Next Article in Journal
In Vivo Accelerator-Based Boron Neutron Capture Therapy for Spontaneous Tumors in Large Animals: Case Series
Previous Article in Journal
Plant Growth-Promoting Activity of Pseudomonas aeruginosa FG106 and Its Ability to Act as a Biocontrol Agent against Potato, Tomato and Taro Pathogens
 
 
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Characterization of Cell-Envelope Proteinases from Two Lacticaseibacillus casei Strains Isolated from Parmigiano Reggiano Cheese

1
Department of Life Sciences, University of Modena and Reggio Emilia, via Amendola, 2—Pad. Besta, 42100 Reggio Emilia, Italy
2
Department of Agriculture, Food and Environment, University of Catania, via Santa Sofia, 100, 95123 Catania, Italy
3
ProBioEtna srl, Spin off University of Catania, via Santa Sofia, 100, 95123 Catania, Italy
*
Author to whom correspondence should be addressed.
Biology 2022, 11(1), 139; https://doi.org/10.3390/biology11010139
Submission received: 9 November 2021 / Revised: 12 January 2022 / Accepted: 12 January 2022 / Published: 14 January 2022
(This article belongs to the Section Microbiology)

Abstract

Simple Summary

Lactic acid bacteria are nutritionally fastidious microorganisms typically used in the production of fermented dairy foods. The lactic acid bacteria’s proteolytic system is crucial for their growth in milk, and plays a paramount role in developing the organoleptic and healthy properties of fermented dairy foods. Cell-envelope proteinases are the first component of this system, responsible for the degradation of caseins into short peptides. In the present work, the cell-envelope proteinases of two highly proteolytic Lacticaseibacillus casei strains, previously isolated from ripened Parmigiano Reggiano cheese, were characterized from a genetic and biochemical point of view. Two different prt genes existed in the genomes of both strains, but only one, named prtR1, was expressed. PrtR1 proteins extracted from both strains displayed the highest activity at 40 °C and pH 7. Interestingly, PrtR1 extracted from Lacticaseibacillus casei PRA205 retained some residual activity at 5 °C and at pH 4. These important biotechnological features can be exploited in the production of fermented dairy products. Peptidomic analysis revealed that both proteinases were able to release β- and αS1-casein-derived bioactive peptides, suggesting that Lacticaseibacillus casei can be a source of new proteinases that can be exploited for the formulation of dairy beverages or hydrolysates enriched in bioactive peptides.

Abstract

In the present work, two cell-envelope proteinases (CEPs) from Lacticaseibacillus casei strains PRA205 and 2006 were characterized at both the biochemical and genetic levels. The genomes of both L. casei strains included two putative CEPs genes prtP2 and prtR1, but only prtR1 was transcribed. The extracted PrtR1 proteinases were serine proteinases with optimal activity at 40 °C and pH 7.5, and were activated by Ca2+ ions. Interestingly, PrtR1 from L. casei PRA205 exhibited high residual activity at pH 4 and at 5 °C, suggesting its possible exploitation for fermented food production. The caseinolytic activity against αS1- and β-casein indicated that both PrtR1s belonged to the PI/PIII type. These PrtR1s cleaved β-casein peptide bonds preferentially when amino acid M or N was present at the P1 subsite and amino acids A and D were at the P1′ subsite. Several bioactive peptides were found to be released from PrtR1 after αs1- and β-casein hydrolysis.

Graphical Abstract

1. Introduction

Lactic acid bacteria (LAB) are a group of microorganisms generally found in nutrient-rich environments and are commonly used in the manufacturing of fermented dairy foods. LAB are nutritionally fastidious, and their growth is dependent on the presence of external sources of nitrogen (e.g., amino acids or short peptides), since they are auxotrophic for numerous amino acids [1]. The low amounts of amino acids and peptides in milk have caused the LAB to evolve a complex proteolytic system to achieve casein hydrolysis, releasing amino acids and oligopeptides [1]. In addition to the well-studied starter LAB, some non-starter LAB (NS-LAB) also exhibit a proteolytic phenotype [2]. These NS-LAB typically colonize cheese during ripening, making an important contribution to milk protein hydrolysis, and to the formation of the texture and flavor of the fermented milk products [3].
The LAB proteolytic system involves various components, such as (1) cell-envelope proteinases (CEPs), which are responsible for the first degradation of caseins into oligopeptides; (2) a specific transport system that internalizes peptides; and (3) a wide variety of internal peptidases, such as specific endopeptidases, aminopeptidases, tri- and dipeptidases, and proline-specific peptidases [4,5].
To date, six major groups of CEPs have been described among LAB strains, including PrtP from Lacticaseibacillus paracasei and Lactococcus lactis, PrtB typical of Lactobacillus delbrueckii subsp. bulgaricus, PrtH characteristic of Lactobacillus helveticus, PrtS from Streptococcus thermophilus, PrtR found in Lacticaseibacillus rhamnosus, and PrtL typical of Lactobacillus delbrueckii subsp. lactis [5,6]. Moreover, CEPs have also been identified in other LAB species, such as Lactobacillus acidophilus and Lactiplantibacillus plantarum [7,8]. Most LAB are thought to have only one specific CEP, but four unique types of CEPs—namely PrtH, PrtH2, PrtH3, and PrtH4—have been characterized in Lactobacillus helveticus [4]. As revealed by comparative genomic analysis, the quantity of CEP genes in LAB is between 1 and 4, depending on the strain [9]. CEPs are typically synthesized in the cytoplasmic compartment in the form of pre-pro-proteinases of ~2000 amino acids [5,6]; They are organized in 6–8 functional domains comprising a signal sequence S (absent in PrtH2), a pro-domain PP, a catalytic domain PR, an insert domain I (absent in PrtR and PrtH2), the A- and B-domains, and helix domain H (only present in PrtP, PrtH, and PrtH2), a cell wall domain W, and an anchored domain AN (only present in PrtP, PrtS, and PrtR) [5,6].
In addition to the key role of CEPs in LAB growth in milk, they also play a pivotal part in developing the organoleptic properties of fermented dairy foods, and impact on the health properties of fermented dairy foods and probiotic LAB. Several studies have demonstrated that many bioactive peptides can be generated after casein hydrolysis, during both fermentation and in vitro hydrolysis by purified CEPs [6,10]. Beyond their known nutritional value, these peptides can regulate important physiological functions, since they display a plethora of activities, such as antihypertensive, antimicrobial, antithrombotic, immunomodulatory, opioid, antioxidant, and mineral-binding activities [10]. Indeed, CEPs were also able to degrade pro-inflammatory chemokines in vivo, exerting physiologically significant anti-inflammatory effects at the intestinal level [11]. Therefore, CEPs have found several applications in functional food technology [6].
The aim of this study was to characterize the genetic and biochemical features of CEPs from Lacticaseibacillus casei strains PRA205 and 2006—two highly proteolytic NS-LAB previously isolated from ripened Parmigiano Reggiano cheese—in order to verify their ability to produce bioactive peptides from milk proteins, along with their potential technological exploitation.

2. Materials and Methods

2.1. Strains, Species Confirmation, Culture Conditions, and Chemicals

The strains used in this study—PRA205 and 2006—were isolated from Parmigiano Reggiano cheese, and were originally identified as L. casei and L. rhamnosus [2,3]. The latter strain was attributed to L. rhamnosus by tuf gene PCR, but when we confirmed species affiliation by mutL gene PCR assay (Supplementary Table S1) [12], we found that strain 2006 belongs to L. casei (Supplementary Figures S1–S3), while we confirmed that PRA205 also belongs to L. casei. Species misidentification was reported between L. rhamnosus and L. casei for the tuf gene PCR method [12]. Strains used as controls in the experiments were L. casei DSMZ20011T, L. rhamnosus PRA161, and L. rhamnosus 0503 [2,3]. All of the reference strains were confirmed by mutL multiplex PCR [12]. Details of the methods used in species confirmation are reported in the Supplementary Materials. Stocks of cultures were stored frozen at −80 °C in de Man–Rogosa–Sharpe (MRS) medium (Oxoid, Basingstoke, Hampshire, UK) supplemented with 25% (w/v) glycerol. Before experimental use, all of the strains were twice propagated in MRS broth at 37 °C for 24 h, under anaerobic conditions. For the entire duration of the experiments, the reference strains were maintained in MRS medium supplemented with 7% (w/v) agar at 4 °C. All media and chemicals used in this study were purchased from Sigma-Aldrich (St. Louis, MO, USA), unless otherwise indicated. Primers and sequencing services were provided by Bio-Fab Research (Rome, Italy).

2.2. DNA Extraction

Genomic DNA (gDNA) was extracted from late exponential cultures grown in MRS, as described by Gala et al. [13]. Briefly, cells (1.5 mL) were centrifuged at 6000× g for 10 min, washed with 500 μL of TE buffer (10 mmol/L Tris-HCl, 1 mmol/L EDTA, pH 8.0), and re-suspended in 200 μL of TE buffer with glass beads (diameter 0.106 mm). Subsequently, the cell suspension was vortexed with Vortex-Genie 2 (MoBio, Jefferson City, MO, USA) for 4 min (two rounds of 2 min at the maximum speed, with 1 min in ice, and then 2 min at maximum speed). Next, 15 μL of proteinase K (20 mg/mL) was added, and the mixture was incubated at 60 °C for 1 h. After incubation, 40 μL of 20% SDS was added, and the samples were incubated at 65 °C for 15 min. After cooling at room temperature, 90 µL of refrigerated 5 mol/L potassium acetate was added, and the mixture was centrifuged at 10,000× g for 10 min. After performing phenol–chloroform extraction and ethanol precipitation, DNA samples were suspended in 50 μL of TE buffer. Then, the suspension was mixed with 1.5 μL of RNAse (10 mg/mL) and incubated at 37 °C for 2 h. The concentration and purity of gDNA samples were determined using a NanoDrop ND-1000 spectrophotometer (NanoDrop Technologies, Wilmington, DE, USA), while gDNA quality was evaluated by electrophoresis on 0.8% (w/v) agarose gel containing ethidium bromide (0.5 μg/mL) in 0.5X TBE buffer (45 mmol/L Tris–HCl, 45 mmol/L boric acid, and 1 mmol/L EDTA, pH 8.0). gDNA samples were diluted to 50 ng/μL in ddH2O and stored at −20 °C for subsequent analysis.

