Splenocytes Stimulated with the Multiepitope CDV Polypeptide
4. Discussion
5. Conclusions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Rendon-Marin, S.; da Fontoura Budaszewski, R.; Canal, C.W.; Ruiz-Saenz, J. Tropism and molecular pathogenesis of canine distemper virus. Virol. J. 2019, 16, 30. [Google Scholar] [CrossRef] [PubMed]
- Lempp, C.; Spitzbarth, I.; Puff, C.; Cana, A.; Kegler, K.; Techangamsuwan, S.; Baumgartner, W.; Seehusen, F. New aspects of the pathogenesis of canine distemper leukoencephalitis. Viruses 2014, 6, 2571–2601. [Google Scholar] [CrossRef] [PubMed]
- Kolakofsky, D. Paramyxovirus RNA synthesis, mRNA editing, and genome hexamer phase: A review. Virology 2016, 498, 94–98. [Google Scholar] [CrossRef] [PubMed]
- Iwatsuki, K.; Tokiyoshi, S.; Hirayama, N.; Nakamura, K.; Ohashi, K.; Wakasa, C.; Mikami, T.; Kai, C. Antigenic differences in the H proteins of canine distemper viruses. Vet. Microbiol. 2000, 71, 281–286. [Google Scholar] [CrossRef]
- Ross, P.; Nemec, P.S.; Kapatos, A.; Miller, K.R.; Holmes, J.C.; Suter, S.E.; Buntzman, A.S.; Soderblom, E.J.; Collins, E.J.; Hess, P.R. The canine MHC class Ia allele DLA-88*508:01 presents diverse self- and canine distemper virus-origin peptides of varying length that have a conserved binding motif. Vet. Immunol. Immunopathol. 2018, 197, 76–86. [Google Scholar] [CrossRef]
- MacLachlan, N.; Dubovi, E.; Fenner, F. Paramyxoviridae; Elsevier: Amsterdam, The Netherlands, 2011; pp. 299–325. [Google Scholar]
- Martinez-Gutierrez, M.; Ruiz-Saenz, J. Diversity of susceptible hosts in canine distemper virus infection: A systematic review and data synthesis. BMC Vet. Res. 2016, 12, 78. [Google Scholar] [CrossRef]
- Beineke, A.; Baumgartner, W.; Wohlsein, P. Cross-species transmission of canine distemper virus-an update. One Health 2015, 1, 49–59. [Google Scholar] [CrossRef]
- Wang, J.; Liu, L.; Zong, X.; Wang, C.; Zhu, G.; Yang, G.; Jiang, Y.; Yang, W.; Huang, H.; Shi, C.; et al. Immunogenicity and protective efficacy of a novel bacterium-like particle-based vaccine displaying canine distemper virus antigens in mice and dogs. Microbiol. Spectr. 2024, 12, e0347723. [Google Scholar] [CrossRef]
- Wilkes, R.P. Canine Distemper Virus in Endangered Species: Species Jump, Clinical Variations, and Vaccination. Pathogens 2022, 12, 57. [Google Scholar] [CrossRef]
- Pardo, M.C.; Tanner, P.; Bauman, J.; Silver, K.; Fischer, L. Immunization of puppies in the presence of maternally derived antibodies against canine distemper virus. J. Comp. Pathol. 2007, 137 (Suppl. S1), S72–S75. [Google Scholar] [CrossRef]
- Pardo, M.C.; Bauman, J.E.; Mackowiak, M. Protection of dogs against canine distemper by vaccination with a canarypox virus recombinant expressing canine distemper virus fusion and hemagglutinin glycoproteins. Am. J. Vet. Res. 1997, 58, 833–836. [Google Scholar] [CrossRef] [PubMed]
- Bronson, E.; Deem, S.L.; Sanchez, C.; Murray, S. Serologic response to a canarypox-vectored canine distemper virus vaccine in the giant panda (Ailuropoda melanoleuca). J. Zoo Wildl. Med. 2007, 38, 363–366. [Google Scholar] [CrossRef] [PubMed]