2.3. In Silico Analysis, PCR Screening, and Phylogenetic Tree Construction

The in silico search for putative prt genes in L. casei genomes was performed using the BLASTp algorithm against the NCBI database, using L. casei PrtP (AFJ15093.1) as the query sequence. A curated dataset containing 44 proteins from 23 strains was built, and sequences were aligned with the constraint-based alignment tool (COBALT) method [14], using the default settings (Supplementary Table S2). Conserved protein domains were analyzed via NCBI Batch CD-Search (https://www.ncbi.nlm.nih.gov/Structure/bwrpsb/bwrpsb.cgi; last access on 14 June 2021; E-Value threshold 0.01, max. hits 500) using the CDD database.
Primer pairs were designed on the conserved regions within or surrounding the catalytic domains of prt genes, using Primer3 [15] (Supplementary Table S3). All PCR reactions were carried out in a T100 thermal cycler (Bio-Rad, Hercules, CA, USA) with DreamTaq DNA Polymerase (Thermo Scientific, Waltham, MA, USA), following the manufacturer’s instructions. PCR products were resolved by 1.2% (w/v) agarose gel electrophoresis stained with ethidium bromide (5 μg/mL) and, when required, PCR amplicons were digested with the endonuclease EcoRV (Thermo Scientific, Waltham, MA, USA) in a 20 μL final volume, according to the manufacturer’s instructions. PCR products were purified with the DNA Clean & Concentrator™-5 Kit (Zymo Research, Irvine, CA, USA), and were sequenced on both strands through a DNA Sanger dideoxy sequencing process using both external and internal primers (Supplementary Table S3). Sequences were assembled in DNASTAR (DNASTAR, Inc. Madison, WI, USA) and trimmed on both ends to remove primer sequences. The nucleic acid sequences of the prtP and prtR partial genes were deposited at GenBank database under the accession numbers MZ606853 to MZ606856. Phylogenetic relationships were inferred using the gamma distribution (shape parameter = 1) model and the neighbor-joining (NJ) method. Bootstrap support values were calculated from 1000 replicates in MEGA6 [16]. All trees were visualized using the interactive tree of life (iTOL) v5.2 [17].

2.4. Induction of Cell-Envelope Proteinases (CEPs)

To induce the expression of CEPs, the strains were pre-cultured in 50 mL of MRS broth and incubated for 72 h at 37 °C under anaerobic conditions. After centrifugation at 10,000× g for 20 min at 4 °C, cells were re-suspended in physiological solution (0.9% NaCl) at a final OD600nm value of 1010 CFU/mL, and then spread on milk–citrate–agar (MCA) plates (4.4% re-suspended skimmed milk, 0.1% Na citrate, 0.1% yeast extract, 0.5% glucose, and 1.5% agar) in triplicate. After incubation for 48 h at 37 °C, cells were recovered from plates and re-suspended in physiological solution at a final concentration of 1010 CFU/mL. Samples were used for both RNA extraction and biochemical characterization.

2.5. RNA Extraction and RT-PCR

For RNA extraction, glassware was sterilized at 180 °C for at least 4 h to degrade RNases, and all the solutions were prepared with diethyl pyrocarbonate (DEPC)-treated water. MCA-induced cells were washed twice with DEPC-treated TE buffer (100 mmol/L Tris-HCl, 50 mmol/L EDTA, pH 8.0), and cell pellets were maintained at −80 °C until thawed with 1 mL of Tri-reagent using the Direct-zol RNA MiniPrep Kit (Zymo Research, Irvine, CA, USA). Mechanical lysis was performed using a Vortex-Genie 2 for two rounds of 20 min at the highest speed, alternated with 3 min on ice. The quantity of total RNA was measured spectrophotometrically using a NanoDrop ND-1000 (NanoDrop Technology, Wilmington, DE, USA), while the integrity was checked via denaturing gel electrophoresis on a 0.9% (w/v) agarose gel with formaldehyde (10 mL of 10× MOPS running buffer) and 18 mL of 37% formaldehyde (12 mol/L) on a pH 7.0 1× MOPS running buffer (0.4 mol/L MOPS, 1 mol/L sodium acetate, and 0.01 mol/L EDTA), after RNA treatment at 65 °C for 10 min.
Contaminating DNA was removed by treating 2 µg of RNA sample with dsDNase (Thermo Scientific, Waltham, MA, USA) at 37 °C for 2 min in a preheated thermocycler with the lid temperature adjusted to 37 °C. After being chilled on ice and briefly centrifuged, 12.5 µL treated RNA samples were used as templates for first-strand cDNA synthesis with random hexamers (Thermo Scientific, Waltham, MA, USA), using RevertAid Reverse Transcriptase (Thermo Scientific, Waltham, MA, USA), according to the manufacturer’s instructions. CEP-specific RT-PCR assays were performed with the primers reported above (Supplementary Table S3). RT-PCR of the 16S rRNA gene was carried out as previously reported, and used as the positive control [2].

2.6. CEP Extraction and Protein Concentration Determination

Following induction of CEPs, cells were centrifuged at 12,000× g for 10 min and re-suspended in 100 μL of Ca2+-free buffer (Tris-Cl 50 mmol/L; pH 7.5) at a final concentration of 1010 CFU/mL. After 30 min of incubation at 37 °C under agitation, extracts were centrifuged (12,000× g for 10 min), the supernatants collected, and the pellets re-suspended in the same volume of the Ca2+-free buffer for three additional cycles of incubation [18]. The collected supernatants containing the crude enzyme extracts were pooled and stored at −20 °C, awaiting biochemical assays. The protein concentration was assessed using the Bradford Assay Kit according to the manufacturer’s instructions (Sigma-Aldrich, St. Louis, MO, USA). The release of lactate dehydrogenase was measured in order to monitor the membrane integrity and the cell lysis during the extraction phase, as previously described [19].

2.7. CEPs’ Enzymatic Activity Assay

The proteinase activity of crude extracts was evaluated via a chromogenic assay. The activity was measured using the specific substrate succinyl-alanyl-alanyl-prolyl-phenylalanine-p-nitroanilide. The assay mixture, containing 107 μL of 50 mmol/L sodium phosphate buffer (pH 7), 56 μL of 5 mol/L NaCl, 9.5 μL of 20 mmol/L of substrate and 15 μL of extract, was incubated at 40 °C for 120 min in a covered water bath. The reaction was stopped by adding 94 μL of 80% acetic acid. The released p-nitroanilide was measured at 410 nm using a microplate reader. Control reactions with the substrate but without CEPs were also prepared [20]. One unit of proteinase activity was defined as the amount required to liberate 1 μmol of p-nitroanilide per minute. Specific activity was expressed as units of proteinase activity per mg of protein.

2.8. Effects of Temperature, pH, Metal Ions, and Inhibitors on CEPs’ Activity

The effect of temperature on the CEPs’ activity was measured as described above, modifying the incubation temperature. The assay was carried out at four different temperatures (5 °C, 35 °C, 40 °C, and 45 °C), at a constant optimal pH value of 7. The effect of pH on enzyme activity was evaluated by modifying the pH of the reaction buffer, keeping the temperature constant at 40 °C. Sodium acetate buffer (50 mmol/L) was utilized for reactions carried out at pH 4–6 whereas sodium phosphate buffer (50 mmol/L) was used for the reaction performed at pH 8. To analyze the influence of metal ions on proteinase activity, KCl, CaCl2, or MgCl2 was added to the reaction mixture at a final concentration of 2 mmol/L (pH 7, 40 °C). Similarly, in order to evaluate the effects of inhibitors on proteinase activity, EDTA or PMSF was added to the mix, at a final concentration of 0.5 mmol/L (pH 7, 40 °C).

2.9. Casein Hydrolysis

To test the caseinolytic activity of CEPs, 5 mg/mL of αS1-or β-casein solution, dissolved in sodium phosphate buffer (pH 7.0; 100 mmol/L), was mixed at a 1:1 volume ratio with the crude extracts containing 1.5 U/mL of CEP activity. The mixtures were incubated at 40 °C and, after various intervals (0, 8, 24, 30, 48, and 56 h), aliquots of samples were withdrawn and stored at −20 °C for further analysis.

2.10. SDS–PAGE

The casein breakdown pattern was assessed by sodium dodecyl sulfate–polyacrylamide gel electrophoresis (SDS–PAGE). Samples collected during the caseinolytic test described above were diluted in Laemmli buffer in order to load 2.5 μg of total protein per lane. Denaturation was completed by boiling the samples for 3 min. SDS–PAGE was carried out on 12% polyacrylamide gels on vertical electrophoresis cells for 1 h at 200 V. Gels were stained with the Coomassie blue staining method (0.1% Coomassie brilliant blue in 100 mL of 40% methanol, 10% glacial acetic acid, 50% H2O) for 1 h under stirring. Subsequently, gels were de-stained with the de-staining solution (40% methanol, 10% glacial acetic acid, 50% H2O) for 30 min under stirring. The de-staining step was repeated four times.

2.11. Identification of Peptides by Ultrahigh-Performance Liquid Chromatography/High-Resolution Mass Spectrometry (UHPLC/HRMS)

Samples collected during the casein hydrolysis assay were mixed with 1% trifluoroacetic acid at a 1:1 volume ratio and submitted to UHPLC/HRMS analysis for peptide identification. Chromatographic separation was carried out with UHPLC (UHPLC Ultimate 3000 Separation Module, Thermo Fisher Scientific, San Jose, CA, USA) equipped with a C18 column (Acquity UPLC HSS C18 Reversed Phase, 2.1 × 100 mm, 1.8 μm particle size, Waters, Milford, MA, USA). Mass spectrometry (MS) and tandem MS experiments were performed on a Q Exactive Hybrid Quadrupole-Orbitrap Mass Spectrometer (Thermo Fisher Scientific, San Jose, CA, USA). The full description of the gradient, flow rate, and MS and MS/MS parameters was reported by Martini et al. [21].
Peptide sequencing was carried out by using MASCOT (Matrix Science, Boston, MA, USA) protein identification software, with the following search parameters: enzyme, none; peptide mass tolerance, ±5 ppm; fragment mass tolerance, ±0.12 Da; variable modification, oxidation (M) and phosphorylation (ST); maximal number of post-translational modifications permitted in a single peptide, 4. The assignment procedure was confirmed by the manual verification of MS/MS spectra.

2.12. Identification of Bioactive Peptides

The peptides identified via mass spectrometry analysis were investigated in relation to previously identified bioactive peptides. The identification of bioactive peptides was carried out by using the Milk Bioactive Peptide Database (MBPDB)—an online database of human milk- and dairy-derived bioactive peptides [22].

2.13. Calculation of the Cleavage Specificity

The cleavage probability and the positive or negative influence on the cleavage of a specific amino acid in the P1 and P1′ subsites were calculated as described by Solieri et al. [23]. The amino acid residues were designated as P1 in the N-terminal direction (on the left of the sequence) and P1′ in the C-terminal direction (on the right of the sequence) from the cleaved bond. The residue P1 interacts with the subsite S1 in the enzyme active site, whereas the residue P1′ interacts with the subsite S1′ in the enzyme active site. The peptide bond cleaved by the CEPs is defined as the P1–P1′ bond.
The amino acid residue in position P1 or P1′ influences the CEP cleavage probability. If the amino acid residue A is in the position n (P1 or P1′ subsite), the cleavage probability of the P1-P1′ bond will be as follows:
P n = t o t a l   a m i n o   a c i d   A   c l e a v e d   i n   p o s i t i o n   n t o t a l   a m i n o   a c i d   A   i n   p r o t e i n x   100  
The mean cleavage probability was defined by the following formula:
%   P n ¯ = # = 1 20 % P n 20  
The positive or negative influence of an amino acid residue A in the P1 and P1′ subsites was quantified by the coefficient Kn:
K n = ( % P n / % P n ¯ ) 1 ¯  
Kn values > 0 indicate a favorable influence of the amino acid A in the specific subsite on the cleavage of the P1–P1′ bond, whereas Kn values < 0 suggest a negative effect on the cleavage.

2.14. Statistical Analysis

Data are shown as the mean ± standard deviation (SD) for three replicates. Univariate analysis of variance (ANOVA) with Tukey’s post hoc test was applied using GraphPad Prism 6.0 (GraphPad Software, San Diego, CA, USA). The differences were considered significant at p < 0.05.

3. Results and Discussion

3.1. In Silico Survey of Putative prt Genes in the L. casei Genome

Most LAB are thought to possess only one type of CEP [4], but it has been proven that more than one prt gene exists in the genomes of several LAB species, and that the pattern of prt genes is highly variable at the inter-strain level. For instance, L. helveticus possesses four unique types of CEP—namely prtH1, prtH2, prtH3, and prtH4—while L. rhamnosus CGMCC11055 possesses both prtP and prtR genes, although prtP was initially detected only in L. lactis and L. paracasei/L. casei species [4,19,24,25,26].
Using the L. casei PrtP (AFJ15093.1) amino acid sequence as a query in BLASTp search, we built a dataset consisting of 44 putative Prt-encoding genes in L. casei. Protein alignment with COBALT showed that 22 proteins exhibited the insert domain, and were categorized as PrtP (data not shown). The remaining 22 proteins lacked the insert domain, and were categorized as PrtR, with three different lengths of approximately 1500, 1800, and 2200 amino acids (data not shown). This result suggests that both prtP and prtR paralogs exist in several L. casei genomes, including in the type strain ATCC 393T. Clustering analysis showed two distinct clades for L. casei PrtP proteins, referred to as PrtP1 and PrtP2, while PrtR proteins were grouped into three different clusters, referred to as PrtR1, PrtR2, and PrtR3 (Figure 1).
“CD-search” in the Conserved Domain Database (CDD) predicted that PrtP1 and PrtP2 would share the same functional domains, except for the FIVAR domain (pfam07554)—which is present in PrtP2, but not in PrtP1—and the CHB_HEX_C domain, which is present in PrtP1, but not in PrtP2 (Supplementary Figure S4). PrtR proteins shared the subtilisin S8 family domain annotated in the Pfam database (PF00082), but mainly differed from one another at the C-terminus (Supplementary Figure S4).

3.2. PCR Screening and Phylogenetic Analysis

Based on the survey of putative prt genes in 44 L. casei genomes, CEP-specific primer pairs were designed across the putative active domains of five different Prt-encoding genes, and were used to assess the type and distribution of prtP and prtR paralogs in L. casei PRA205 and 2006. Both strains were positive for PrtP2- and PrtR1-specific PCR assays, as they exhibited two bands with the expected lengths of approximately 2630 bp and 1723 bp, respectively, while no PCR products were obtained with the primer pairs targeting the prtP1, prtR2, and prtR3 genes (Figure 2). This pattern of prt genes resembled the one we found in the genome of L. casei LC5, used as the reference strain in the subsequent in silico analyses. Recently, Asahina et al. [27] also identified both prtR and prtP genes in a highly proteolytic L. paracasei strain used as an adjunct starter in Gouda-type cheese production, whilst Vukotić et al. [26] identified three distinct proteinase genes—two prtP-type genes and one prtR-type—in Lacticaseibacillus zeae LMG17315. Considering the importance of the proteolytic system in assuring survival in highly protein-rich environments, the observed diversity of CEPs in mesophilic lactobacilli could arise from horizontal gene transfer, since the gain and loss of genes is a driving force in the LAB genome’s adaptive evolution [28].
To exclude the possibility that putative SNPs prevented the annealing of prtP1-specific primers, an additional primer set was designed on the conserved regions of the prtP1 and prtP2 genes. Restriction analysis of the resulting PCR amplicons with the diagnostic endonuclease EcoRV confirmed the presence of the prtP2 gene (Supplementary Figure S5).
We sequenced the prtP2 and prtR1 PCR amplicons from L. casei PRA205 and 2006 for comparative analysis. A BLASTn search showed that the PRA205 and 2006 prtP2 nucleotide sequences were 93.75 and 93.71% identical to the L. casei ATCC 393T prtP2 sequence, respectively, and even more identical (>99%) to the S8-peptidase-encoding genes in the recently released genomes of L. zeae strains FBL8 and CECT 9104. L. zeae is a recently restored species closely related to L. casei, and is indistinguishable from L. casei based on 16S rRNA gene sequencing [29,30]. BLASTx results using the predicted protein sequences revealed that the most similar protein to PRA205 and 2006 PrtP2 was WP_213449867.1 (L. zeae strain FBL8; 99.81%). Furthermore, PRA205 and 2006 PrtP2 partial proteins diverged from L. casei LC5 PrtP2 due to 13 substitutions, namely, E120K, N122S, V143A, D229A, T237A, S454R, T551A, D652A, A771T, R776G, S837G, K860R, N874S (Supplementary Figure S6). Phylogenetic analysis showed that putative PrtPs from L. zeae strains grouped in a homogeneous cluster divergent from L. casei homologs, and placed PRA205 and 2006 PrtP2 from strains more closely related to L. zeae than to L. casei ATCC 393T and LC5 PrtP2 proteins (Figure 3A).
The prtR1 nucleotide partial sequences in L. casei PRA205 and 2006 were 94.98, 93.07, and 77.83% identical to the L. casei LC5, L. zeae 1934, and L. rhamnosus prtR1 genes, respectively. The predicted partial PrtR1 proteins showed six substitutions—namely V539I, T571S, S896T, A946T, V923I, and S946T—compared with LC5 PrtR1 (Supplementary Figure S7). The phylogenetic tree revealed that PrtR1 protein sequences from L. casei, L. paracasei, and L. zeae formed a heterogeneous group together with plasmid-encoded PrtR1 proteins from Lacticaseibacillus manihotivorans and Lactiplantibacillus plantarum (Figure 3B).
Proteinase genes (prtP and prtM) were also proven to be plasmid-encoded in Lactococcus lactis [31]. In S. thermophilus, the prtS gene is part of a genomic island flanked by conserved insertion sequence (IS) elements [32,33]. This mobile island has been shown to trigger gene gain and loss recombination events, which could be responsible for the huge interspecies and intraspecies variability in proteolytic activity and prt gene patterns observed in lactobacilli. Remarkably, PRA205 and 2006 PrtR1 partial proteins diverged from those of the L. casei group, and clustered separately (Figure 3B). Further experiments are required in order to establish whether the prtR1 gene is plasmid-encoded in L. casei PRA205 and 2006, or whether it belongs to a genomic island flanked by IS regions.

3.3. CEP Extraction and prt Gene Expression Profile

Peptide-rich media generally repress proteinase activities in several lactobacilli, including L. casei [34,35]. Therefore, we decided to assess the CEP activities of the strains PRA205 and 2006, grown until the stationary phase on the MCA medium. Extraction of CEPs was performed using Ca2+-free buffer, and the specific enzyme activity was determined with the chromogenic substrate succinyl-alanyl-alanyl-prolyl-phenylalanine-p-nitroanilide. Strain 2006 showed a specific CEP activity of 11.34 ± 0.45 U/mg, whereas for PRA205 it was 3.73 ± 0.03 U/mg. A lactate dehydrogenase activity assay was performed in order to check the membrane integrity during the extraction process. In the crude extracts, the LDH activity was undetectable (data not shown), proving that the proteolytic activity reported was due to the action of CEPs rather than intracellular peptidases. However, we cannot exclude the possible occurrence of cell-wall-associated peptidases. The presence of cell-wall aminopeptidases has been reported for L. lactis, L. helveticus, and Streptococcus cremoris [36,37,38]. However, El Soda et al. [39] did not detect any aminopeptidase, dipeptidase, or carboxypeptidase activity in the cell-wall-associated proteinase fraction obtained from L. casei.
To qualitative establish which prt gene is actively transcribed in MCA-grown cells, we carried out an RT-PCR assay. Figure 4A,B show that both strains (PRA205 and 2006) transcribed prtR1, but not prtP2, suggesting that the CEP activity detected above mainly came from PrtR1 proteinase when the strains were grown on MCA medium. This result differed from that found in L. rhamnosus strain CGMCC11055, which has both prtP and prtR genes, but only prtP gene transcription was detected when grown in a synthetic medium [19]. Moreover, the results are in disagreement with those reported by Pastar et al. [40], which showed that PrtR from L. rhamnosus EN1 was not released following incubation with Ca2+-free buffer.