- Coke, R.L.; Backues, K.A.; Hoover, J.P.; Saliki, J.T.; Ritchey, J.W.; West, G.D. Serologic responses after vaccination of fennec foxes (Vulpes zerda) and meerkats (Suricata suricatta) with a live, canarypox-vectored canine distemper virus vaccine. J. Zoo Wildl. Med. 2005, 36, 326–330. [Google Scholar] [CrossRef] [PubMed]
- Wimsatt, J.; Biggins, D.; Innes, K.; Taylor, B.; Garell, D. Evaluation of oral and subcutaneous delivery of an experimental canarypox recombinant canine distemper vaccine in the Siberian polecat (Mustela eversmanni). J. Zoo Wildl. Med. 2003, 34, 25–35. [Google Scholar] [CrossRef] [PubMed]
- Stephensen, C.B.; Welter, J.; Thaker, S.R.; Taylor, J.; Tartaglia, J.; Paoletti, E. Canine distemper virus (CDV) infection of ferrets as a model for testing Morbillivirus vaccine strategies: NYVAC- and ALVAC-based CDV recombinants protect against symptomatic infection. J. Virol. 1997, 71, 1506–1513. [Google Scholar] [CrossRef]
- Sami, S.A.; Marma, K.K.S.; Mahmud, S.; Khan, M.A.N.; Albogami, S.; El-Shehawi, A.M.; Rakib, A.; Chakraborty, A.; Mohiuddin, M.; Dhama, K.; et al. Designing of a Multi-epitope Vaccine against the Structural Proteins of Marburg Virus Exploiting the Immunoinformatics Approach. ACS Omega 2021, 6, 32043–32071. [Google Scholar] [CrossRef]
- Jain, P.; Joshi, A.; Akhtar, N.; Krishnan, S.; Kaushik, V. An immunoinformatics study: Designing multivalent T-cell epitope vaccine against canine circovirus. J. Genet. Eng. Biotechnol. 2021, 19, 121. [Google Scholar] [CrossRef]
- Ali, M.; Pandey, R.K.; Khatoon, N.; Narula, A.; Mishra, A.; Prajapati, V.K. Exploring dengue genome to construct a multi-epitope based subunit vaccine by utilizing immunoinformatics approach to battle against dengue infection. Sci. Rep. 2017, 7, 9232. [Google Scholar] [CrossRef]
- Kimpston, C.N.; Hatke, A.L.; Castelli, B.; Otto, N.; Tiffin, H.S.; Machtinger, E.T.; Brown, J.D.; Van Why, K.R.; Marconi, R.T. High Prevalence of Antibodies against Canine Parvovirus and Canine Distemper Virus among Coyotes and Foxes from Pennsylvania: Implications for the Intersection of Companion Animals and Wildlife. Microbiol. Spectr. 2022, 10, e0253221. [Google Scholar] [CrossRef]
- Oleaga, A.; Vazquez, C.B.; Royo, L.J.; Barral, T.D.; Bonnaire, D.; Armenteros, J.A.; Rabanal, B.; Gortazar, C.; Balseiro, A. Canine distemper virus in wildlife in south-western Europe. Transbound. Emerg. Dis. 2022, 69, e473–e485. [Google Scholar] [CrossRef]
- Gilbert, M.; Sulikhan, N.; Uphyrkina, O.; Goncharuk, M.; Kerley, L.; Castro, E.H.; Reeve, R.; Seimon, T.; McAloose, D.; Seryodkin, I.V.; et al. Distemper, extinction, and vaccination of the Amur tiger. Proc. Natl. Acad. Sci. USA 2020, 117, 31954–31962. [Google Scholar] [CrossRef] [PubMed]
- Samimi Hashjin, A.; Sardari, S.; Rostamian, M.; Ahmadi, K.; Madanchi, H.; Khalaj, V. A new multi-epitope vaccine candidate based on S and M proteins is effective in inducing humoral and cellular immune responses against SARS-CoV-2 variants: An in silico design approach. J. Biomol. Struct. Dyn. 2023, 1–18. [Google Scholar] [CrossRef] [PubMed]