3.4. Biochemical Characterization of L. casei PRA205 and 2006 Cell-Envelope Proteinases’ PrtR1

The proteolytic activity of PrtR1 was analyzed by modifying the incubation temperature and the pH of the reaction buffer in order to determine the best conditions of substrate hydrolysis. The PrtR1 extracted from each strain displayed the highest activity at 40 °C, and the enzymatic activity at 40 °C was taken as the reference (100%) for the calculation of residual (%) activity (Figure 5A). A slight decrease in the PrtR1 catalytic activity was observed at 35 °C, whereas at 5 °C the residual activity rapidly decreased for PrtR1 extracted from L. casei 2006, whereas the proteinase extracted from L. casei PRA205 retained 48% of its activity. The high proteolytic activity at 5 °C seems to be a peculiar feature of L. casei PRA205 PrtR1, since the majority of previously characterized CEPs almost completely lost their activity at temperatures around 20 °C [7,8,19,41]. The effect of pH on the enzyme activity was analyzed by varying the pH of the reaction buffer from 4 to 8, at a constant temperature of 40 °C (Figure 5B). All of the crude extracts achieved the highest activity at an optimal pH value of 7, which was used as the reference (100%) for the calculation of residual (%) activity. In particular, the residual activity gradually decreased at pH below and above 7 for both strains. However, when the PrtR1 activity was tested at pH 4, proteinase extracted from L. casei PRA205 showed a significantly higher residual proteolytic activity compared to that extracted from L. casei 2006.
This property could be of paramount importance because it suggests a possible exploitation of L. casei PRA205 in the production of bioactive peptides in fermented dairy foods such as cheese, yogurt, and fermented milk, which are characterized by low pH values. This observation could also explain the fact that L. casei PRA205 whole cells presented higher proteolytic activity in fermented milk than L. casei 2006 whole cells, despite the latter strain showing the highest CEP specific activity [2,42]. Moreover, the fact that L. casei PRA205 PrtR1 retained almost 50% of its activity at low temperatures suggests that the enzyme might also be active during the cold storage of fermented dairy foods, promoting the continuous release of bioactive peptides from caseins during cold storage.
The proteolytic activity of both PrtR1s was inhibited by K+ (71.2 ± 1.5% and 67.0 ± 6.1% of residual activity for L. casei PRA205 and L. casei 2006 PrtR1, respectively) and Mg2+ (80.9 ± 2.4% and 70.5 ± 6.4% of residual activity for L. casei PRA205 and L. casei 2006 PrtR1, respectively) ions when added at 2 mmol/L, and vice versa—PrtR1 activity was enhanced by 2 mmol/L Ca2+ ions (143.5 ± 5.3% and 183.0 ± 2% of residual activity for L. casei PRA205 and L. casei 2006 PrtR1, respectively), as reported for numerous other extracted CEPs [6]. Indeed, the activity of both PrtR1s was almost completely abolished by 1 mmol/L PMSF (86.5% and 99.9% of inhibition for L. casei PRA205 and L. casei 2006 PrtR1, respectively), suggesting that both PrtR1s were members of the serine proteinase family. The chelator EDTA at 1 mmol/L concentration also inhibited the PrtR1 activity (31.5% and 39.2% of inhibition for L. casei PRA205 and L. casei 2006 PrtR1, respectively), indicating that cations (i.e., Ca2+ ions) are required for their activity.

3.5. Caseinolytic Specificity of Extracted PrtR1, and PeptidomicsAnalysis of Casein Hydrolysates

The proteolytic activity of PrtR1 was assessed against αS1- and β-caseins as substrates. Aliquots of samples were taken after 0, 8, 24, 30, 48, and 56 h, and analyzed via SDS–PAGE and mass spectrometry experiments. As shown in Figure 6, both of the extracted PrtR1s completely degraded β-casein after 48 h of incubation under the optimal conditions, while αS1-casein was hydrolyzed at a lower rate, with the protein bands still present after 56 h (Figure 6).
Based on the specific hydrolysis patterns of the αS1-, β-, and κ-caseins, CEPs were classified in three different types: CEPs belonging to the PI type primarily hydrolyze β-casein, which is cleaved into more than 100 different oligopeptides, ranging from 4 to 30 amino acid residues [6]. PIII-type CEPs can hydrolyze αS1-, β-, and κ-caseins equally well [6]. There is also a mixed CEP type named PI/PIII that cleaves β-casein in a similar manner to PI-type CEPs, and is also able to cleave αS1-casein, to a lesser extent, [10]. The above reported results indicated that β-casein was the preferential substrate over αS1-casein, suggesting that PrtR1 extracted from L. casei PRA205 and L. casei 2006 belonged to the PI/PIII type. These results are inconsistent with the findings of Kojic et al. [18], who characterized a PI-type CEP in L. casei HN14, while they are consistent with the mixed PI/PIII-type CEP isolated from L. casei IFLP 731 [41].
Samples collected during the casein hydrolysis assay were submitted to UHPLC/HRMS analysis for peptide identification in order to study the casein breakdown patterns produced by the PrtR1 extracted from the selected strains. The full list of identified peptides at the different time points for the both β- and αS1-caseins, along with the mass spectrometry data, are reported in Supplementary Tables S4–S7.
Crude extracts were incubated with β-casein for up to 48 h, and the peptidomic analysis revealed that a total of 116 and 119 peptides were released by PrtR1 extracted from L. casei PRA205 and L. casei 2006, respectively (Supplementary Tables S4 and S6). In the αS1-casein hydrolysis, samples were incubated for up to 56 h, and at the end of the incubation time a total of 102 and 124 peptides were released by PrtR1 extracted from L. casei PRA205 and L. casei 2006, respectively (Supplementary Tables S5 and S7). The number of identified peptides released from β-casein constantly increased during hydrolysis for both PrtR1s (Supplementary Tables S4 and S6, and Supplementary Figure S8A), whereas, in the case of αS1-casein, the number of peptides peaked after 48 h of incubation (Supplementary Tables S5 and S7 and Supplementary Figure S8B). As reported in the Venn diagrams (Supplementary Figure S9), 57.7% of peptides released from β-casein and 61.4% of peptides released from αS1-casein were commonly found in the hydrolysates obtained from the two PrtR1s, suggesting a similar cleavage specificity.

3.6. Analysis of the β-Casein Cleavage Site Specificity

The analysis of the β-casein cleavage site specificity revealed the presence of 63 and 66 different cleavage sites in samples hydrolyzed by PrtR1 extracted from L. casei PRA205 and L. casei 2006, respectively (Figure 7A,B); these represented 30.3% and 31.7% of all peptide bonds present in the proteins, respectively. A total of 54 cleavage sites were in common between the two PrtR1s, representing 85.7 and 81.8% of the total sites found in L. casei PRA205 and L. casei 2006 CEPs, respectively, suggesting that these CEPs had almost the same cleavage specificity.
The time-course analysis indicated that the hydrolysis of β-casein began at the hydrophobic C-terminal region. After 8 h of reaction, 80% and 76% of the cleavage sites produced by L. casei PRA205 and L. casei 2006 PrtR1, respectively, were located between residue 161 and the C-terminal amino acid V at position 209. At this point in time, no cleavage sites were found in the N-terminal region between residues 1 and 72 or in the central region situated between the amino acids at positions 106 and 134. Furthermore, considering the long region between amino acids 1 and 134, only two and four cleavage sites were detected in the L. casei PRA205 and L. casei 2006 PrtR1 hydrolysates, respectively. After 24 h of hydrolysis, the majority (59% for L. casei PRA205 PrtR1 and 62% for L. casei 2006 PrtR1) of the cleavage sites were still in the C-terminal region. At the end of the hydrolysis, the cleavage sites were distributed throughout the entire β-casein sequence for both of the PrtR1s; however, no cleavage sites were identified in the polyphosphorylated region between residues 8 and 28. It is worth noting that the majority of the previously characterized lactobacilli proteinases have a proven preference for hydrolyzing the C-terminal region of β-casein [6,43].
Furthermore, the cleavage probability at subsites P1 and P1′, along with the Kn coefficients, which measure the positive or negative effects of amino acids on the P1–P1′ cleavage probability, were calculated (Table 1).
PrtR1 extracted from both L. casei strains showed a marked preference for the amino acid M, for polar uncharged amino acids (S, Q, and N), and for positively charged amino acids (R and K) in the P1 position. In particular, the amino acids M and N showed the highest Kn values for both PrtR1s, therefore exerting the strongest positive effect on cleavage probability at the P1 subsite. The only difference between the two PrtR1s was the strong positive effect of amino acid A on PrtR1 extracted from L. casei 2006. In position P1, the amino acids I, T, P, V, and H, as well as the negatively charged (D and E) and aromatic (F and Y) amino acids, exhibited a strong negative effect on cleavage probability for both of the extracted PrtR1s.
The strongest positive effect on cleavage probability at subsite P1′ was found for the small aliphatic amino acids A and G, as well as the amino acids H and D, for both of the extracted PrtR1s. In both cases, the amino acids D and A showed the highest Kn values. The strongest negative effect at position P1′ was exhibited by the polar uncharged amino acids (especially P, Q, and T) and by the amino acid E. Some of the identified preferred amino acids have already been reported in previous studies; for example, the positive effect of amino acid Q in position P1 has been already described for CEPs characterized from L. delbrueckii CRL581, L. helveticus BGRA43, L. paracasei BGHN14, L. rhamnosus BGT10 and PRA331, and Lc. lactis NCDO763 [20,23,43,44]. The preference for this amino acid at the P1 subsite seems to be a common feature among the CEPs extracted from lactobacilli belonging to different species. In addition, the preference for N and M at position P1 has already been described for L. lactis NCDO763 and L. rhamnosus PRA331, respectively [23,44]. To the best of our knowledge, the strong positive effects exerted by the positively charged amino acids (R and K) in the P1 position and by the residue D in the P1′ position have never been reported in the CEPs of LAB. The profile of cleavage-site specificity was slightly distinct from that previously reported for L. casei PRA205 [23]. These differences may be related to different experimental conditions, e.g., hydrolysis carried out with PRA205 whole cells and milk.

3.7. Analysis of the αS1-Casein Cleavage Site Specificity

Unlike β-casein, the hydrolysis of αS1-casein started at the N-terminal part of the protein. After 24 h of incubation, 50% and 45% of the cleavage sites were located in the sequence between residues 1 and 36 for PrtR1 extracted from L. casei PRA205 and L. casei 2006, respectively (Figure 8A,B). Most of these cleavage sites were positioned in the fragment 1–23. Additional preferred cleavage sites at the beginning of the hydrolysis occurred in the sequence 90–110 for L. casei 2006 PrtR1, and in sequence 140–160 for both extracted CEPs. At the end of hydrolysis, the cleavage sites were mainly concentrated in the fragments 1–40 and 90–160, as already reported for the majority of characterized CEPs [6].

3.8. Identification of Bioactive Peptides Using the Milk Bioactive Peptide Database

The identification of bioactive peptides released by PrtR1 was carried out by searching all of the peptides found in the mass spectrometry analysis experiments against the Milk Bioactive Peptide Database (MBPDB). The hydrolysis of β-casein by PrtR1 of L. casei PRA205 and L. casei 2006 produced 14 and 17 functional peptides previously demonstrated to have several bioactivities, respectively (Table 2).
The PrtR1 of both L. casei strains commonly released a total of 13 bioactive peptides, whereas 4 were uniquely produced by L. casei 2006 PrtR1 and 1 by L. casei PRA205 PrtR1. In contrast, the hydrolysis of αS1-casein by PrtR1 of L. casei PRA205 and L. casei 2006 generated 9 and 11 bioactive peptides, respectively, among which 8 were commonly released by the PrtR1 of both strains.
The identified bioactive peptides showed several functional properties, as 13 peptides were ACE inhibitors, 13 were antimicrobial, 6 were antioxidants, 5 had immunomodulatory activity, 1 showed dipeptidyl peptidase IV (DPPIV)-inhibitory activity, and 1 showed anxiolytic activity. Most of the identified bioactive peptides were tested in vitro for their bioactivity, whereas some of them also exhibited their activities in vivo. For example, the tripeptide LLY demonstrated a positive influence in vivo in Swiss albino mice against ethanol-induced oxidative stress [45]. The β-casein fragment KVLPVPQ showed antihypertensive activity in vivo in spontaneously hypertensive rats (SHRs) [10]. In addition, the bioactive peptide LYQEPVLGPVRGPFPIIV exerted its immunomodulatory activities by stimulating lymphocyte proliferation in rats [46].
With the sole exception of the αS1-casein-derived peptides LGY and RPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGKEK, all the other identified bioactive peptides were found at the end of the hydrolysis, suggesting their resistance to further hydrolysis by PrtR1 (Table S3). In addition, 16 bioactive peptides were released only in the final periods of hydrolysis.
To exert their physiological effect, bioactive peptides should be stable under gastrointestinal conditions and resistant to the hydrolysis by gastrointestinal proteases. In a recent study, it was demonstrated that most of the peptides identified after in vitro gastro-pancreatic digestion contained 1–4 proline residues near the carboxylic ends of their sequences. In addition, the simultaneous presence of DPP-IV-inhibitory peptides causes a strong decrease in the intestinal prolyl peptidases’ activity [47]. Among the identified peptides, LLYQEPVLGPVRGPFPIIV, YQEPVLGPVRGPFPIIV, and QEPVLGPVRGPFPIIV were found after simulating gastro-pancreatic digestion of homogenized yogurt; in addition, KVLPVPQ, VLPVPQK, YQEPVLGPVRGPFPIIV, LPVPQ, and EPVLGPVRGPFP were found in the human gastrointestinal tract [48].

4. Conclusions

In this work, two unique CEPs from the highly proteolytic strains L. casei PRA205 and L. casei 2006, previously isolated from ripened Parmigiano Reggiano cheese, were characterized. Both strains possessed two different prt genes in their genome—prtP2 and prtR1—but the evidence collected in this study suggests that only one gene, prtR1, is actively transcribed in MCS-induced cells after 48 h of incubation. In both strains, the predicted protein catalytic domain sequences of PrtR1 showed six amino acid substitutions compared with the reference sequence, suggesting that these proteases were peculiar to the selected strains. In addition, PrtR1 identified in L. casei PRA205 and 2006 showed high similarity with PrtR1-like sequences which are plasmid-encoded in other LAB species. The presence of PrtR1 on plasmids could confer an important evolutionary advantage to these strains, but further analysis is required to establish the true gene position.
PrtR1 extracted from both strains displayed the highest activity at 40 °C, pH 7; interestingly, PrtR1 extracted from L. casei PRA205 retained 48% of its activity at 5 °C and showed higher activity at pH 4 than strain L. casei 2006. These important biotechnological features can be exploited to produce fermented dairy products with low pH and low storage temperatures, such as fermented milk and yoghurt.
Remarkably, peptidomic analysis assisted us in demonstrating that these CEPs are able to release β- and αS1-casein-derived bioactive peptides. Most of these peptides matched the sequences of previously reported bioactive peptides, and some of them were resistant to gastro-intestinal hydrolysis.
Overall, the results presented in this study provide new knowledge on the proteolytic systems of two strains belonging to the L. casei species, which is poorly explored in comparison with thermophilic lactobacilli or lactococci. Furthermore, PrtR1 from both strains were able to release some bioactive peptides, suggesting that L. casei can be a source of new proteases exploitable as enzymes for the formulation of dairy beverages or hydrolysates enriched in bioactive peptides, and with improved digestibility of milk proteins. Thereby, NS-LAB can be considered as a source of new enzymes, and the knowledge of CEPs developed in this work can be used as a tool for the selection of new proteinase-proficient strains, as well as for the improvement of functional lactobacilli performance—particularly in the L. casei species.

Supplementary Materials

The following are available online at https://www.mdpi.com/article/10.3390/biology11010139/s1: Figure S1: Phylogenetic relationships among Lacticaseibacillus casei species inferred by the neighbor-joining (NJ) method from partial mutL gene sequences; Figure S2: mutL-targeted PCR amplification of L. casei 2006 and PRA205; Figure S3: Phylogenetic tree generated from 1473 nucleotide positions of the strain 2006 16S rRNA gene; Figure S4: Representative selection of conserved domains identified in PrtP1, PrtP2, PrtR1, PrtR2, and PrtR3; Figure S5: PCR-based approaches to dissect PrtP variants in Lacticaseibacillus casei PRA205 and 2006; Figure S6: Multiple sequence alignment of PRA205 and 2006 PrtP2 partial proteins with the PrtP2 reference protein from Lacticaseibacillus casei LC5; Figure S7: Multiple sequence alignment of PRA205 and 2006 PrtR1 partial proteins with the Prtr1 reference protein from Lacticaseibacillus casei LC5; Figure S8: Number of peptides identified in β-casein and αS1-casein hydrolysates at the different time points; Figure S9: Venn diagram displaying differences between peptides produced after β-casein (A) or aS1-casein (B) hydrolysis by Lacticaseibacillus casei PRA205 and 2006; Table S1: Primers used in mutL-gene-targeted multiplex PCR; Table S2: Dataset containing L. casei genomes’ accession numbers, putative prt gene coordinates (in brackets), and protein IDs; Table S3: Primer sequences, their targets, and the annealing temperatures used for Lacticaseibacillus casei prtP and prtR gene screening and sequencing; Table S4: List of peptides identified at the different time points during hydrolysis of β-casein with PrtR1 from Lacticaseibacillus casei PRA205; Table S5: List of peptides identified at the different time points during hydrolysis of αS1-casein with PrtR1 from Lacticaseibacillus casei PRA205; Table S6: List of peptides identified at the different time points during hydrolysis of β-casein with PrtR1 from Lacticaseibacillus casei 2006; Table S7: List of peptides identified at the different time points during hydrolysis of αS1-casein with PrtR1 from Lacticaseibacillus casei 2006.

Author Contributions

Conceptualization, L.S. (Lisa Solieri), L.S. (Laura Sola), C.L.R., S.M. and D.T.; methodology, L.S. (Lisa Solieri), L.S. (Laura Sola), A.V., S.M. and D.T.; validation, L.S. (Lisa Solieri), C.L.R., S.M. and D.T.; formal analysis, L.S. (Laura Sola), A.V. and S.M.; investigation, L.S. (Laura Sola), A.V. and S.M.; data curation, L.S. (Lisa Solieri), L.S. (Laura Sola), A.V., C.L.R., S.M. and D.T.; writing—original draft preparation, L.S. (Lisa Solieri) and D.T.; writing—review and editing, L.S. (Lisa Solieri), L.S. (Laura Sola), A.V., C.L.R., S.M. and D.T.; supervision, L.S. (Lisa Solieri), S.M. and D.T.; project administration, D.T.; funding acquisition, L.S. (Lisa Solieri) and D.T. All authors have read and agreed to the published version of the manuscript.

Funding

This research was supported by two grants from Department of Life Sciences, University of Modena and Reggio Emilia: Research project FAR2019 “Diversità MIcrobica, profilo PEptidico e proprietà Biofunzionali: il caso del formaggio Parmigiano Reggiano (MiPEB)”; research project FAR2020 “Sviluppo di un approccio di BioREFining basato sull’impiego di batteri lattici e lieviti per la valorizzazione dei sottoprodotti dell’industria lattiero-casearia (BioREFMilk)”. S.M. was supported by a grant under the framework “Programma Operativo Regionale POR FSE 2014/2020 Obiettivo Tematico 10—Bando Regione Emilia Romagna Alte competenze per nuove imprese: Laboratorio regionale per l’imprenditorialità” from Regione Emilia Romagna, Italy.

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

The data presented in this study are available in here and in supplementary material.

Acknowledgments

The authors acknowledge the Fondazione Cassa di Risparmio di Modena for funding the UPLC-ESI-Q Exactive Hybrid Quadrupole-Orbitrap Mass Spectrometer system at the Centro Interdipartimentale Grandi Strumenti (CIGS).