- Akhtar, N.; Kaushik, V.; Grewal, R.K.; Wani, A.K.; Suwattanasophon, C.; Choowongkomon, K.; Oliva, R.; Shaikh, A.R.; Cavallo, L.; Chawla, M. Immunoinformatics-Aided Design of a Peptide Based Multiepitope Vaccine Targeting Glycoproteins and Membrane Proteins against Monkeypox Virus. Viruses 2022, 14, 2374. [Google Scholar] [CrossRef] [PubMed]
- Poland, G.A.; Ovsyannikova, I.G.; Kennedy, R.B.; Haralambieva, I.H.; Jacobson, R.M. Vaccinomics and a new paradigm for the development of preventive vaccines against viral infections. OMICS 2011, 15, 625–636. [Google Scholar] [CrossRef] [PubMed]
- de la Fuente, J.; Contreras, M. Vaccinomics: A future avenue for vaccine development against emerging pathogens. Expert Rev. Vaccines 2021, 20, 1561–1569. [Google Scholar] [CrossRef]
- Yashvardhini, N.; Kumar, A.; Jha, D.K. Immunoinformatics Identification of B- and T-Cell Epitopes in the RNA-Dependent RNA Polymerase of SARS-CoV-2. Can. J. Infect. Dis. Med. Microbiol. 2021, 2021, 6627141. [Google Scholar] [CrossRef]
- Gu, Y.; Sun, X.; Li, B.; Huang, J.; Zhan, B.; Zhu, X. Vaccination with a Paramyosin-Based Multi-Epitope Vaccine Elicits Significant Protective Immunity against Trichinella spiralis Infection in Mice. Front. Microbiol. 2017, 8, 1475. [Google Scholar] [CrossRef]
- Kar, T.; Narsaria, U.; Basak, S.; Deb, D.; Castiglione, F.; Mueller, D.M.; Srivastava, A.P. A candidate multi-epitope vaccine against SARS-CoV-2. Sci. Rep. 2020, 10, 10895. [Google Scholar] [CrossRef]
- Tahir Ul Qamar, M.; Rehman, A.; Tusleem, K.; Ashfaq, U.A.; Qasim, M.; Zhu, X.; Fatima, I.; Shahid, F.; Chen, L.L. Designing of a next generation multiepitope based vaccine (MEV) against SARS-COV-2: Immunoinformatics and in silico approaches. PLoS ONE 2020, 15, e0244176. [Google Scholar] [CrossRef]
- Davoodi, S.; Bolhassani, A.; Namazi, F. In vivo delivery of a multiepitope peptide and Nef protein using novel cell-penetrating peptides for development of HIV-1 vaccine candidate. Biotechnol. Lett. 2021, 43, 547–559. [Google Scholar] [CrossRef]
- Sominskaya, I.; Skrastina, D.; Dislers, A.; Vasiljev, D.; Mihailova, M.; Ose, V.; Dreilina, D.; Pumpens, P. Construction and immunological evaluation of multivalent hepatitis B virus (HBV) core virus-like particles carrying HBV and HCV epitopes. Clin. Vaccine Immunol. 2010, 17, 1027–1033. [Google Scholar] [CrossRef] [PubMed]
- Stanekova, Z.; Vareckova, E. Conserved epitopes of influenza A virus inducing protective immunity and their prospects for universal vaccine development. Virol. J. 2010, 7, 351. [Google Scholar] [CrossRef]
- He, L.; Cheng, Y.; Kong, L.; Azadnia, P.; Giang, E.; Kim, J.; Wood, M.R.; Wilson, I.A.; Law, M.; Zhu, J. Approaching rational epitope vaccine design for hepatitis C virus with meta-server and multivalent scaffolding. Sci. Rep. 2015, 5, 12501. [Google Scholar] [CrossRef] [PubMed]
- Khan, S.; Khan, A.; Rehman, A.U.; Ahmad, I.; Ullah, S.; Khan, A.A.; Ali, S.S.; Afridi, S.G.; Wei, D.Q. Immunoinformatics and structural vaccinology driven prediction of multi-epitope vaccine against Mayaro virus and validation through in-silico expression. Infect. Genet. Evol. 2019, 73, 390–400. [Google Scholar] [CrossRef] [PubMed]