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Christensen, J.E.; Dudley, E.G.; Pederson, J.A.; Steele, J.L. Peptidases and amino acid catabolism in lactic acid bacteria. Antonie Leeuwenhoek 1999, 76, 217–246. [Google Scholar] [CrossRef] [PubMed]
  2. Tagliazucchi, D.; Baldaccini, A.; Martini, S.; Bianchi, A.; Pizzamiglio, V.; Solieri, L. Cultivable non-starter lactobacilli from ripened Parmigiano Reggiano cheeses with different salt content and their potential to release anti-hypertensive peptides. Int. J. Food Microbiol. 2020, 330, 108688. [Google Scholar] [CrossRef]
  3. Solieri, L.; Bianchi, A.; Giudici, P. Inventory of non starter lactic acid bacteria from ripened Parmigiano Reggiano cheese as assessed by a culture dependent multiphasic approach. Syst. Appl. Microbiol. 2012, 35, 270–277. [Google Scholar] [CrossRef]
  4. Sadat-Mekmene, L.; Genay, M.; Atlan, D.; Lortal, S.; Gagnaire, V. Original features of cell-envelope proteinases of Lactobacillus helveticus. A review. Int. J. Food Microbiol. 2011, 146, 1–13. [Google Scholar] [CrossRef] [PubMed]
  5. Savijoki, K.; Ingmer, H.; Varmanen, P. Proteolytic systems of lactic acid bacteria. Appl. Microbiol. Biotechnol. 2006, 71, 394–406. [Google Scholar] [CrossRef] [PubMed]
  6. Ji, D.; Ma, J.; Xu, M.; Agyei, D. Cell-envelope proteinases from lactic acid bacteria: Biochemical features and biotech-nological applications. Compr. Rev. Food Sci. Food Saf. 2021, 20, 369–400. [Google Scholar] [CrossRef] [PubMed]
  7. Chen, H.; Huang, J.; Cao, B.; Chen, L.; Song, N.; Lei, N. Study of Extraction and Enzymatic Properties of Cell-Envelope Proteinases from a Novel Wild Lactobacillus plantarum LP69. Catalysts 2018, 8, 325. [Google Scholar] [CrossRef]
  8. Fira, D.; Kojic, M.; Banina, A.; Spasojevic, I.; Strahinic, I.; Topisirovic, L. Characterization of cell envelope-associated proteinases of thermophilic lactobacilli. J. Appl. Microbiol. 2001, 90, 123–130. [Google Scholar] [CrossRef]
  9. Liu, M.; Bayjanov, J.R.; Renckens, B.; Nauta, A.; Siezen, R.J. The proteolytic system of lactic acid bacteria revisited: A genomic comparison. BMC Genom. 2010, 11, 36. [Google Scholar] [CrossRef]
  10. Tagliazucchi, D.; Martini, S.; Solieri, L. Bioprospecting for Bioactive Peptide Production by Lactic Acid Bacteria Isolated from Fermented Dairy Food. Fermentation 2019, 5, 96. [Google Scholar] [CrossRef]
  11. Von Schillde, M.-A.; Hörmannsperger, G.; Weiher, M.; Alpert, C.-A.; Hahne, H.; Bäuerl, C.; van Huynegem, K.; Steidler, L.; Hrncir, T.; Pérez-Martínez, G.; et al. Lactocepin Secreted by Lactobacillus Exerts Anti-Inflammatory Effects By Selectively Degrading Proinflammatory Chemokines. Cell Host Microbe 2012, 11, 387–396. [Google Scholar] [CrossRef] [PubMed]
  12. Bottari, B.; Felis, G.E.; Salvetti, E.; Castioni, A.; Campedelli, I.; Torriani, S.; Bernini, V.; Gatti, M. Effective identification of Lactobacillus casei group species: Genome-based selection of the gene mutL as the target of a novel multiplex PCR assay. Microbiology 2017, 163, 950–960. [Google Scholar] [CrossRef] [PubMed]
  13. Gala, E.; Landi, S.; Solieri, L.; Nocetti, M.; Pulvirenti, A.; Giudici, P. Diversity of lactic acid bacteria population in ripened Parmigiano Reggiano cheese. Int. J. Food Microbiol. 2008, 125, 347–351. [Google Scholar] [CrossRef] [PubMed]
  14. Papadopoulos, J.S.; Agarwala, R. COBALT: Constraint-based alignment tool for multiple protein sequences. Bioinformatics 2007, 23, 1073–1079. [Google Scholar] [CrossRef] [PubMed]
  15. Kõressaar, T.; Lepamets, M.; Kaplinski, L.; Raime, K.; Andreson, R.; Remm, M. Primer3_masker: Integrating masking of template sequence with primer design software. Bioinformatics 2018, 34, 1937–1938. [Google Scholar] [CrossRef] [PubMed]
  16. Tamura, K.; Stecher, G.; Peterson, D.; Filipski, A.; Kumar, S. MEGA6: Molecular Evolutionary Genetics Analysis version 6.0. Mol. Biol. Evol. 2013, 30, 2725–2729. [Google Scholar] [CrossRef]
  17. Letunic, I.; Bork, P. Interactive Tree of Life (iTOL) v4: Recent updates and new developments. Nucleic Acid. Res. 2019, 47, W256–W259. [Google Scholar] [CrossRef]
  18. Kojic, M.; Fira, D.; Banina, A.; Topisirovic, L. Characterization of the Cell Wall-Bound Proteinase of Lactobacillus casei HN14. Appl. Environ. Microbiol. 1991, 57, 1753–1757. [Google Scholar] [CrossRef] [PubMed]
  19. Guo, T.; Ouyang, X.; Xin, Y.; Wang, Y.; Zhang, S.; Kong, J. Characterization of a New Cell Envelope Proteinase PrtP from Lactobacillus rhamnosus CGMCC11055. J. Agric. Food Chem. 2016, 64, 6985–6992. [Google Scholar] [CrossRef] [PubMed]
  20. Hebert, E.M.; Mamone, G.; Picariello, G.; Raya, R.R.; Savoy, G.; Ferranti, P.; Addeo, F. Characterization of the pattern of αs1- and β-casein breakdown and release of a bioactive peptide by a cell envelope proteinase from Lactobacillus delbrueckii subsp. lactis CRL 581. Appl. Environ. Microbiol. 2008, 74, 3682–3689. [Google Scholar] [CrossRef]
  21. Martini, S.; Solieri, L.; Cattivelli, A.; Pizzamiglio, V.; Tagliazucchi, D. An Integrated Peptidomics and In Silico Approach to Identify Novel Anti-Diabetic Peptides in Parmigiano-Reggiano Cheese. Biology 2021, 10, 563. [Google Scholar] [CrossRef]
  22. Nielsen, S.D.; Beverly, R.L.; Qu, Y.; Dallas, D.C. Milk bioactive peptide database: A comprehensive database of milk protein-derived bioactive peptides and novel visualization. Food Chem. 2018, 232, 673–682. [Google Scholar] [CrossRef] [PubMed]
  23. Solieri, L.; De Vero, L.; Tagliazucchi, D. Peptidomic study of casein proteolysis in bovine milk by Lactobacillus casei PRA205 and Lactobacillus rhamnosus PRA331. Int. Dairy J. 2018, 85, 237–246. [Google Scholar] [CrossRef]
  24. Kok, J.; Leenhouts, K.J.; Haandrikman, A.J.; Ledeboer, A.M.; Venema, G. Nucleotide-sequence of the cell-wall pro-teinase gene of Streptococcus cremoris WG2. Appl. Environ. Microbiol. 1988, 54, 231–238. [Google Scholar] [CrossRef] [PubMed]
  25. Nikolić, M.; Tolinački, M.; Fira, D.; Golić, N.; Topisirović, L. Variation in specificity of the PrtP extracellular proteinases in Lactococcus lactis and Lactobacillus paracasei subsp. paracasei. Folia Microbiol. 2009, 54, 188–194. [Google Scholar] [CrossRef] [PubMed]
  26. Vukotić, G.; Strahinić, I.; Begović, J.; Lukić, J.; Kojić, M.; Fira, D. Survey on proteolytic activity and diversity of pro-teinase genes in mesophilic lactobacilli. Microbiology 2016, 85, 33–41. [Google Scholar] [CrossRef]
  27. Asahina, Y.; Hagi, T.; Kobayashi, M.; Narita, T.; Sasaki, K.; Tajima, A.; Nomura, M. Expression profiles of milk pro-teolysis-related genes in Lactobacillus paracasei EG9, a non-starter lactic acid bacterial strain, during Gouda-type cheese ripening. Int. Dairy J. 2020, 110, 104812. [Google Scholar] [CrossRef]
  28. Makarova, K.S.; Koonin, E.V. Evolutionary Genomics of Lactic Acid Bacteria. J. Bacteriol. 2007, 189, 1199–1208. [Google Scholar] [CrossRef]
  29. Huang, C.H.; Chen, C.C.; Liou, J.S.; Lee, A.Y.; Blom, J.; Lin, Y.C.; Huang, L.; Watanabe, K. Genome-based reclassifi-cation of Lactobacillus casei: Emended classification and description of the species Lactobacillus zeae. Int. J. Syst. Evol. Microbiol. 2020, 70, 3755–3762. [Google Scholar] [CrossRef]
  30. Liu, D.D.; Gu, C.T. Proposal to reclassify Lactobacillus zhaodongensis, Lactobacillus zeae, Lactobacillus argentoratensis and Lactobacillus buchneri subsp. silagei as Lacticaseibacillus zhaodongensis comb. nov., Lacticaseibacillus zeae comb. nov., Lactiplantibacillus argentoratensis comb. nov. and Lentilactobacillus buchneri subsp. silagei comb. nov., respectively and Apilactobacillus kosoi as a later heterotypic synonym of Apilactobacillus micheneri. Int. J. Syst. Evol. Microbiol. 2020, 70, 6414–6417. [Google Scholar] [CrossRef]
  31. Kojic, M.; Strahinic, I.; Topisirovic, L. Proteinase PI and lactococcin A genes are located on the largest plasmid in Lactococcus lactis subsp. lactis bv. diacetylactis S50. Can. J. Microbiol. 2005, 51, 305–314. [Google Scholar] [CrossRef]
  32. Dandoy, D.; Fremaux, C.; de Frahan, M.H.; Horvath, P.; Boyaval, P.; Hols, P.; Fontaine, L. The fast milk acidifying phenotype of Streptococcus thermophilus can be acquired by natural transformation of the genomic island encoding the cell-envelope proteinase PrtS. Microb. Cell Factories 2011, 10, S21. [Google Scholar] [CrossRef]
  33. Selle, K.; Klaenhammer, T.R.; Barrangou, R. CRISPR-based screening of genomic island excision events in bacteria. Proc. Natl. Acad. Sci. USA 2015, 112, 8076–8081. [Google Scholar] [CrossRef]
  34. Alcantara, C.; Bäuerl, C.; Revilla-Guarinos, A.; Pérez-Martínez, G.; Monedero, V.; Zúñiga, M. Peptide and amino acid metabolism is controlled by an OmpR-family response regulator in Lactobacillus casei. Mol. Microbiol. 2016, 100, 25–41. [Google Scholar] [CrossRef]
  35. Hébert, E.M.; Raya, R.R.; de Giori, G.S. Modulation of the Cell-Surface Proteinase Activity of Thermophilic Lactobacilli by the Peptide Supply. Curr. Microbiol. 2002, 45, 385–389. [Google Scholar] [CrossRef]
  36. Geis, A.; Bockelmann, W.; Teuber, M. Simultaneous extraction and purification of a cell wall-associated peptidase and β-casein specific protease from Streptococcus cremoris AC1. Appl. Microbiol. Biotechnol. 1985, 23, 79–84. [Google Scholar] [CrossRef]
  37. Blanc, B.; Laloi, P.; Atlan, D.; Gilbert, C.; Portalier, R. Two cell-wall-associated aminopeptidases from Lactobacillus helveticus and the purification and characterization of APII from strain ITGL1. J. Gen. Microbiol. 1993, 139, 1441–1448. [Google Scholar] [CrossRef] [PubMed]
  38. Kiefer-Partsch, B.; Bockelmann, W.; Geis, A.; Teuber, M. Purification of an X-prolyl-dipeptidyl aminopeptidase from the cell wall proteolytic system of Lactococcus lactis subsp. cremoris. Appl. Microbiol. Biotechnol. 1989, 31, 75–78. [Google Scholar] [CrossRef]
  39. El Soda, M.; Desmazeaud, M.J.; Le Bars, D.; Zevaco, C. Cell-wall-associated proteinases in Lactobacillus casei and Lac-tobacillus plantarum. J. Food Prot. 1986, 49, 361–365. [Google Scholar] [CrossRef] [PubMed]
  40. Pastar, I.; Fira, D.; Strahinic, I.; Krstic, K.; Begovic, J.; Topisirovic, L.; Jovanovic, G. Analysis of the presence of prtR proteinase gene in natural isolates of Lactobacillus rhamnsosus. Folia Microbiol. 2006, 51, 535–541. [Google Scholar] [CrossRef] [PubMed]
  41. Fernández De Palencia, P.; Peláez, C.; Romero, C.; Martín-Hernández, C. Purification and Characterization of the Cell Wall Proteinase of Lactobacillus casei Subsp. casei IFPL 731 Isolated from Raw Goat’s Milk Cheese. J. Agric. Food Chem. 1997, 45, 6985–6992. [Google Scholar] [CrossRef]
  42. Solieri, L.; Rutella, G.S.; Tagliazucchi, D. Impact of non-starter lactobacilli on release of peptides with angioten-sin-converting enzyme inhibitory and antioxidant activities during bovine milk fermentation. Food Microbiol. 2015, 51, 108–116. [Google Scholar] [CrossRef] [PubMed][Green Version]
  43. Lozo, J.; Strahinic, I.; Dalgalarrondo, M.; Chobert, J.-M.; Haertlé, T.; Topisirovic, C. Comparative analysis of β-casein proteolysis by PrtP proteinase from Lactobacillus paracasei subsp. paracasei BGHN14, PrtR proteinase from Lactobacillus rhamnosus BGT10 and PrtH proteinase from Lactobacillus helveticus BGRA43. Int. Dairy J. 2011, 21, 863–868. [Google Scholar] [CrossRef]
  44. Monnet, V.; Ley, J.P.; Gonzàlez, S. Substrate specificity of the cell envelope-located proteinase of Lactococcus lactis subsp. lactis NCDO 763. Int. J. Biochem. 1992, 24, 707–718. [Google Scholar] [CrossRef]
  45. Sowmya, K.; Mala, D.; Bhat, M.I.; Kumar, N.; Bajaj, R.K.; Kapila, S.; Kapila, R. Bio-accessible milk casein derived tripeptide (LLY) mediates overlapping anti- inflammatory and anti-oxidative effects under cellular (Caco-2) and in vivo milieu. J. Nutr. Biochem. 2018, 62, 167–180. [Google Scholar] [CrossRef] [PubMed]
  46. Coste, M.; Rochet, V.; Léonil, J.; Mollé, D.; Bouhallab, S.; Tomé, D. Identification of C-terminal peptides of bovine β-casein that enhance proliferation of rat lymphocytes. Immunol. Lett. 1992, 33, 41–46. [Google Scholar] [CrossRef]
  47. Tagliazucchi, D.; Helal, A.; Verzelloni, E.; Bellesia, A.; Conte, A. Composition and properties of peptides that survive standardised in vitro gastro-pancreatic digestion of bovine milk. Int. Dairy J. 2016, 61, 196–204. [Google Scholar] [CrossRef]
  48. Boutrou, R.; Gaudichon, C.; Dupont, D.; Jardin, J.; Airinei, G.; Marsset-Baglieri, A.; Benamouzig, R.; Tome’, D.; Leonil, J. Sequential release of milk protein–derived bioactive peptides in the jejunum in healthy humans. Am. J. Clin. Nutr. 2013, 97, 1314–1323. [Google Scholar] [CrossRef] [PubMed]