- Purcell, A.W.; McCluskey, J.; Rossjohn, J. More than one reason to rethink the use of peptides in vaccine design. Nat. Rev. Drug Discov. 2007, 6, 404–414. [Google Scholar] [CrossRef] [PubMed]
- Malonis, R.J.; Lai, J.R.; Vergnolle, O. Peptide-Based Vaccines: Current Progress and Future Challenges. Chem. Rev. 2020, 120, 3210–3229. [Google Scholar] [CrossRef] [PubMed]
- Zhao, S.; Han, X.; Lang, Y.; Xie, Y.; Yang, Z.; Zhao, Q.; Wen, Y.; Xia, J.; Wu, R.; Huang, X.; et al. Development and efficacy evaluation of remodeled canine parvovirus-like particles displaying major antigenic epitopes of a giant panda derived canine distemper virus. Front. Microbiol. 2023, 14, 1117135. [Google Scholar] [CrossRef]
- Sawatsky, B.; Bente, D.A.; Czub, M.; von Messling, V. Morbillivirus and henipavirus attachment protein cytoplasmic domains differently affect protein expression, fusion support and particle assembly. J. Gen. Virol. 2016, 97, 1066–1076. [Google Scholar] [CrossRef]
- Kim, J.Y.; Rosenberger, M.G.; Rutledge, N.S.; Esser-Kahn, A.P. Next-Generation Adjuvants: Applying Engineering Methods to Create and Evaluate Novel Immunological Responses. Pharmaceutics 2023, 15, 1687. [Google Scholar] [CrossRef]
- Rendon-Marin, S.; Ruiz-Saenz, J. Universal peptide-based potential vaccine design against canine distemper virus (CDV) using a vaccinomic approach. Sci. Rep. 2024, 14, 16605. [Google Scholar] [CrossRef]
- Charan, J.; Kantharia, N.D. How to calculate sample size in animal studies? J. Pharmacol. Pharmacother. 2013, 4, 303–306. [Google Scholar] [CrossRef]
- Whittaker, A.L.; Liu, Y.; Barker, T.H. Methods Used and Application of the Mouse Grimace Scale in Biomedical Research 10 Years on: A Scoping Review. Animals 2021, 11, 673. [Google Scholar] [CrossRef] [PubMed]
- Herrera-Rodriguez, J.; Meijerhof, T.; Niesters, H.G.; Stjernholm, G.; Hovden, A.O.; Sorensen, B.; Okvist, M.; Sommerfelt, M.A.; Huckriede, A. A novel peptide-based vaccine candidate with protective efficacy against influenza A in a mouse model. Virology 2018, 515, 21–28. [Google Scholar] [CrossRef] [PubMed]
- Yan, L.; Zhao, Z.; Xue, X.; Zheng, W.; Xu, T.; Liu, L.; Tian, L.; Wang, X.; He, H.; Zheng, X. A Bivalent Human Adenovirus Type 5 Vaccine Expressing the Rabies Virus Glycoprotein and Canine Distemper Virus Hemagglutinin Protein Confers Protective Immunity in Mice and Foxes. Front. Microbiol. 2020, 11, 1070. [Google Scholar] [CrossRef]
- Sadler, R.A.; Ramsay, E.; McAloose, D.; Rush, R.; Wilkes, R.P. Evaluation of Two Canine Distemper Virus Vaccines in Captive Tigers (Panthera Tigris). J. Zoo Wildl. Med. 2016, 47, 558–563. [Google Scholar] [CrossRef] [PubMed]
- Pujol, J.; Rousseau, C.; Vergneau-Grosset, C. Serologic Response and Adverse Effects of Recombinant Canine Distemper Vaccination in Three Aquarium-Housed Walruses (Odobenus Rosmarus). J. Zoo Wildl. Med. 2023, 54, 131–136. [Google Scholar] [CrossRef] [PubMed]