Figure 1. Fast minimum evolution tree of 44 putative S8 subtilisin proteases from Lacticaseibacillus casei genomes reported in GenBank (last access on 4 April 2021). Sequences were aligned using the COBALT tool with default parameters, while the fast minimum evolution algorithm was used to determine the distance for tree construction. Labels represent protein IDs and strain codes. The image was created using the interactive tree of life (iTOL) v5.2.
Figure 1. Fast minimum evolution tree of 44 putative S8 subtilisin proteases from Lacticaseibacillus casei genomes reported in GenBank (last access on 4 April 2021). Sequences were aligned using the COBALT tool with default parameters, while the fast minimum evolution algorithm was used to determine the distance for tree construction. Labels represent protein IDs and strain codes. The image was created using the interactive tree of life (iTOL) v5.2.
Biology 11 00139 g001
Figure 2. Screening of prtP and prtR genes in Lacticaseibacillus casei PRA205 and 2006. Lacticaseibacillus rhamnosus 0503 was used as a control to demonstrate the species-specificity of primer pairs. Arrows indicate expected length values. M: GeneRuler 1 kbp Plus DNA Ladders (Thermo Scientific, Waltham, MA, USA); N: negative control (PCR mixture without any DNA template).
Figure 2. Screening of prtP and prtR genes in Lacticaseibacillus casei PRA205 and 2006. Lacticaseibacillus rhamnosus 0503 was used as a control to demonstrate the species-specificity of primer pairs. Arrows indicate expected length values. M: GeneRuler 1 kbp Plus DNA Ladders (Thermo Scientific, Waltham, MA, USA); N: negative control (PCR mixture without any DNA template).
Biology 11 00139 g002
Figure 3. Phylogenetic trees of PrtP2 (A) and PrtR1 (B) amino acid partial sequences. The evolutionary histories were inferred using the neighbor-joining method. The percentage of replicate trees in which the associated taxa clustered together in the bootstrap test (1000 replicates) are shown next to the branches (values > 0.5). The evolutionary distances were computed using the Poisson correction method, and are given as the number of amino acid substitutions per site. The rate variation between sites was modelled with a gamma distribution (shape parameter = 1). Evolutionary analyses were conducted in MEGA6.
Figure 3. Phylogenetic trees of PrtP2 (A) and PrtR1 (B) amino acid partial sequences. The evolutionary histories were inferred using the neighbor-joining method. The percentage of replicate trees in which the associated taxa clustered together in the bootstrap test (1000 replicates) are shown next to the branches (values > 0.5). The evolutionary distances were computed using the Poisson correction method, and are given as the number of amino acid substitutions per site. The rate variation between sites was modelled with a gamma distribution (shape parameter = 1). Evolutionary analyses were conducted in MEGA6.
Biology 11 00139 g003
Figure 4. RT-PCR assay targeting the prtP2 and prtR1 genes in Lacticaseibacillus casei PRA205 and 2006 cells grown on MCA medium. The figure depicts amplified cDNAs generated with prtP2 and prtR1 gene (A)- and 16S rRNA (B)-specific primers from PRA205 and 2006 cells harvested in stationary phase from MCA medium; ± indicate reverse-transcription-positive and -negative controls. The 16S rRNA gene was used as a housekeeping gene. gDNA amplification was used as a positive PCR control. Abbreviations—M: molecular weight marker; N: negative control.
Figure 4. RT-PCR assay targeting the prtP2 and prtR1 genes in Lacticaseibacillus casei PRA205 and 2006 cells grown on MCA medium. The figure depicts amplified cDNAs generated with prtP2 and prtR1 gene (A)- and 16S rRNA (B)-specific primers from PRA205 and 2006 cells harvested in stationary phase from MCA medium; ± indicate reverse-transcription-positive and -negative controls. The 16S rRNA gene was used as a housekeeping gene. gDNA amplification was used as a positive PCR control. Abbreviations—M: molecular weight marker; N: negative control.
Biology 11 00139 g004
Figure 5. Influence of temperature (A) and pH (B) on Lacticaseibacillus casei PRA205 and Lacticaseibacillus casei 2006 PrtR1 activity. Grey bars refer to L. casei PRA205, whereas black bars refer to L. casei 2006. Results are expressed as the percentage of residual activity, set as 100% of the value at pH 7 and 40 °C. PrtR1 activity was assayed by using the specific substrate succinyl-alanyl-alanyl-prolyl-phenylalanine-p-nitroanilide. Values are the mean of three assay replications ± standard deviation (SD).
Figure 5. Influence of temperature (A) and pH (B) on Lacticaseibacillus casei PRA205 and Lacticaseibacillus casei 2006 PrtR1 activity. Grey bars refer to L. casei PRA205, whereas black bars refer to L. casei 2006. Results are expressed as the percentage of residual activity, set as 100% of the value at pH 7 and 40 °C. PrtR1 activity was assayed by using the specific substrate succinyl-alanyl-alanyl-prolyl-phenylalanine-p-nitroanilide. Values are the mean of three assay replications ± standard deviation (SD).
Biology 11 00139 g005
Figure 6. Time-course hydrolysis of β-casein and αS1-casein by PrtR1 extracted from Lacticaseibacillus casei PRA205 and Lacticaseibacillus casei 2006. β-casein or αS1-casein was added to the crude extracts containing PrtR1, and samples were taken immediately after addition and at 8, 24, 30, 48, and 56 h.
Figure 6. Time-course hydrolysis of β-casein and αS1-casein by PrtR1 extracted from Lacticaseibacillus casei PRA205 and Lacticaseibacillus casei 2006. β-casein or αS1-casein was added to the crude extracts containing PrtR1, and samples were taken immediately after addition and at 8, 24, 30, 48, and 56 h.
Biology 11 00139 g006
Figure 7. Distribution of the cleavage sites identified in the primary sequences of β-casein by PrtR1 from Lacticaseibacillus casei PRA205 and Lacticaseibacillus casei 2006. (A) β-casein hydrolysis by Lacticaseibacillus casei PRA205, and cleavage sites identified after 8, 24, 30, and 48 h of hydrolysis. (B) β-casein hydrolysis by Lacticaseibacillus casei 2006, and cleavage sites identified after 8, 24, 30 and 48 h of hydrolysis.
Figure 7. Distribution of the cleavage sites identified in the primary sequences of β-casein by PrtR1 from Lacticaseibacillus casei PRA205 and Lacticaseibacillus casei 2006. (A) β-casein hydrolysis by Lacticaseibacillus casei PRA205, and cleavage sites identified after 8, 24, 30, and 48 h of hydrolysis. (B) β-casein hydrolysis by Lacticaseibacillus casei 2006, and cleavage sites identified after 8, 24, 30 and 48 h of hydrolysis.
Biology 11 00139 g007
Figure 8. Distribution of the cleavage sites identified in the primary sequences of αS1-casein by PrtR1 from Lacticaseibacillus casei PRA205 and Lacticaseibacillus casei 2006. (A) αS1-casein hydrolysis by Lacticaseibacillus casei PRA205, and cleavage sites identified after 24, 30, 48, and 56 h of hydrolysis. (B) αS1-casein hydrolysis by Lacticaseibacillus casei 2006, and cleavage sites identified after 24, 30, 48, and 56 h of hydrolysis.
Figure 8. Distribution of the cleavage sites identified in the primary sequences of αS1-casein by PrtR1 from Lacticaseibacillus casei PRA205 and Lacticaseibacillus casei 2006. (A) αS1-casein hydrolysis by Lacticaseibacillus casei PRA205, and cleavage sites identified after 24, 30, 48, and 56 h of hydrolysis. (B) αS1-casein hydrolysis by Lacticaseibacillus casei 2006, and cleavage sites identified after 24, 30, 48, and 56 h of hydrolysis.
Biology 11 00139 g008
Table 1. Cleavage occurrence, cleavage probability (%P), and Kn coefficients for Lacticaseibacillus casei PRA205 and Lacticaseibacillus casei 2006 PrtR1 on β-casein in different amino acids at the P1 and P1′subsites after 48 h of hydrolysis.
Table 1. Cleavage occurrence, cleavage probability (%P), and Kn coefficients for Lacticaseibacillus casei PRA205 and Lacticaseibacillus casei 2006 PrtR1 on β-casein in different amino acids at the P1 and P1′subsites after 48 h of hydrolysis.
L. casei PRA205 PrtR1L. casei 2006 PrtR1
Amino Acid 1P1 SubsiteP1′ SubsiteP1 SubsiteP1′ Subsite
Number of Cleaved Bonds 2 (%P1 3)KnNumber of Cleaved Bonds 2 (%P1′ 3)KnNumber of Cleaved Bonds 2 (%P1 3)KnNumber of Cleaved Bonds 2 (%P1′ 3)Kn
Aliphatic
A (5)2 (40.0)0.084 (80.0)0.863 (60.0)0.695 (100.0)1.42
G (5)1 (20.0)−0.463 (60.0)0.402 (40.0)0.133 (60.0)0.45
V (19)3 (15.8)−0.589 (47.4)0.103 (15.8)−0.568 (42.1)0.02
L (22)10 (45.5)0.2210 (45.5)0.069 (40.9)0.158 (36.4)−0.12
I (10)1 (10.0)−0.734 (40.0)−0.071 (10.0)−0.723 (30.0)−0.27
M (6)5 (83.3)1.242 (33.3)−0.224 (66.7)0.882 (33.3)−0.19
Polar un-charged
T (9)2 (22.2)−0.402 (22.2)−0.481 (11.1)−0.691 (11.1)−0.73
S (16)8 (50.0)0.357 (43.8)0.027 (43.8)0.237 (43.8)0.06
Q (20)10 (50.0)0.352 (10.0)−0.7710 (50.0)0.413 (15.0)−0.64
N (5)4 (80.0)1.152 (40.0)−0.073 (60.0)0.691 (20.0)−0.52
P (35)8 (22.9)−0.384 (11.4)−0.735 (14.3)−0.604 (11.4)−0.72
Positively charged
R (4)2 (50.0)0.351 (25.0)−0.422 (50.0)0.411 (25.0)−0.40
K (11)5 (45.5)0.224 (36.4)−0.156 (54.6)0.545 (45.5)0.10
H (5)1 (20.0)−0.463 (60.0)0.401 (20.0)−0.443 (60.0)0.45
Negatively charged
E (19)3 (15.8)−0.582 (10.5)−0.765 (26.3)−0.262 (10.5)−0.75
D (4)1 (25.0)−0.334 (100.0)1.330 (0)−1.004 (100.0)1.42
Aromatic
F (9)2 (22.2)−0.404 (44.4)0.032 (22.2)−0.373 (33.3)−0.19
Y (4)1 (25.0)−0.332 (50.0)0.161 (25.0)−0.302 (50.0)0.21
1 One code letter was used for amino acid nomenclature. The amino acid C is not present in the sequence of β-casein, while the amino acid W was omitted from the analysis because it occurs only once in the β-casein sequence. Numbers in brackets are the number of specific residues in the protein sequence. 2 The cleaved bonds are reported in Figure 7. 3 See the Materials and Methods section for the calculation of the %P1 and %P1′ cleavage probability and the Kn coefficient. Amino acids with a positive impact on the cleavage probability are shown in bold.
Table 2. Peptides with previously demonstrated bioactivity (100% homology) identified in the β-casein and αS1-casein hydrolysates produced by PrtR1 activity of Lacticaseibacillus casei PRA205 and Lacticaseibacillus casei 2006.
Table 2. Peptides with previously demonstrated bioactivity (100% homology) identified in the β-casein and αS1-casein hydrolysates produced by PrtR1 activity of Lacticaseibacillus casei PRA205 and Lacticaseibacillus casei 2006.
SequenceFragmentBioactivityPrtR1
VVPPβ-casein
f(83–86)
ACE inhibitionL. casei PRA205
VKEAMAPKβ-casein
f(98–105)
Antioxidant
Antimicrobial
L. casei 2006
EAMAPKβ-casein
f(100–105)
AntimicrobialL. casei 2006
SQSKVLPVPQβ-casein
f(166–175)
ACE inhibitionL. casei PRA205
L. casei 2006
KVLPVPQβ-casein
f(169–175)
ACE inhibitionL. casei 2006
VLPVPQKAVPYPQRβ-casein
f(170–183)
AntimicrobialL. casei PRA205
L. casei 2006
VLPVPQKβ-casein
f(170–176)
ACE inhibition Antioxidant
Antimicrobial
L. casei 2006
LPVPQβ-casein
f(171–175)
DPP-IV inhibitionL. casei PRA205
L. casei 2006
PYPQβ-casein
f(179–182)
AntioxidantL. casei PRA205
L. casei 2006
RDMPIQAFβ-casein
f(183–190)
ACE inhibitionL. casei PRA205
L. casei 2006
LLYβ-casein
f(191–193)
ImmunomodulationL. casei PRA205
L. casei 2006
LLYQEPVLGPVRGPFPIIVβ-casein
f(191–209)
ACE inhibitionL. casei PRA205
L. casei 2006
LYQEPVLGPVRGPFPIIVβ-casein
f(192–209)
ImmunomodulationL. casei PRA205
L. casei 2006
YQEPVLGPVRβ-casein
f(193-202)
ACE inhibition ImmunomodulationL. casei PRA205
L. casei 2006
YQEPVLGPVRGPFPIβ-casein
f(193–207)
AntimicrobialL. casei PRA205
L. casei 2006
YQEPVLGPVRGPFPIIVβ-casein
f(193–209)
ACE inhibition Immunomodulation
Antimicrobial
L. casei PRA205
L. casei 2006
QEPVLGPVRGPFPIIVβ-casein
f(194–209)
ACE inhibitionL. casei PRA205
L. casei 2006
EPVLGPVRGPFPβ-casein
f(195–206)
ACE inhibitionL. casei PRA205
L. casei 2006
RPKHPIKαS1-casein
f(1–7)
AntimicrobialL. casei 2006
RPKHPIKHQαS1-casein
f(1–9)
ACE inhibitionL. casei 2006
RPKHPIKHQGLPQEVLNENLLRFαS1-casein
f(1–23)
Immunomodulation
Antimicrobial
L. casei PRA205
L. casei 2006
RPKHPIKHQGLPQEVLNENLLRFFαS1-casein
f(1–24)
AntimicrobialL. casei PRA205
L. casei 2006
RPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGKEKαS1-casein
f(1–36)
AntimicrobialL. casei 2006
VLNENLLRαS1-casein
f(15–22)
AntimicrobialL. casei PRA205
L. casei 2006
YLGYLEQLLRαS1-casein
f(91–100)
AnxiolyticL. casei PRA205
LGYαS1-casein
f(92–94)
ACE inhibition AntioxidantL. casei PRA205
L. casei 2006
LGYLEQLLRLαS1-casein
f(92–101)
AntimicrobialL. casei PRA205
L. casei 2006
YLEQLLRαS1-casein
f(94–100)
AntimicrobialL. casei PRA205
L. casei 2006
PELαS1-casein
f(147–149)
AntioxidantL. casei PRA205
L. casei 2006
GTQYTDAPSFSDIPNPIGSENSEKTTMPLWαS1-casein
f(170–199)
ACE inhibition AntioxidantL. casei PRA205
L. casei 2006
Abbreviations—ACE: angiotensin-converting enzyme; DPP-IV: dipeptidyl peptidase IV.
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Share and Cite