- Gong, Y.; Chen, T.; Feng, N.; Meng, X.; Sun, W.; Wang, T.; Zhao, Y.; Yang, S.; Song, X.; Li, W.; et al. A highly efficient recombinant canarypox virus-based vaccine against canine distemper virus constructed using the CRISPR/Cas9 gene editing method. Vet. Microbiol. 2020, 251, 108920. [Google Scholar] [CrossRef]
- Rouxel, R.N.; Svitek, N.; von Messling, V. A chimeric measles virus with canine distemper envelope protects ferrets from lethal distemper challenge. Vaccine 2009, 27, 4961–4966. [Google Scholar] [CrossRef]
- Zhao, J.; Sun, Y.; Sui, P.; Pan, H.; Shi, Y.; Chen, J.; Zhang, H.; Wang, X.; Tao, R.; Liu, M.; et al. DNA Vaccine Co-Expressing Hemagglutinin and IFN-gamma Provides Partial Protection to Ferrets against Lethal Challenge with Canine Distemper Virus. Viruses 2023, 15, 1873. [Google Scholar] [CrossRef]
- Nguyen, D.T.; Ludlow, M.; van Amerongen, G.; de Vries, R.D.; Yuksel, S.; Verburgh, R.J.; Osterhaus, A.D.; Duprex, W.P.; de Swart, R.L. Evaluation of synthetic infection-enhancing lipopeptides as adjuvants for a live-attenuated canine distemper virus vaccine administered intra-nasally to ferrets. Vaccine 2012, 30, 5073–5080. [Google Scholar] [CrossRef]
- Nielsen, L.; Sogaard, M.; Karlskov-Mortensen, P.; Jensen, T.H.; Jensen, T.D.; Aasted, B.; Blixenkrone-Moller, M. Humoral and cell-mediated immune responses in DNA immunized mink challenged with wild-type canine distemper virus. Vaccine 2009, 27, 4791–4797. [Google Scholar] [CrossRef] [PubMed]
- Norrby, E.; Utter, G.; Orvell, C.; Appel, M.J. Protection against canine distemper virus in dogs after immunization with isolated fusion protein. J. Virol. 1986, 58, 536–541. [Google Scholar] [CrossRef] [PubMed]
- Du, X.; Goffin, E.; Gillard, L.; Machiels, B.; Gillet, L. A Single Oral Immunization with Replication-Competent Adenovirus-Vectored Vaccine Induces a Neutralizing Antibody Response in Mice against Canine Distemper Virus. Viruses 2022, 14, 1847. [Google Scholar] [CrossRef] [PubMed]
- Durchfeld, B.; Baumgartner, W.; Herbst, W.; Brahm, R. Vaccine-associated canine distemper infection in a litter of African hunting dogs (Lycaon pictus). Zentralbl. Vet. B 1990, 37, 203–212. [Google Scholar] [CrossRef] [PubMed]
- Black, B.; Thaw, D.B. Vaccinating against a Novel Pathogen: A Critical Review of COVID-19 Vaccine Effectiveness Evidence. Microorganisms 2023, 12, 89. [Google Scholar] [CrossRef]
- Hirama, K.; Togashi, K.; Wakasa, C.; Yoneda, M.; Nishi, T.; Endo, Y.; Miura, R.; Tsukiyama-Kohara, K.; Kai, C. Cytotoxic T-lymphocyte activity specific for hemagglutinin (H) protein of canine distemper virus in dogs. J. Vet. Med. Sci. 2003, 65, 109–112. [Google Scholar] [CrossRef] [PubMed]
- Ghosh, S.; Walker, J.; Jackson, D.C. Identification of canine helper T-cell epitopes from the fusion protein of canine distemper virus. Immunology 2001, 104, 58–66. [Google Scholar] [CrossRef]
- da Fontoura Budaszewski, R.; Hudacek, A.; Sawatsky, B.; Kramer, B.; Yin, X.; Schnell, M.J.; von Messling, V. Inactivated Recombinant Rabies Viruses Displaying Canine Distemper Virus Glycoproteins Induce Protective Immunity against Both Pathogens. J. Virol. 2017, 91, 10–1128. [Google Scholar] [CrossRef]
- Reiss, S.; Baxter, A.E.; Cirelli, K.M.; Dan, J.M.; Morou, A.; Daigneault, A.; Brassard, N.; Silvestri, G.; Routy, J.P.; Havenar-Daughton, C.; et al. Comparative analysis of activation induced marker (AIM) assays for sensitive identification of antigen-specific CD4 T cells. PLoS ONE 2017, 12, e0186998. [Google Scholar] [CrossRef]
- Nguyen, N.X.; Richens, A.W.; Sircy, L.M.; Allard, D.E.; Kolawole, E.M.; Evavold, B.D.; Bettini, M.; Hale, J.S. Immunogen-Specific Strengths and Limitations of the Activation-Induced Marker Assay for Assessing Murine Antigen-Specific CD4+ T Cell Responses. J. Immunol. 2023, 210, 916–925. [Google Scholar] [CrossRef]
- Havenar-Daughton, C.; Reiss, S.M.; Carnathan, D.G.; Wu, J.E.; Kendric, K.; Torrents de la Pena, A.; Kasturi, S.P.; Dan, J.M.; Bothwell, M.; Sanders, R.W.; et al. Cytokine-Independent Detection of Antigen-Specific Germinal Center T Follicular Helper Cells in Immunized Nonhuman Primates Using a Live Cell Activation-Induced Marker Technique. J. Immunol. 2016, 197, 994–1002. [Google Scholar] [CrossRef] [PubMed]
- Jiang, W.; Wragg, K.M.; Tan, H.X.; Kelly, H.G.; Wheatley, A.K.; Kent, S.J.; Juno, J.A. Identification of murine antigen-specific T follicular helper cells using an activation-induced marker assay. J. Immunol. Methods 2019, 467, 48–57. [Google Scholar] [CrossRef] [PubMed]
- Liu, J.; Na, S.; Glasebrook, A.; Fox, N.; Solenberg, P.J.; Zhang, Q.; Song, H.Y.; Yang, D.D. Enhanced CD4+ T cell proliferation and Th2 cytokine production in DR6-deficient mice. Immunity 2001, 15, 23–34. [Google Scholar] [CrossRef] [PubMed]
- Mehta, A.K.; Gracias, D.T.; Croft, M. TNF activity and T cells. Cytokine 2018, 101, 14–18. [Google Scholar] [CrossRef]
- Parvathaneni, S.; Yang, J.; Lotspeich-Cole, L.; Sakai, J.; Lee, R.C.; Akkoyunlu, M. IL6 suppresses vaccine responses in neonates by enhancing IL2 activity on T follicular helper cells. NPJ Vaccines 2023, 8, 173. [Google Scholar] [CrossRef]
- Dienz, O.; Eaton, S.M.; Bond, J.P.; Neveu, W.; Moquin, D.; Noubade, R.; Briso, E.M.; Charland, C.; Leonard, W.J.; Ciliberto, G.; et al. The induction of antibody production by IL-6 is indirectly mediated by IL-21 produced by CD4+ T cells. J. Exp. Med. 2009, 206, 69–78. [Google Scholar] [CrossRef]
- Dienz, O.; Rincon, M. The effects of IL-6 on CD4 T cell responses. Clin. Immunol. 2009, 130, 27–33. [Google Scholar] [CrossRef]
- Dienz, O.; Eaton, S.M.; Krahl, T.J.; Diehl, S.; Charland, C.; Dodge, J.; Swain, S.L.; Budd, R.C.; Haynes, L.; Rincon, M. Accumulation of NFAT mediates IL-2 expression in memory, but not naive, CD4+ T cells. Proc. Natl. Acad. Sci. USA 2007, 104, 7175–7180. [Google Scholar] [CrossRef]
- Diehl, S.; Chow, C.W.; Weiss, L.; Palmetshofer, A.; Twardzik, T.; Rounds, L.; Serfling, E.; Davis, R.J.; Anguita, J.; Rincon, M. Induction of NFATc2 expression by interleukin 6 promotes T helper type 2 differentiation. J. Exp. Med. 2002, 196, 39–49. [Google Scholar] [CrossRef]
- Hamley, I.W. Peptides for Vaccine Development. ACS Appl. Bio Mater. 2022, 5, 905–944. [Google Scholar] [CrossRef]
- Hutchinson, J.A.; Hamley, I.W.; Torras, J.; Aleman, C.; Seitsonen, J.; Ruokolainen, J. Self-Assembly of Lipopeptides Containing Short Peptide Fragments Derived from the Gastrointestinal Hormone PYY(3-36): From Micelles to Amyloid Fibrils. J. Phys. Chem. B 2019, 123, 614–621. [Google Scholar] [CrossRef] [PubMed]
- Pudlarz, A.; Szemraj, J. Nanoparticles as Carriers of Proteins, Peptides and Other Therapeutic Molecules. Open Life Sci. 2018, 13, 285–298. [Google Scholar] [CrossRef] [PubMed]
- Kennedy, J.M.; Earle, J.A.P.; Omar, S.; Abdullah, H.; Nielsen, O.; Roelke-Parker, M.E.; Cosby, S.L. Canine and Phocine Distemper Viruses: Global Spread and Genetic Basis of Jumping Species Barriers. Viruses 2019, 11, 944. [Google Scholar] [CrossRef] [PubMed]
- Timm, S.F.; Munson, L.; Summers, B.A.; Terio, K.A.; Dubovi, E.J.; Rupprecht, C.E.; Kapil, S.; Garcelon, D.K. A suspected canine distemper epidemic as the cause of a catastrophic decline in Santa Catalina Island foxes (Urocyon littoralis catalinae). J. Wildl. Dis. 2009, 45, 333–343. [Google Scholar] [CrossRef] [PubMed]
- Gilbert, M.; Soutyrina, S.V.; Seryodkin, I.V.; Sulikhan, N.; Uphyrkina, O.V.; Goncharuk, M.; Matthews, L.; Cleaveland, S.; Miquelle, D.G. Canine distemper virus as a threat to wild tigers in Russia and across their range. Integr. Zool. 2015, 10, 329–343. [Google Scholar] [CrossRef]
- Jo, W.K.; Peters, M.; Kydyrmanov, A.; van de Bildt, M.W.G.; Kuiken, T.; Osterhaus, A.; Ludlow, M. The Canine Morbillivirus Strain Associated with An Epizootic in Caspian Seals Provides New Insights into the Evolutionary History of this Virus. Viruses 2019, 11, 894. [Google Scholar] [CrossRef]
- Williams, E.S.; Thorne, E.T.; Appel, M.J.; Belitsky, D.W. Canine distemper in black-footed ferrets (Mustela nigripes) from Wyoming. J. Wildl. Dis. 1988, 24, 385–398. [Google Scholar] [CrossRef]
- van de Bildt, M.W.; Kuiken, T.; Visee, A.M.; Lema, S.; Fitzjohn, T.R.; Osterhaus, A.D. Distemper outbreak and its effect on African wild dog conservation. Emerg. Infect. Dis. 2002, 8, 211–213. [Google Scholar] [CrossRef]
- Feng, N.; Yu, Y.; Wang, T.; Wilker, P.; Wang, J.; Li, Y.; Sun, Z.; Gao, Y.; Xia, X. Fatal canine distemper virus infection of giant pandas in China. Sci. Rep. 2016, 6, 27518. [Google Scholar] [CrossRef]
- Wang, D.; Accatino, F.; Smith, J.L.D.; Wang, T. Contributions of distemper control and habitat expansion to the Amur leopard viability. Commun. Biol. 2022, 5, 1153. [Google Scholar] [CrossRef]
- Mourya, D.T.; Yadav, P.D.; Mohandas, S.; Kadiwar, R.F.; Vala, M.K.; Saxena, A.K.; Shete-Aich, A.; Gupta, N.; Purushothama, P.; Sahay, R.R.; et al. Canine Distemper Virus in Asiatic Lions of Gujarat State, India. Emerg. Infect. Dis. 2019, 25, 2128–2130. [Google Scholar] [CrossRef] [PubMed]
- Rahman, D.A.; Saepuloh, U.; Santosa, Y.; Darusman, H.S.; Romaria Pinondang, I.M.; Kindangen, A.S.; Pertiwi, A.P.; Sari, L.; Irawan, A.; Sultan, K.; et al. Molecular diagnosis with the corresponding clinical symptoms of canine distemper virus infection in javan leopard (Panthera pardus ssp. melas). Heliyon 2022, 8, e11341. [Google Scholar] [CrossRef] [PubMed]
- Ramsay, E.C.; Georoff, T.A.; Burrell, C.; Anis, E.; Wilkes, R.P. Red Pandas’ (Ailurus Fulgens) Serological Response to Canarypox-Vectored Canine Distemper Vaccines. J. Zoo Wildl. Med. 2019, 50, 478–481. [Google Scholar] [CrossRef] [PubMed]
- Woodroffe, R. Modified Live Distemper Vaccines Carry Low Mortality Risk for Captive African Wild Dogs, Lycaon Pictus. J. Zoo Wildl. Med. 2021, 52, 176–184. [Google Scholar] [CrossRef] [PubMed]
- Rendon-Marin, S.; Higuita-Gutierrez, L.F.; Ruiz-Saenz, J. Safety and Immunogenicity of Morbillivirus canis Vaccines for Domestic and Wild Animals: A Scoping Review. Viruses 2024, 16, 1078. [Google Scholar] [CrossRef]
- Opriessnig, T.; Gauger, P.C.; Filippsen Favaro, P.; Rawal, G.; Magstadt, D.R.; Digard, P.; Lee, H.M.; Halbur, P.G. An experimental universal swine influenza a virus (IAV) vaccine candidate based on the M2 ectodomain (M2e) peptide does not provide protection against H1N1 IAV challenge in pigs. Vaccine 2024, 42, 220–228. [Google Scholar] [CrossRef]
- Bartsch, S.M.; O’Shea, K.J.; John, D.C.; Strych, U.; Bottazzi, M.E.; Martinez, M.F.; Ciciriello, A.; Chin, K.L.; Weatherwax, C.; Velmurugan, K.; et al. The potential epidemiologic, clinical, and economic value of a universal coronavirus vaccine: A modelling study. EClinicalMedicine 2024, 68, 102369. [Google Scholar] [CrossRef]
Peptide | Sequence | Protein | Initial Position | Length (AA) | Purity (%) | Concentration (nM) ** |
---|---|---|---|---|---|---|
P1 | QVIDVLTPLFK | H | 97 | 11 | 98.21 | 20 |
P2 | VENLVRIRF | F | 316 | 9 | 98.27 | 20 |
P3 | LKLLRYYTE | H | 592 | 9 | 98.45 | 20 |
P4 | PPYLLFVLLILLV | H | 32 | 13 | 98.12 | 20 |
P5 | KAQIHWNNL | F | 134 | 9 | 98.72 | 20 |
Poly * | QVIDVLTPLFKAAYLKLLRYYTEGPGPGVENLVRIRFGPGPGPPYLLFVLLILLVKKKAQIHWNNL | NA | NA | 66 | 98.65 | 25 |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2024 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Rendon-Marin, S.; Rincón-Tabares, D.-S.; Tabares-Guevara, J.H.; Arbeláez, N.; Forero-Duarte, J.E.; Díaz, F.J.; Robledo, S.M.; Hernandez, J.C.; Ruiz-Saenz, J. Evaluation of the Safety and Immunogenicity of a Multiple Epitope Polypeptide from Canine Distemper Virus (CDV) in Mice. Vaccines 2024, 12, 1140. https://doi.org/10.3390/vaccines12101140
Rendon-Marin S, Rincón-Tabares D-S, Tabares-Guevara JH, Arbeláez N, Forero-Duarte JE, Díaz FJ, Robledo SM, Hernandez JC, Ruiz-Saenz J. Evaluation of the Safety and Immunogenicity of a Multiple Epitope Polypeptide from Canine Distemper Virus (CDV) in Mice. Vaccines. 2024; 12(10):1140. https://doi.org/10.3390/vaccines12101140
Chicago/Turabian StyleRendon-Marin, Santiago, Daniel-Santiago Rincón-Tabares, Jorge H. Tabares-Guevara, Natalia Arbeláez, Jorge E. Forero-Duarte, Francisco J. Díaz, Sara M. Robledo, Juan C. Hernandez, and Julian Ruiz-Saenz. 2024. "Evaluation of the Safety and Immunogenicity of a Multiple Epitope Polypeptide from Canine Distemper Virus (CDV) in Mice" Vaccines 12, no. 10: 1140. https://doi.org/10.3390/vaccines12101140