MDPI and ACS Style

Solieri, L.; Sola, L.; Vaccalluzzo, A.; Randazzo, C.L.; Martini, S.; Tagliazucchi, D. Characterization of Cell-Envelope Proteinases from Two Lacticaseibacillus casei Strains Isolated from Parmigiano Reggiano Cheese. Biology 2022, 11, 139. https://doi.org/10.3390/biology11010139

AMA Style

Solieri L, Sola L, Vaccalluzzo A, Randazzo CL, Martini S, Tagliazucchi D. Characterization of Cell-Envelope Proteinases from Two Lacticaseibacillus casei Strains Isolated from Parmigiano Reggiano Cheese. Biology. 2022; 11(1):139. https://doi.org/10.3390/biology11010139

Chicago/Turabian Style

Solieri, Lisa, Laura Sola, Amanda Vaccalluzzo, Cinzia Lucia Randazzo, Serena Martini, and Davide Tagliazucchi. 2022. "Characterization of Cell-Envelope Proteinases from Two Lacticaseibacillus casei Strains Isolated from Parmigiano Reggiano Cheese" Biology 11, no. 1: 139. https://doi.org/10.3390/biology11010139

APA Style

Solieri, L., Sola, L., Vaccalluzzo, A., Randazzo, C. L., Martini, S., & Tagliazucchi, D. (2022). Characterization of Cell-Envelope Proteinases from Two Lacticaseibacillus casei Strains Isolated from Parmigiano Reggiano Cheese. Biology, 11(1), 139. https://doi.org/10.3390/biology11010139

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop