Antimicrobial Peptides with Antibacterial Activity against Vancomycin-Resistant Staphylococcus aureus Strains: Classification, Structures, and Mechanisms of Action
Abstract
:1. Introduction
2. Phenotypic and Genotypic Characteristics of VRSA and VISA Strains That Showed Susceptibility to AMPs
3. Classification of AMPs with Antibacterial Activity against VRSA and VISA Strains
3.1. AMP Classification Based on Their Origin
3.1.1. Animal-Derived AMPs
3.1.2. Bacteria-Derived AMPs
3.1.3. Artificial AMPs
3.2. AMPs Classification Based on Their Physicochemical and Structural Properties
3.2.1. α-helix AMPs
3.2.2. AMPs Forming β-Pleated Sheet Peptides
3.2.3. Mixed AMPs
3.2.4. AMPs of Atypical Structure: Cyclic, Complex, and with Unusual Amino Acids
AMP Name | Aminoacid Sequences and Structures | Molecular Weight (KDa) | Reference |
---|---|---|---|
Nisin | | 3.35 | [53] |
Hominicin | | 2.03 | [52] |
Mutacin 1140 (MU1140) | | 2.26 | [44] |
Mersacidin | | 1.82 | [55,127] |
Bactofencin A (analog 5) | | 2.77 | [28] |
BCP61 | | 9.50 | [45] |
Lugdunin | | 0.78 | [58] |
LI-F04a analog 5 | | – | [58] |
LI-F04a analog 6 | | – | [58] |
LI-F04a analog 8 | | – | [58] |
LI-F04a analog 11 | | – | [58] |
Peptide Name | Chemical Structure | Molecular Weight (KDa) | Reference |
---|---|---|---|
Omiganan | | 1.96 | [42,148] |
Lipopeptide 1 * | | – | [40] |
Lipopeptide 2 * | | – | [40] |
Lipopeptide 3 * | | – | [40] |
Lipopeptide 4 * | | – | [40] |
Lipopeptide 5 * | | – | [40] |
Lipopeptide 6 * | | – | [40] |
3.3. Mechanisms of Action of AMPs with Antibacterial Activity against VRSA and VISA
3.3.1. AMPs That Permeabilize Bacterial Membranes
3.3.2. AMPs That Interact with DNA
4. Conclusions
Supplementary Materials
Author Contributions
Funding
Acknowledgments
Conflicts of Interest
References
- Ventola, C.L. The Antibiotic Resistance: Part 1: Causes and threats. Pharm. Ther. 2015, 40, 277–283. [Google Scholar]
- WHO. Global Antimicrobial Resistance Surveillance System (GLASS) Report; World Health Organization: Geneve, Switzerland, 2017. [Google Scholar]
- Friedman, N.D.; Temkin, E.; Carmeli, Y. The negative impact of antibiotic resistance. Clin. Microbiol. Infect 2016, 22, 416–422. [Google Scholar] [CrossRef]
- Munita, J.M.; Bayer, A.S.; Arias, C.A. Evolving Resistance among Gram-positive Pathogens. Clin. Infect Dis. 2015, 61, S48–S57. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- World Health Organization. Lack of New Antibiotics Threatens Global Efforts to Contain Drug-Resistant Infections. Available online: https://www.who.int/news/item/17-01-2020-lack-of-new-antibiotics-threatens-global-efforts-to-contain-drug-resistant-infections (accessed on 28 May 2021).
- Bassetti, M.; Melica, G.; Cenderello, G.; Rosso, R.; Di Biagio, A.; Bassetti, D. Gram-positive bacterial resistance: A challenge for the next millennium. Panminerva Med. 2002, 44, 179–184. [Google Scholar]
- World Health Organization. WHO Publishes List of Bacteria for Which New Antibiotics Are Urgently Needed. Available online: https://www.who.int/news-room/detail/27-02-2017-who-publishes-list-of-bacteria-for-which-new-antibiotics-are-urgently-needed (accessed on 25 May 2021).
- WHO. Global Priority List of Antibiotic-Resistant Bacteria to Guide Research, Discovery, and Development of New Antibiotics; World Health Organization: Geneve, Switzerland, 2017. [Google Scholar]
- Turner, N.A.; Sharma-Kuinkel, B.K.; Maskarinec, S.A.; Eichenberger, E.M.; Shah, P.P.; Carugati, M.; Holland, T.L.; Fowler, V.G. Methicillin-resistant Staphylococcus aureus: An overview of basic and clinical research. Nat. Rev. Microbiol. 2019, 17, 203–218. [Google Scholar] [CrossRef]
- Chambers, H.F.; DeLeo, F.R. Waves of resistance: Staphylococcus aureus in the antibiotic era. Nat. Rev. Microbiol. 2009, 7, 629–641. [Google Scholar] [CrossRef]
- Lee, A.S.; de Lencastre, H.; Garau, J.; Kluytmans, J.; Malhotra-Kumar, S.; Peschel, A.; Harbarth, S. Methicillin-resistant Staphylococcus aureus. Nat. Rev. Dis. Prim. 2018, 4, 18033. [Google Scholar] [CrossRef]
- Jubeh, B.; Breijyeh, Z.; Karaman, R. Resistance of gram-positive bacteria to current antibacterial agents and overcoming approaches. Molecules 2020, 25, 2888. [Google Scholar] [CrossRef] [PubMed]
- Aldred, K.J.; Kerns, R.J.; Osheroff, N. Mechanism of quinolone action and resistance. Biochemistry 2014, 53, 1565–1574. [Google Scholar] [CrossRef] [PubMed]
- Krause, K.M.; Serio, A.W.; Kane, T.R.; Connolly, L.E. Aminoglycosides: An overview. Cold Spring Harb. Perspect Med. 2020, 6. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Kim, T.; Chong, Y.P.; Park, K.; Bang, K.M.; Park, S.; Kim, S.; Jeong, J.; Lee, S.; Choi, S.; Woo, J.H.; et al. Clinical and microbiological factors associated with early patient mortality from methicillin- resistant Staphylococcus aureus bacteremia. Korean J. Intern. Med. 2019, 34, 184–194. [Google Scholar] [CrossRef] [Green Version]
- Shariati, A.; Dadashi, M.; Moghadam, M.T.; van Belkum, A.; Yaslianifard, S.; Darban-Sarokhalil, D. Global prevalence and distribution of vancomycin resistant, vancomycin intermediate and heterogeneously vancomycin intermediate Staphylococcus aureus clinical isolates: A systematic review and meta-analysis. Sci. Rep. 2020, 10, 1–16. [Google Scholar] [CrossRef]
- Sujatha, S.; Praharaj, I. Glycopeptide resistance in gram-positive Cocci: A review. Interdiscip Perspect Infect Dis. 2012, 2012, 781679. [Google Scholar] [CrossRef] [Green Version]
- Zhanel, G.G.; Schweizer, F.; Karlowsky, J.A. Oritavancin: Mechanism of action. Clin. Infect Dis. 2012, 54, 214–219. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Culp, E.J.; Waglechner, N.; Wang, W.; Fiebig-Comyn, A.A.; Hsu, Y.P.; Koteva, K.; Sychantha, D.; Coombes, B.K.; Van Nieuwenhze, M.S.; Brun, Y.V.; et al. Evolution-guided discovery of antibiotics that inhibit peptidoglycan remodelling. Nature 2020, 578, 582–587. [Google Scholar] [CrossRef] [PubMed]
- Omardien, S.; Brul, S.; Zaat, S.A.J. Antimicrobial activity of cationic antimicrobial peptides against gram-positives: Current progress made in understanding the mode of action and the response of bacteria. Front. Cell Dev. Biol. 2016, 4, 111. [Google Scholar] [CrossRef] [PubMed]
- Yu, G.; Baeder, D.Y.; Regoes, R.R.; Rolff, J. Predicting drug resistance evolution: Insights from antimicrobial peptides and antibiotics. Proc. Biol. Sci. 2018, 285. [Google Scholar] [CrossRef] [Green Version]
- Wang, S.; Zeng, X.; Yang, Q.; Qiao, S. Antimicrobial peptides as potential alternatives to antibiotics in food animal industry. Int. J. Mol. Sci. 2016, 17, 603. [Google Scholar] [CrossRef]
- Lai, Y.; Gallo, R.L. AMPed up immunity: How antimicrobial peptides have multiple roles in immune defense. Trends Immunol. 2009, 30, 131–141. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Huan, Y.; Kong, Q.; Mou, H.; Yi, H. Antimicrobial Peptides: Classification, Design, Application and Research Progress in Multiple Fields. Front. Microbiol. 2020, 11, 1–21. [Google Scholar] [CrossRef]
- Powers, J.P.S.; Hancock, R.E.W. The relationship between peptide structure and antibacterial activity. Peptides 2003, 24, 1681–1691. [Google Scholar] [CrossRef]
- Yeung, A.T.Y.; Gellatly, S.L.; Hancock, R.E.W. Multifunctional cationic host defence peptides and their clinical applications. Cell. Mol. Life Sci. 2011, 68, 2161–2176. [Google Scholar] [CrossRef] [PubMed]
- Park, C.B.; Kim, H.S.; Kim, S.C. Mechanism of Action of the Antimicrobial Peptide Buforin II: Buforin II Kills Microorganisms by Penetrating the Cell Membrane and Inhibiting Cellular Functions. Biochem. Biophys. Res. Commun. 1998, 244, 253–257. [Google Scholar] [CrossRef] [Green Version]
- Bédard, F.; Fliss, I.; Biron, E. Structure-Activity Relationships of the Bacteriocin Bactofencin A and Its Interaction with the Bacterial Membrane. ACS Infect Dis. 2019, 5, 199–207. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Fan, Z.; Cao, L.; He, Y.; Hu, J.; Di, Z.; Wu, Y.; Li, W.; Cao, Z. Ctriporin, a new anti-methicillin-resistant Staphylococcus aureus peptide from the venom of the scorpion Chaerilus tricostatus. Antimicrob. Agents Chemother. 2011, 55, 5220–5229. [Google Scholar] [CrossRef] [Green Version]
- Prestinaci, F.; Pezzotti, P.; Pantosti, A. Antimicrobial resistance: A global multifaceted phenomenon. Pathog. Glob. Health 2015, 109, 309–318. [Google Scholar] [CrossRef] [Green Version]
- Liu, C.; Chambers, H.F. Staphylococcus aureus with Heterogeneous Resistance to Vancomycin: Epidemiology, Clinical Significance, and Critical Assessment of Diagnostic Methods. Antimicrob. Agents Chemother. 2003, 47, 3040–3045. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Makarova, O.; Johnston, P.; Rodriguez-Rojas, A.; El Shazely, B.; Morales, J.M.; Rolff, J. Genomics of experimental adaptation of Staphylococcus aureus to a natural combination of insect antimicrobial peptides. Sci. Rep. 2018, 8, 15359. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- El Shazely, B.; Yu, G.; Johnston, P.R.; Rolff, J. Resistance Evolution Against Antimicrobial Peptides in Staphylococcus aureus Alters Pharmacodynamics Beyond the MIC. Front. Microbiol. 2020, 11, 103. [Google Scholar]
- Miyoshi, N.; Isogai, E.; Hiramatsu, K.; Sasaki, T. Activity of tick antimicrobial peptide from Ixodes persulcatus (persulcatusin) against cell membranes of drug-resistant Staphylococcus aureus. J. Antibiot. (Tokyo) 2017, 70, 142–146. [Google Scholar] [CrossRef] [Green Version]
- Jelinkova, P.; Splichal, Z.; Jimenez, A.M.J.; Haddad, Y.; Mazumdar, A.; Sur, V.P.; Milosavljevic, V.; Kopel, P.; Buchtelova, H.; Guran, R.; et al. Novel vancomycin–peptide conjugate as potent antibacterial agent against vancomycin-resistant Staphylococcus aureus. Infect Drug Resist. 2018, 11, 1807–1817. [Google Scholar] [CrossRef] [Green Version]
- Saravolatz, L.D.; Pawlak, J.; Johnson, L.; Bonilla, H.; Saravolatz, L.D.; Fakih, M.G.; Fugelli, A.; Olsen, W.M. In Vitro activities of LTX-109, a synthetic antimicrobial peptide, against methicillin-resistant, vancomycin-intermediate, vancomycin-resistant, daptomycin-nonsusceptible, and linezolid-nonsusceptible Staphylococcus aureus. Antimicrob. Agents Chemother. 2012, 56, 4478–4482. [Google Scholar] [CrossRef] [Green Version]
- Mohamed, M.F.; Abdelkhalek, A.; Seleem, M.N. Evaluation of short synthetic antimicrobial peptides for treatment of drug-resistant and intracellular Staphylococcus aureus. Sci. Rep. 2016, 6, 1–14. [Google Scholar] [CrossRef]
- Regmi, S.; Choi, Y.H.; Choi, Y.S.; Kim, M.R.; Yoo, J.C. Antimicrobial peptide isolated from Bacillus amyloliquefaciens K14 revitalizes its use in combinatorial drug therapy. Folia Microbiol. (Praha) 2017, 62, 127–138. [Google Scholar] [CrossRef] [PubMed]
- Regmi, S.; Choi, Y.S.; Choi, Y.H.; Kim, Y.K.; Cho, S.S.; Yoo, J.C.; Suh, J.W. Antimicrobial peptide from Bacillus subtilis CSB138: Characterization, killing kinetics, and synergistic potency. Int. Microbiol. 2017, 20, 45–53. [Google Scholar] [CrossRef]
- Azmi, F.; Elliott, A.G.; Marasini, N.; Ramu, S.; Ziora, Z.; Kavanagh, A.M.; Blaskovich, M.A.T.; Cooper, M.A.; Skwarczynski, M.; Toth, I. Short cationic lipopeptides as effective antibacterial agents: Design, physicochemical properties and biological evaluation. Bioorganic Med. Chem. 2016, 24, 2235–2241. [Google Scholar] [CrossRef]
- Shurko, J.F.; Galega, R.S.; Li, C.; Lee, G.C. Evaluation of LL-37 antimicrobial peptide derivatives alone and in combination with vancomycin against S. aureus. J. Antibiot. 2018, 71, 971–974. [Google Scholar] [CrossRef] [Green Version]
- Fritsche, T.R.; Rhomberg, P.R.; Sader, H.S.; Jones, R.N. In Vitro activity of omiganan pentahydrochloride tested against vancomycin-tolerant, -intermediate, and -resistant Staphylococcus aureus. Diagn. Microbiol. Infect Dis. 2008, 60, 399–403. [Google Scholar] [CrossRef] [PubMed]
- Wu, C.; Hsueh, J.; Yip, B.; Chih, Y.; Peng, K.; Cheng, J. Antimicrobial Peptides Display Strong Synergy with Vancomycin Against Vancomycin-Resistant. Int. J. Mol. Sci. 2020, 21, 4578. [Google Scholar]
- Ghobrial, O.G.; Derendorf, H.; Hillman, J.D. Pharmacodynamic activity of the lantibiotic MU1140. Int. J. Antimicrob. Agents 2009, 33, 70–74. [Google Scholar] [CrossRef] [Green Version]
- Choi, Y.H.; Cho, S.S.; Simkhada, J.R.; Yoo, J.C. A novel thermotolerant and acidotolerant peptide produced by a Bacillus strain newly isolated from a fermented food (kimchi) shows activity against multidrug-resistant bacteria. Int. J. Antimicrob. Agents 2012, 40, 80–83. [Google Scholar] [CrossRef]
- Wang, B.; Yao, Y.; Wei, P.; Song, C.; Wan, S.; Yang, S.; Zhu, G.M.; Liu, H.M. Housefly Phormicin inhibits Staphylococcus aureus and MRSA by disrupting biofilm formation and altering gene expression In Vitro and In Vivo. Int. J. Biol. Macromol. 2020. [Google Scholar] [CrossRef]
- Mohamed, M.F.; Hamed, M.I.; Panitch, A.; Seleem, M.N. Targeting methicillin-resistant Staphylococcus aureus with short salt-resistant synthetic peptides. Antimicrob. Agents Chemother. 2014, 58, 4113–4122. [Google Scholar] [CrossRef] [Green Version]
- Muller, J.A.I.; Lawrence, N.; Chan, L.Y.; Harvey, P.J.; Elliott, A.G.; Blaskovich, M.A.T.; Gonçalves, J.C.; Galante, P.; Mortari, M.R.; Toffoli-Kadri, M.C.; et al. Antimicrobial and Anticancer Properties of Synthetic Peptides Derived from the Wasp Parachartergus fraternus. Chem. Biol. Chem. 2021, 22, 1415–1423. [Google Scholar] [CrossRef] [PubMed]
- Cirioni, O.; Silvestri, C.; Ghiselli, R.; Giacometti, A.; Orlando, F.; Mocchegiani, F.; Chiodi, L.; Della Vittoria, A.; Saba, V.; Scalise, G. Experimental study on the efficacy of combination of α-helical antimicrobial peptides and vancomycin against Staphylococcus aureus with intermediate resistance to glycopeptides. Peptides 2006, 27, 2600–2606. [Google Scholar] [CrossRef]
- Lima, W.G.; de Brito, J.C.M.; Cardoso, V.N.; Fernandes, S.O.A. In-depth characterization of antibacterial activity of melittin against Staphylococcus aureus and use in a model of non-surgical MRSA-infected skin wounds. Eur. J. Pharm. Sci. 2021, 156, 105592. [Google Scholar] [CrossRef]
- Wenzel, M.; Prochnow, P.; Mowbray, C.; Vuong, C.; Höxtermann, S.; Stepanek, J.J.; Albada, H.B.; Hall, J.; Metzler-Nolte, N.; Bandow, J.E. Towards profiles of resistance development and toxicity for the small cationic hexapeptide RWRWRW-NH 2. Front. Cell Dev. Biol. 2016, 4, 1–9. [Google Scholar] [CrossRef] [Green Version]
- Kim, P.I.; Sohng, J.K.; Sung, C.; Joo, H.S.; Kim, E.M.; Yamaguchi, T.; Park, D.; Kim, B.G. Characterization and structure identification of an antimicrobial peptide, hominicin, produced by Staphylococcus hominis MBBL 2-9. Biochem. Biophys. Res. Commun. 2010, 399, 133–138. [Google Scholar] [CrossRef] [PubMed]
- Piper, C.; Draper, L.A.; Cotter, P.D.; Ross, R.P.; Hill, C. A comparison of the activities of lacticin 3147 and nisin against drug-resistant Staphylococcus aureus and Enterococcus species. J. Antimicrob. Chemother. 2009, 64, 546–551. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Harrison, P.L.; Abdel-Rahman, M.A.; Strong, P.N.; Tawfik, M.M.; Miller, K. Characterisation of three alpha-helical antimicrobial peptides from the venom of Scorpio maurus palmatus. Toxicon 2016, 117, 30–36. [Google Scholar] [CrossRef] [PubMed]
- Sass, P.; Jansen, A.; Szekat, C.; Sass, V.; Sahl, H.G.; Bierbaum, G. The lantibiotic mersacidin is a strong inducer of the cell wall stress response of Staphylococcus aureus. BMC Microbiol. 2008, 8, 1–11. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Mishra, B.; Wang, X.; Lushnikova, T.; Zang, Y.; Golla, R.; Lakshmaiah, J.; Wang, C.; Mcguire, T.; Wang, G. Antibacterial, Antifungal, Anticancer Activities and Structural Bioinformatics Analysis of Six Naturally Occurring Temporins. Peptides 2018, 1, 9–20. [Google Scholar] [CrossRef]
- Bionda, N.; Stawikowski, M.; Stawikowski, R.; Cudic, M.; Lopéz, F.; Treitl, D.; Medina, J.; Cudic, P. Effects of cyclic lipodepsipeptide structural modulation on stability, antibacterial activity and human cell toxicity. Chem. Med. Chem. 2012, 7, 871–882. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Zipperer, A.; Konnerth, M.C.; Laux, C.; Berscheid, A.; Janek, D.; Weidenmaier, C.; Burian, M.; Schilling, N.A.; Slavetinsky, C.; Marschal, M.; et al. Human commensals producing a novel antibiotic impair pathogen colonization. Nature 2016, 535, 511–516. [Google Scholar] [CrossRef]
- Mishra, B.; Lushnikova, T.; Wang, G. Small lipopeptides possess anti-biofilm capability comparable to daptomycin and vancomycin. RSC Adv. 2015, 5, 59758–59769. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Nielsen, S.L.; Frimodt-Møller, N.; Kragelund, B.B.; Hansen, P.R. Structure-activity study of the antibacterial peptide fallaxin. Protein Sci. 2007, 16, 1969–1976. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Garoy, E.Y.; Gebreab, Y.B.; Achila, O.O.; Tekeste, D.G.; Kesete, R.; Ghirmay, R.; Kiflay, R.; Tesfu, T. Methicillin-Resistant Staphylococcus aureus (MRSA): Prevalence and Antimicrobial Sensitivity Pattern among Patients—A Multicenter Study in Asmara, Eritrea. Can. J. Infect Dis. Med. Microbiol. 2019, 2019. [Google Scholar] [CrossRef] [Green Version]
- Steinig, E.J.; Duchene, S.; Robinson, D.A.; Monecke, S.; Yokoyama, M.; Laabei, M.; Slickers, P.; Andersson, P.; Williamson, D.; Kearns, A.; et al. Evolution and global transmission of a multidrug-resistant, community-associated methicillin-resistant staphylococcus aureus lineage from the Indian subcontinent. MBio 2019, 10, 1–20. [Google Scholar] [CrossRef] [Green Version]
- Parastan, R.; Kargar, M.; Solhjoo, K.; Kafilzadeh, F. A synergistic association between adhesion-related genes and multidrug resistance patterns of Staphylococcus aureus isolates from different patients and healthy individuals. J. Glob. Antimicrob. Resist. 2020, 22, 379–385. [Google Scholar] [CrossRef]
- Farrell, D.J.; Flamm, R.K.; Sader, H.S.; Jones, R.N. Activity of ceftobiprole against methicillin-resistant Staphylococcus aureus strains with reduced susceptibility to daptomycin, linezolid or vancomycin, and strains with defined SCCmec types. Int. J. Antimicrob. Agents 2014, 43, 323–327. [Google Scholar] [CrossRef] [PubMed]
- Shekarabi, M.; Hajikhani, B.; Salimi Chirani, A.; Fazeli, M.; Goudarzi, M. Molecular characterization of vancomycin-resistant Staphylococcus aureus strains isolated from clinical samples: A three year study in Tehran, Iran. PLoS ONE 2017, 12, e0183607. [Google Scholar] [CrossRef] [PubMed]
- Reichmann, N.T.; Pinho, M.G. Role of SCCmec type in resistance to the synergistic activity of oxacillin and cefoxitin in MRSA. Sci. Rep. 2017, 7, 1–9. [Google Scholar] [CrossRef] [Green Version]
- Katayama, Y.; Ito, T.; Hiramatsu, K. A new class of genetic element, staphylococcus cassette chromosome mec, encodes methicillin resistance in Staphylococcus aureus. Antimicrob. Agents Chemother. 2000, 44, 1549–1555. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- BARBER, M. Methicillin-resistant staphylococci. J. Clin. Pathol. 1961, 14, 385–393. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Hiramatsu, K.; Katayama, Y.; Matsuo, M.; Sasaki, T.; Morimoto, Y.; Sekiguchi, A.; Baba, T. Multi-drug-resistant Staphylococcus aureus and future chemotherapy. J. Infect Chemother 2014, 20, 593–601. [Google Scholar] [CrossRef] [Green Version]
- Chambers, H.F. Methicillin resistance in staphylococci: Molecular and biochemical basis and clinical implications. Clin. Microbiol. Rev. 1997, 10, 781–791. [Google Scholar] [CrossRef]
- Ito, T.; Katayama, Y.; Asada, K.; Mori, N.; Tsutsumimoto, K.; Tiensasitorn, C.; Hiramatsu, K. Structural comparison of three types of staphylococcal cassette chromosome mec integrated in the chromosome in methicillin-resistant Staphylococcus aureus. Antimicrob. Agents Chemother. 2001, 45, 1323–1336. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Miragaia, M. Factors contributing to the evolution of Meca-mediated β-lactam resistance in staphylococci: Update and new insights from whole genome sequencing (WGS). Front. Microbiol. 2018, 9, 2723. [Google Scholar] [CrossRef] [Green Version]
- Mella, S.S. Staphylococcus aureus resistente a vancomicina. Rev. Chil. Infectol. 2002, 19, 575–587. [Google Scholar] [CrossRef]
- CLSI. Performance Standards for Antimicrobial Susceptibility Testing; Twenty-Seventh Informational Supplement, CLSI Document M100-S27; Clinical and Laboratory Standards Institute: Wayne, PA, USA, 2017; ISBN 1562387855. [Google Scholar]
- Cong, Y.; Yang, S.; Rao, X. Vancomycin resistant Staphylococcus aureus infections: A review of case updating and clinical features. J. Adv. Res. 2020, 21, 169–176. [Google Scholar] [CrossRef] [PubMed]
- McGuinness, W.A.; Malachowa, N.; DeLeo, F.R. Vancomycin resistance in Staphylococcus aureus. Yale J. Biol. Med. 2017, 90, 269–281. [Google Scholar]
- Loomba, P.; Taneja, J.; Mishra, B. Methicillin and vancomycin resistant S. aureus in hospitalized patients. J. Glob. Infect Dis. 2010, 2, 275. [Google Scholar] [CrossRef]
- Howden, B.P.; Davies, J.K.; Johnson, P.D.R.; Stinear, T.P.; Grayson, M.L. Reduced vancomycin susceptibility in Staphylococcus aureus, including vancomycin-intermediate and heterogeneous vancomycin-intermediate strains: Resistance mechanisms, laboratory detection, and clinical implications. Clin. Microbiol. Rev. 2010, 23, 99–139. [Google Scholar] [CrossRef] [Green Version]
- Chaili, S.; Cheung, A.L.; Bayer, A.S.; Xiong, Y.Q.; Waring, A.J.; Memmi, G.; Donegan, N.; Yang, S.J.; Yeaman, M.R. The GraS sensor in Staphylococcus aureus mediates resistance to host defense peptides differing in mechanisms of action. Infect Immun. 2016, 84, 459–466. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Lei, J.; Sun, L.C.; Huang, S.; Zhu, C.; Li, P.; He, J.; Mackey, V.; Coy, D.H.; He, Q.Y. The antimicrobial peptides and their potential clinical applications. Am. J. Transl. Res. 2019, 11, 3919–3931. [Google Scholar] [PubMed]
- Wu, X.; Li, Z.; Li, X.; Tian, Y.; Fan, Y.; Yu, C.; Zhou, B.; Liu, Y.; Xiang, R.; Yang, L. Synergistic effects of antimicrobial peptide DP7 combined with antibiotics against multidrug-resistant bacteria. Drug Des. Devel. Ther. 2017, 11, 939–946. [Google Scholar] [CrossRef] [Green Version]
- Aoki, W.; Ueda, M. Characterization of antimicrobial peptides toward the development of novel antibiotics. Pharmaceuticals 2013, 6, 1055–1081. [Google Scholar] [CrossRef] [Green Version]
- Ganz, T. The Role of Antimicrobial Peptides in Innate Immunity. Integr. Comp. Biol. 2003, 43, 300–304. [Google Scholar] [CrossRef] [Green Version]
- Khurshid, Z.; Naseem, M.; Sheikh, Z.; Najeeb, S.; Shahab, S.; Zafar, M.S. Oral antimicrobial peptides: Types and role in the oral cavity. Saudi Pharm. J. 2016, 24, 515–524. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Chaparro-Aguirre, E.; Segura-Ramírez, P.J.; Alves, F.L.; Riske, K.A.; Miranda, A.; Silva Júnior, P.I. Antimicrobial activity and mechanism of action of a novel peptide present in the ecdysis process of centipede Scolopendra subspinipes subspinipes. Sci. Rep. 2019, 9, 1–11. [Google Scholar] [CrossRef] [PubMed]
- Levy, O. Antimicrobial proteins and peptides of blood: Templates for novel antimicrobial agents. Blood 2000, 96, 2664–2672. [Google Scholar] [CrossRef]
- Han, F.F.; Liu, Y.F.; Xie, Y.G.; Gao, Y.H.; Luan, C.; Wang, Y.Z. Antimicrobial peptides derived from different animals: Comparative studies of antimicrobial properties, cytotoxicity and mechanism of action. World J. Microbiol. Biotechnol. 2011, 27, 1847–1857. [Google Scholar] [CrossRef]
- Wu, Q.; Patočka, J.; Kuča, K. Insect Antimicrobial Peptides, a Mini Review. Toxins 2018, 10, 461. [Google Scholar] [CrossRef] [PubMed]
- Brady, D.; Grapputo, A.; Romoli, O.; Sandrelli, F. Insect cecropins, antimicrobial peptides with potential therapeutic applications. Int. J. Mol. Sci. 2019, 20, 5862. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Choi, J.H.; Jang, A.Y.; Lin, S.; Lim, S.; Kim, D.; Park, K.; Han, S.M.; Yeo, J.H.; Seo, H.S. Melittin, a honeybee venom-derived antimicrobial peptide, may target methicillin-resistant Staphylococcus aureus. Mol. Med. Rep. 2015, 12, 6483–6490. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Dosler, S.; Alev Gerceker, A. In vitro activities of antimicrobial cationic peptides; melittin and nisin, alone or in combination with antibiotics against Gram-positive bacteria. J. Chemother 2012, 24, 137–143. [Google Scholar] [CrossRef] [PubMed]
- Akbari, R.; Hakemi Vala, M.; Hashemi, A.; Aghazadeh, H.; Sabatier, J.M.; Pooshang Bagheri, K. Action mechanism of melittin-derived antimicrobial peptides, MDP1 and MDP2, de novo designed against multidrug resistant bacteria. Amino Acids 2018, 50, 1231–1243. [Google Scholar] [CrossRef] [PubMed]
- Lee, E.; Shin, A.; Kim, Y. Anti-inflammatory activities of cecropin A and its mechanism of action. Arch. Insect Biochem. Physiol. 2015, 88, 31–44. [Google Scholar] [CrossRef]
- Mendes, M.A.; De Souza, B.M.; Marques, M.R.; Palma, M.S. Structural and biological characterization of two novel peptides from the venom of the neotropical social wasp Agelaia pallipes pallipes. Toxicon 2004, 44, 67–74. [Google Scholar] [CrossRef]
- Saez, N.J.; Senff, S.; Jensen, J.E.; Er, S.Y.; Herzig, V.; Rash, L.D.; King, G.F. Spider-venom peptides as therapeutics. Toxins 2010, 2, 2851–2871. [Google Scholar] [CrossRef] [Green Version]
- Estrada-Peña, A.; Cabezas-Cruz, A.; Obregón, D. Resistance of tick gut microbiome to anti-tick vaccines, pathogen infection and antimicrobial peptides. Pathogens 2020, 9, 309. [Google Scholar] [CrossRef]
- Saito, Y.; Konnai, S.; Yamada, S.; Imamura, S.; Nishikado, H.; Ito, T.; Onuma, M.; Ohashi, K. Identification and characterization of antimicrobial peptide, defensin, in the taiga tick, ixodes persulcatus. Insect Mol. Biol. 2009, 18, 531–539. [Google Scholar] [CrossRef]
- Imura, Y.; Choda, N.; Matsuzaki, K. Magainin 2 in action: Distinct modes of membrane permeabilization in living bacterial and mammalian cells. Biophys. J. 2008, 95, 5757–5765. [Google Scholar] [CrossRef] [Green Version]
- Hani, K.; Zairi, A.; Tangy, F.; Bouassida, K. Dermaseptins and magainins: Antimicrobial peptides from frogs’ skin-new sources for a promising spermicides microbicides-a mini review. J. Biomed. Biotechnol. 2009, 2009, 452567. [Google Scholar] [CrossRef] [Green Version]
- Romero, S.M.; Cardillo, A.B.; Martínez Ceron, M.C.; Camperi, S.A.; Giudicessi, S.L. Temporins: An Approach of Potential Pharmaceutic Candidates. Surg. Infect 2020, 21, 309–322. [Google Scholar] [CrossRef]
- Šíma, P.; Trebichavský, I.; Sigler, K. Mammalian antibiotic peptides. Folia Microbiol. (Praha) 2003, 48, 123–137. [Google Scholar] [CrossRef]
- Dürr, U.H.N.; Sudheendra, U.S.; Ramamoorthy, A. LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochim. Biophys. Acta Biomembr. 2006, 1758, 1408–1425. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Pahar, B.; Madonna, S.; Das, A.; Albanesi, C.; Girolomoni, G. Immunomodulatory role of the antimicrobial ll-37 peptide in autoimmune diseases and viral infections. Vaccines 2020, 8, 517. [Google Scholar] [CrossRef] [PubMed]
- Geitani, R.; Ayoub Moubareck, C.; Touqui, L.; Karam Sarkis, D. Cationic antimicrobial peptides: Alternatives and/or adjuvants to antibiotics active against methicillin-resistant Staphylococcus aureus and multidrug-resistant Pseudomonas aeruginosa. BMC Microbiol. 2019, 19, 1–12. [Google Scholar] [CrossRef] [Green Version]
- Hibbing, M.E.; Fuqua, C.; Parsek, M.R.; Peterson, S.B. Bacterial competition: Surviving and thriving in the microbial jungle. Nat. Rev. Microbiol. 2010, 8, 15–25. [Google Scholar] [CrossRef] [Green Version]
- Zharkova, M.S.; Orlov, D.S.; Golubeva, O.Y.; Chakchir, O.B.; Eliseev, I.E.; Grinchuk, T.M.; Shamova, O.V. Application of antimicrobial peptides of the innate immune system in combination with conventional antibiotics-a novel way to combat antibiotic resistance? Front. Cell. Infect Microbiol. 2019, 9, 128. [Google Scholar] [CrossRef] [Green Version]
- Santos, J.C.P.; Sousa, R.C.S.; Otoni, C.G.; Moraes, A.R.F.; Souza, V.G.L.; Medeiros, E.A.A.; Espitia, P.J.P.; Pires, A.C.S.; Coimbra, J.S.R.; Soares, N.F.F. Nisin and other antimicrobial peptides: Production, mechanisms of action, and application in active food packaging. Innov. Food Sci. Emerg. Technol. 2018, 48, 179–194. [Google Scholar] [CrossRef]
- Simons, A.; Alhanout, K.; Duval, R.E. Bacteriocins, antimicrobial peptides from bacterial origin: Overview of their biology and their impact against multidrug-resistant bacteria. Microorganisms 2020, 8, 639. [Google Scholar] [CrossRef] [PubMed]
- Maher, S.; McClean, S. Investigation of the cytotoxicity of eukaryotic and prokaryotic antimicrobial peptides in intestinal epithelial cells In Vitro. Biochem. Pharmacol. 2006, 71, 1289–1298. [Google Scholar] [CrossRef] [PubMed]
- Kers, J.A.; Sharp, R.E.; Defusco, A.W.; Park, J.H.; Xu, J.; Pulse, M.E.; Weiss, W.J.; Handfield, M. Mutacin 1140 lantibiotic variants are efficacious against Clostridium difficile infection. Front. Microbiol. 2018, 9, 1–14. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Geng, M.; Ravichandran, A.; Escano, J.; Smith, L. Efficacious Analogs of the Lantibiotic Mutacin 1140 against a Systemic Methicillin-Resistant Staphylococcus aureus Infection. Antimicrob. Agents Chemother. 2018, 62, e01626-18. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Kruszewska, D.; Sahl, H.; Bierbaum, G.; Pag, U.; Hynes, S.O. Mersacidin eradicates methicillin-resistant Staphylococcus aureus (MRSA) in a mouse rhinitis model. J. Antimicrob. Chemother. 2004, 54, 648–653. [Google Scholar] [CrossRef]
- Patra, J.K.; Das, G.; Paramithiotis, S.; Shin, H.S. Kimchi and other widely consumed traditional fermented foods of Korea: A review. Front. Microbiol. 2016, 7, 1–15. [Google Scholar] [CrossRef] [Green Version]
- Chai, K.F.; Voo, A.Y.H.; Chen, W.N. Bioactive peptides from food fermentation: A comprehensive review of their sources, bioactivities, applications, and future development. Compr. Rev. Food Sci. Food Saf. 2020, 19, 3825–3885. [Google Scholar] [CrossRef]
- Torres, M.D.T.; de la Fuente-Nunez, C. Toward computer-made artificial antibiotics. Curr. Opin. Microbiol. 2019, 51, 30–38. [Google Scholar] [CrossRef]
- Huerta-cantillo, J.; Navarro-garcía, F. Properties and design of antimicrobial peptides as potential tools against pathogens and malignant cells. Investig. Discapac. 2016, 5, 96–115. [Google Scholar]
- Lytix Bipharma. LTX-109—A High Value Game Changer in Diabetic Foot Infections. Successful Proof of Concept for Topical Antimicrobial Drug Lytixar (LTX-109) . Available online: https://www.lytixbiopharma.com/news/152/130/Successful-Proof-of-Concept-for-topical-antimicrobial-drug-Lytixar-LTX-109.html (accessed on 26 May 2021).
- Rubinchik, E.; Dugourd, D.; Algara, T.; Pasetka, C.; Friedland, H.D. Antimicrobial and antifungal activities of a novel cationic antimicrobial peptide, omiganan, in experimental skin colonisation models. Int. J. Antimicrob. Agents 2009, 34, 457–461. [Google Scholar] [CrossRef]
- Sader, H.S.; Fedler, K.A.; Rennie, R.P.; Stevens, S.; Jones, R.N. Omiganan pentahydrochloride (MBI 226), a topical 12-amino-acid cationic peptide: Spectrum of antimicrobial activity and measurements of bactericidal activity. Antimicrob. Agents Chemother. 2004, 48, 3112–3118. [Google Scholar] [CrossRef] [Green Version]
- Lohan, S.; Monga, J.; Cameotra, S.S.; Bisht, G.S. In Vitro and In Vivo antibacterial evaluation and mechanistic study of ornithine based small cationic lipopeptides against antibiotic resistant clinical isolates. Eur. J. Med. Chem. 2014, 88, 19–27. [Google Scholar] [CrossRef]
- Kumar, P.; Kizhakkedathu, J.N.; Straus, S.K. Antimicrobial peptides: Diversity, mechanism of action and strategies to improve the activity and biocompatibility In Vivo. Biomolecules 2018, 8, 4. [Google Scholar] [CrossRef] [Green Version]
- Hancock, R.E.W.; Diamond, G. The role of cationic antimicrobial peptides in innate host defences. Trends Microbiol. 2000, 8, 402–410. [Google Scholar] [CrossRef]
- Osorio, D.; Rondón-Villarreal, P.; Torres, R. Peptides: A package for data mining of antimicrobial peptides. R J. 2015, 7, 4–14. [Google Scholar] [CrossRef]
- Harris, F.; Dennison, S.; Phoenix, D. Anionic Antimicrobial Peptides from Eukaryotic Organisms. Curr. Protein Pept. Sci. 2009, 10, 585–606. [Google Scholar] [CrossRef] [PubMed]
- Wang, J.; Dou, X.; Song, J.; Lyu, Y.; Zhu, X.; Xu, L.; Li, W.; Shan, A. Antimicrobial peptides: Promising alternatives in the post feeding antibiotic era. Med. Res. Rev. 2018, 39, 831–859. [Google Scholar] [CrossRef]
- Zelezetsky, I.; Tossi, A. Alpha-helical antimicrobial peptides-Using a sequence template to guide structure-activity relationship studies. Biochim. Biophys. Acta Biomembr. 2006, 1758, 1436–1449. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Mojsoska, B.; Jenssen, H. Peptides and peptidomimetics for antimicrobial drug design. Pharmaceuticals 2015, 8, 366–415. [Google Scholar] [CrossRef] [PubMed]
- Sancho-Vaello, E.; Gil-Carton, D.; François, P.; Bonetti, E.J.; Kreir, M.; Pothula, K.R.; Kleinekathöfer, U.; Zeth, K. The structure of the antimicrobial human cathelicidin LL-37 shows oligomerization and channel formation in the presence of membrane mimics. Sci. Rep. 2020, 10, 1–16. [Google Scholar] [CrossRef]
- Seil, M.; Nagant, C.; Dehaye, J.P.; Vandenbranden, M.; Lensink, M.F. Spotlight on human LL-37, an immunomodulatory peptide with promising cell-penetrating properties. Pharmaceuticals 2010, 3, 3435–3460. [Google Scholar] [CrossRef] [Green Version]
- Raghuraman, H.; Chattopadhyay, A. Melittin: A membrane-active peptide with diverse functions. Biosci. Rep. 2007, 27, 189–223. [Google Scholar] [CrossRef]
- Ceremuga, M.; Stela, M.; Janik, E.; Gorniak, L.; Synowiec, E.; Sliwinski, T.; Sitarek, P.; Saluk-Bijak, J.; Bijak, M. Melittin—a natural peptide from bee venom which induces apoptosis in human leukaemia cells. Biomolecules 2020, 10, 247. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Matsuzaki, K.; Sugishita, K.I.; Harada, M.; Fujii, N.; Miyajima, K. Interactions of an antimicrobial peptide, magainin 2, with outer and inner membranes of Gram-negative bacteria. Biochim. Biophys. Acta Biomembr. 1997, 1327, 119–130. [Google Scholar] [CrossRef] [Green Version]
- Ennahar, S.; Sashihara, T.; Sonomoto, K.; Ishizaki, A. Class IIa bacteriocins: Biosynthesis, structure and activity. FEMS Microbiol. Rev. 2000, 24, 85–106. [Google Scholar] [CrossRef] [PubMed]
- Müller, A.; Wenzel, M.; Strahl, H.; Grein, F.; Saaki, T.N.V.; Kohl, B.; Siersma, T.; Bandow, J.E.; Sahl, H.G.; Schneider, T.; et al. Daptomycin inhibits cell envelope synthesis by interfering with fluid membrane microdomains. Proc. Natl. Acad. Sci. USA 2016, 113, E7077–E7086. [Google Scholar] [CrossRef] [Green Version]
- Zhong, G.; Cheng, J.; Liang, Z.C.; Xu, L.; Lou, W.; Bao, C.; Ong, Z.Y.; Dong, H.; Yang, Y.Y.; Fan, W. Short Synthetic β-Sheet Antimicrobial Peptides for the Treatment of Multidrug-Resistant Pseudomonas aeruginosa Burn Wound Infections. Adv. Healthc. Mater. 2017, 6. [Google Scholar] [CrossRef]
- Jin, Y.; Hammer, J.; Pate, M.; Zhang, Y.; Zhu, F.; Zmuda, E.; Blazyk, J. Antimicrobial activities and structures of two linear cationic peptide families with various amphipathic β-sheet and α-helical potentials. Antimicrob. Agents Chemother. 2005, 49, 4957–4964. [Google Scholar] [CrossRef] [Green Version]
- Rausch, J.M.; Marks, J.R.; Wimley, W.C. Rational combinatorial design of pore-forming β-sheet peptides. Proc. Natl. Acad. Sci. USA 2005, 102, 10511–10515. [Google Scholar] [CrossRef] [Green Version]
- Santos-Silva, C.A.; Zupin, L.; Oliveira-Lima, M.; Vilela, L.M.; Bezerra-Neto, J.P.; Ferreira-Neto, J.R.; Ferreira, J.D.; Oliveira-Silva, R.L.; Pires, C.D.; Aburjaile, F.F.; et al. Plant Antimicrobial Peptides: State of the Art, In Silico Prediction and Perspectives in the Omics Era. Bioinform. Biol. Insights 2020, 14. [Google Scholar] [CrossRef] [PubMed]
- Greco, S.; Gerdol, M.; Edomi, P.; Pallavicini, A. Molecular Diversity of Mytilin-Like Defense Peptides (Mollusca, Bivalvia). Antibiotics 2020, 9, 37. [Google Scholar] [CrossRef] [Green Version]
- Dias, R.D.O.; Franco, O.L. Cysteine-stabilized αβ defensins: From a common fold to antibacterial activity. Peptides 2015, 72, 64–72. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Lee, D.W.; Kim, B.S. Antimicrobial cyclic peptides for plant disease control. Plant. Pathol. J. 2015, 31, 1–11. [Google Scholar] [CrossRef]
- Jeong Hee, J.; Ha Chul, S. Crystal Structure of NisI in a Lipid-Free Form, the Nisin Immunity Protein, from Lactococcus lactis. Antimicrob. Agents Chemother. 2018, 62, 1–12. [Google Scholar] [CrossRef] [Green Version]
- Williams, G.C.; Delves-Broughton, J. NISIN. In Encyclopedia of Food Sciences and Nutrition, 2nd ed.; Caballero, B., Ed.; Academic Press: Oxford, UK, 2003; pp. 4128–4135. ISBN 978-0-12-227055-0. [Google Scholar]
- Smith, L.; Zachariah, C.; Thirumoorthy, R.; Rocca, J.; Novák, J.; Hillman, J.D.; Edison, A.S. Structure and dynamics of the lantibiotic mutacin 1140. Biochemistry 2003, 42, 10372–10384. [Google Scholar] [CrossRef] [PubMed]
- O’Shea, E.F.; O’Connor, P.M.; O’Sullivan, O.; Cotter, P.D.; Ross, R.P.; Hill, C. Bactofencin A, a new type of cationic bacteriocin with Unusual Immunity. MBio 2013, 4, 1–9. [Google Scholar] [CrossRef] [Green Version]
- Rubinchik, E.; Dugourd, D. Omiganan Pentahydrochloride: A Novel, Broad-Spectrum Antimicrobial Peptide for Topical Use; Wiley-VCH Verlag GmbH & Co, Boschstr.: Weinheim, Germany, 2011; pp. 157–169. ISBN 9783527328918. [Google Scholar]
- Yu, H.-Y.; Tu, C.-H.; Yip, B.-S.; Chen, H.-L.; Cheng, H.-T.; Huang, K.-C.; Lo, H.-J.; Cheng, J.-W. Easy strategy to increase salt resistance of antimicrobial peptides. Antimicrob. Agents Chemother. 2011, 55, 4918–4921. [Google Scholar] [CrossRef] [Green Version]
- National Center for Biotechnology Information. PubChem Compound Summary for CID 16131446, Omiganan Pentahydrochloride. Available online: https://pubchem.ncbi.nlm.nih.gov/compound/Omiganan-pentahydrochloride (accessed on 3 June 2021).
- Datta, S.; Roy, A. Antimicrobial Peptides as Potential Therapeutic Agents: A Review. Int. J. Pept. Res. Ther. 2021, 27, 555–577. [Google Scholar] [CrossRef]
- Martinez de Tejada, G.; Sanchez-Gomez, S.; Razquin-Olazaran, I.; Kowalski, I.; Kaconis, Y.; Heinbockel, L.; Andra, J.; Schurholz, T.; Hornef, M.; Dupont, A.; et al. Bacterial Cell Wall Compounds as Promising Targets of Antimicrobial Agents I. Antimicrobial Peptides and Lipopolyamines. Curr. Drug Targets 2012, 13, 1121–1130. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Malanovic, N.; Lohner, K. Antimicrobial Peptides Targeting Gram-Positive Bacteria. Pharmaceuticals 2016, 9, 59. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Ren, H.; Gray, W.M. Amino Acid Composition Determines Peptide Activity Spectrum and Hot-Spot-Based Design of Merecidin. Physiol. Behav. 2019, 176, 139–148. [Google Scholar] [CrossRef]
- Yin, L.M.; Edwards, M.A.; Li, J.; Yip, C.M.; Deber, C.M. Roles of hydrophobicity and charge distribution of cationic antimicrobial peptides in peptide-membrane interactions. J. Biol. Chem. 2012, 287, 7738–7745. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Sohlenkamp, C.; Geiger, O. Bacterial membrane lipids: Diversity in structures and pathways. FEMS Microbiol. Rev. 2015, 40, 133–159. [Google Scholar] [CrossRef] [Green Version]
- Van Den Bogaart, G.; Guzmán, J.V.; Mika, J.T.; Poolman, B. On the mechanism of pore formation by melittin. J. Biol. Chem. 2008, 283, 33854–33857. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Matsuzaki, K.; Sugishita, K.; Ishibe, N.; Ueha, M.; Nakata, S.; Miyajima, K.; Epand, R.M. Relationship of Membrane Curvature to the Formation of Pores by Magainin 2. Biochemistry 1998, 37, 11856–11863. [Google Scholar] [CrossRef]
- Subbalakshmi, C.; Sitaram, N. Mechanism of antimicrobial action of indolicidin. FEMS Microbiol. Lett. 1998, 160, 91–96. [Google Scholar] [CrossRef]
Strain ID * | Interpretive Categories for Conventional Antibiotics | Method | Genotype | Reference | ||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
PEN 1 | AMX 1 | OXA 1 | ERY 2 | VAN 3 | TET 4 | DAP 5 | LZD 6 | CLI 7 | ||||
VRSA-1 | R | – | – | – | R | – | – | – | – | MIC (μg/mL) | – | [29] |
VRSA-2 | R | – | – | – | R | – | – | – | – | MIC (μg/mL) | – | [29] |
VRSA-3 | – | – | – | – | R | – | – | – | – | – | – | [34] |
VRSA-4 | R | R | – | R | R | S | – | – | – | Disc diffusion | VanA | [35] |
VRSA-5 | – | – | – | – | R | – | S | S | R | MIC (μg/mL) | SCCmec II | [36] |
VRSA-6 | – | – | R | – | R | – | – | – | – | MIC (μM) | – | [37] |
VRSA-7 | – | – | R | – | R | – | – | – | – | MIC (μM) | – | [37] |
VRSA-8 | – | – | R | – | R | – | – | – | – | MIC (μM) | – | [37] |
VRSA-9 | – | – | R | – | R | – | – | – | – | MIC (μM) | – | [37] |
VRSA-10 | – | – | R | – | R | – | – | – | – | MIC (μM) | – | [37] |
VRSA-11 | – | – | R | – | R | – | – | – | – | MIC (μM) | – | [37] |
VRSA-12 | – | – | R | – | R | – | – | – | – | MIC (μM) | – | [37] |
VRSA-13 | R | – | R | – | R | – | – | – | – | MIC (μg/mL) | – | [38] |
VRSA-14 | – | – | – | – | R | – | – | – | – | MIC (μg/mL) | – | [39] |
VRSA-15 | – | – | – | – | R | – | – | – | – | MIC (μM) | – | [40] |
VRSA-16 | – | – | – | – | R | – | – | – | – | MIC (μM) | – | [40] |
VRSA-17 | – | – | – | – | R | – | – | – | – | MIC (μM) | – | [40] |
VRSA-18 | – | – | – | – | R | – | – | – | – | MIC (μg/mL) | – | [41] |
VRSA-19 | – | – | S | R | R | R | – | – | R | MIC (μg/mL) | – | [42] |
VRSA-20 | – | – | – | - | R | – | – | – | – | MIC (μg/mL) | – | [43] |
VRSA-21 | – | – | – | - | R | – | – | – | – | MIC (μg/mL) | – | [43] |
VRSA-22 | – | – | – | - | R | – | – | – | – | MIC (μg/mL) | – | [43] |
VRSA-23 | – | – | – | - | R | – | – | – | – | MIC (μg/mL) | – | [44] |
VRSA-24 | – | – | – | - | R | – | – | – | – | MIC (μg/mL) | – | [45] |
VRSA-25 | – | – | – | - | R | – | – | – | – | – | – | [28] |
VRSA-26 | – | – | – | - | R | – | – | – | – | – | – | [28] |
VRSA-27 | – | – | – | - | R | – | – | – | – | MIC (μg/mL) | MecA | [46] |
VRSA-28 | – | – | – | - | R | – | – | S | – | – | – | [47] |
VRSA-29 | – | – | – | - | R | – | – | S | – | – | – | [47] |
VRSA-30 | – | – | – | - | R | – | – | S | – | – | – | [47] |
VRSA-31 | – | – | – | - | R | – | – | S | – | – | – | [47] |
VRSA-32 | – | – | – | - | R | – | – | R | – | – | – | [47] |
VRSA-33 | – | – | – | - | R | – | – | – | – | – | – | [48] |
VISA-1 | R | – | – | - | I | – | – | – | – | MIC (μg/mL) | – | [29] |
VISA-2 | – | – | – | - | I | – | – | – | – | MIC (μg/mL) | – | [34] |
VISA-3 | – | – | – | - | I | – | R | S | R | MIC (μg/mL) | SCCmec II | [36] |
VISA-4 | – | – | – | R | I | – | – | S | – | MIC (μM) | – | [37] |
VISA-5 | – | – | – | R | I | – | – | S | – | MIC (μM) | – | [37] |
VISA-6 | – | – | – | R | I | – | – | S | – | MIC (μM) | – | [37] |
VISA-7 | – | – | – | – | I | – | – | – | – | MIC (μg/mL) | – | [41] |
VISA-8 | – | – | – | – | I | – | – | – | – | Disc diffusion | – | [49] |
VISA-9 | – | – | – | – | I | – | – | – | – | MIC (μM) | – | [50] |
VISA-10 | – | – | S | R | I | S | – | – | R | MIC (μg/mL) | – | [42] |
VISA-11 | – | – | S | R | I | S | – | – | R | MIC (μg/mL) | – | [42] |
VISA-12 | – | – | – | – | I | – | – | – | – | MIC (μg/mL) | – | [43] |
VISA-13 | – | – | – | – | I | – | – | – | – | MIC (μg/mL) | – | [43] |
VISA-14 | – | – | – | – | I | – | – | – | – | MIC (μg/mL) | – | [43] |
VISA-15 | - | – | – | – | I | – | – | – | – | MIC (μg/mL) | – | [44] |
VISA-16 | - | – | – | – | I | – | – | – | – | MIC (μg/mL) | GraS | [51] |
VISA-17 | - | – | – | – | I | – | – | – | – | MIC (μg/mL) | GraS | [51] |
VISA-18 | - | – | – | – | I | – | – | – | – | – | – | [52] |
VISA-19 | - | – | – | – | I | – | – | – | – | – | – | [53] |
VISA-20 | - | – | – | – | I | – | – | – | – | – | – | [53] |
VISA-21 | - | – | – | – | I | – | – | – | – | – | – | [53] |
VISA-22 | - | – | – | – | I | – | – | – | – | – | – | [53] |
VISA-23 | - | – | – | – | I | – | – | – | – | – | – | [53] |
VISA-24 | - | – | – | – | I | – | – | – | – | – | – | [53] |
VISA-25 | - | – | – | – | I | – | – | – | – | MIC (μg/mL) | – | [54] |
VISA-26 | - | – | – | – | I | – | – | – | – | MIC (μg/mL) | – | [54] |
VISA-27 | - | – | – | – | I | – | – | – | – | – | – | [55] |
VISA-28 | – | – | – | – | I | – | – | – | – | – | – | [56] |
VISA-29 | – | – | – | – | I | – | – | – | – | – | – | [57] |
VISA-30 | – | – | – | – | I | – | – | – | – | – | – | [58] |
VISA-31 | – | – | – | – | I | – | – | – | – | – | – | [59] |
VISA-32 | – | – | – | – | I | – | – | – | – | – | – | [60] |
VISA-33 | – | – | – | – | I | – | – | S | – | – | – | [47] |
Source | AMP Name | Strain ID | MIC Value | Reference | Toxicity/Properties |
---|---|---|---|---|---|
Apis mellifera | Melittin | VISA-9 | 2 μM | [50] | High toxicity to erythrocytes and other human cells |
Mellitin analog | Hec | VRSA-4 | 80 μM | [35] | Moderate toxic effect at high concentrations |
Musca domestica | Formicin C | VRSA-27 | 32 μg/mL | [46] | Non toxic to the intradermal model of the larva Hermetia illucens |
Hyalophora cecropia | Cecropin A | VISA-8 | 64 μg/mL | [49] | Low cytotoxic effect on human lung carcinoma |
Parachartergus fraternus and Agelaia pallipes pallipes | Agelaia-MPI | VRSA-33 | 4–8 μg/mL | [48] | Strong hemolytic effect on human erythrocytes |
Protonectin | VRSA-33 | 16 μg/mL | [48] | Toxic to cancerous and non-cancerous cell lines, but moderated hemolytic effect against human erythrocytes | |
Agelaia-MPI analog | NeuroVAL | VRSA-33 | >128 μg/mL | [48] | Non toxic to human erythrocytes, and cancerous and non-cancerous cells lines. |
Protonectin analog | Protonectin-F | VRSA-33 | 16 μg/mL | [48] | Toxic to cancerous and non-cancerous cell lines, but moderated hemolytic effect against human erythrocytes |
Chaerilus tricostatus | Ctriporin | VRSA-1 | 10 μg/mL | [29] | Histological results showed recovery of the skin |
VRSA-2 | 10 μg/mL | [29] | |||
VISA-1 | 10 μg/mL | [29] | |||
Scorpio maurus palmatus | Smp24 | VISA-25 | 32 μg/mL | [54] | Toxic to sheep erythrocytes |
VISA-26 | 64 μg/mL | [54] | |||
Ixodes persulcatus | Persulcatusin (IP) | VRSA-3 | 2 μg/mL | [34] | Non toxic to fibroblasts, colon epithelial cells, and erythrocytes |
VISA-2 | 8 μg/mL | [34] | |||
Ixodes ricinus | IR | VRSA-3 | 32 μg/mL | [34] | – |
VISA-2 | >32 μg/mL | [34] | – | ||
Haemaphysalis longicornis | HAE | VRSA-3 | >32 μg/mL | [34] | – |
VISA-2 | >32 μg/mL | [34] | – | ||
Ornithodoros moubata | OMBAC | VRSA-3 | 8 μg/mL | [34] | – |
VISA-2 | >32 μg/mL | [34] | – | ||
Xenopus laevis | Magainin-2 | VISA-8 | 16 μg/mL | [49] | – |
Lithobates capito | Temporin-CPa | VISA-28 | >25 μM | [56] | Hemolysis of human erythrocytes at high concentrations |
Temporin-CPb | VISA-28 | 12.5 μM | [56] | Hemolysis of human erythrocytes at high concentrations | |
Rana grylio | Temporin-1Ga | VISA-28 | 6.2 μM | [56] | Strong hemolytic effect on human erythrocytes |
Rana okaloosae | Temporin-1OLa | VISA-28 | 3.1 μM | [56] | Strong hemolytic effect on human erythrocytes |
Rana septentrionalis | Temporin-1 SPa | VISA-28 | 12.5 μM | [56] | Moderate hemolytic effect on human erythrocytes |
Rana ornativentris | Temporin-1Oc | VISA-28 | 1.6 μM | [56] | Strong hemolytic effect on human erythrocytes |
Fallaxin analogs | FL10 | VISA-32 | 50 μM | [60] | High hemolytic effect on human erythrocytes |
FL9 | VISA-32 | 50 μM | [60] | Moderate hemolytic effect on human erythrocytes | |
FA12 | VISA-32 | 50 μM | [60] | High hemolytic effect on human erythrocytes | |
FL14 | VISA-32 | 50 μM | [60] | High hemolytic effect on human erythrocytes | |
Homo sapiens | LL-37 | VRSA-18 | 64 μg/mL | [41] | Low cytotoxic effect |
VISA-7 | 64 μg/mL | [41] | |||
Derived from LL-37 | LL-13 | VRSA-18 | 512 μg/mL | [41] | – |
VISA-7 | 1024 μg/mL | [41] | – | ||
Derived from LL-37 | LL-17 | VRSA-18 | 512 μg/mL | [41] | – |
VISA-7 | 1024 μg/mL | [41] | – |
Source | AMP Name | Strain ID | MIC Value | Reference | Toxicity/Properties |
---|---|---|---|---|---|
Lactococcus lactis | Nisin | VISA-19 | 4.1 mg/L | [53] | Hemolytic effect on sheep erythrocytes |
VISA-20 | 8.3 mg/L | [53] | |||
VISA-21 | 4.1 mg/L | [53] | |||
VISA-22 | 8.3 mg/L | [53] | |||
VISA-23 | 8.3 mg/L | [53] | |||
VISA-24 | 4.1 mg/L | [53] | |||
Staphylococcus hominis | Hominicin | VISA-18 | 3.82 μg/mL | [52] | – |
Streptococcus mutans | Mutacin 1140 | VRSA-23 | 4–8 μg/mL | [44] | – |
VISA-15 | 4 μg/mL | [44] | – | ||
Bacillus sp. | Mersacidin | VISA-27 | 35 μg/mL | [55] | – |
Lactobacillus salivarius | Bactofencin A (analog 5) | VRSA-25 | 4.3 μM | [28] | – |
VRSA-26 | 100 μM | [28] | – | ||
Staphylococcus lugdunensis | Lugdunin | VISA-30 | 3 μg/mL | [58] | No lysis of primary human erythrocytes or neutrophils. |
Bacillus sp. | BCP61 | VRSA-24 | 10 μg/mL | [45] | – |
Bacillus subtilis subsp. inaquosorum | P138-C | VRSA-14 | 20 μg/mL | [39] | – |
Bacillus amyloliquefaciens | CSPK14 | VRSA-13 | 64 μg/mL | [38] | – |
Fusaricidin analogs | LI-F04a analog 5 | VISA-29 | 16 μg/mL | [57] | Hemolysis on human erythrocytes |
LI-F04a analog 6 | VISA-29 | 16 μg/mL | [57] | Hemolysis on human erythrocytes | |
LI-F04a analog 8 | VISA-29 | 16 μg/mL | [57] | Hemolysis on human erythrocytes | |
LI-F04a analog 11 | VISA-29 | 16 μg/mL | [57] | Hemolysis on human erythrocytes |
AMP Name | Strain ID | MIC Value | Reference | Toxicity/Properties |
---|---|---|---|---|
LTX-109 | VRSA-5 | 2–4 μg/mL | [36] | Phase III of a clinical trial |
VISA-3 | 2–4 μg/mL | [36] | ||
Omiganan (Indolicidin analog) | VRSA-19 | 16 μg/mL | [42] | Topical antimicrobial agent in phase III of a clinical trial |
VISA-10 | 16 μg/mL | [42] | ||
VISA-11 | 16 μg/mL | [42] | ||
WR12 | VRSA-6 | 4 μM | [37] | – |
VRSA-7 | 8 μM | [37] | – | |
VRSA-8 | 8 μM | [37] | – | |
VRSA-9 | 4 μM | [37] | – | |
VRSA-10 | 4 μM | [37] | – | |
VRSA-11 | 8 μM | [37] | – | |
VRSA-12 | 4 μM | [37] | – | |
VISA-4 | 1 μM | [37] | – | |
VISA-5 | 1 μM | [37] | – | |
VISA-6 | 1 μM | [37] | – | |
DIK-8 | VRSA-6 | 8 μM | [37] | – |
VRSA-7 | 16 μM | [37] | – | |
VRSA-8 | 16 μM | [37] | – | |
VRSA-9 | 16 μM | [37] | – | |
VRSA-10 | 16 μM | [37] | – | |
VRSA-11 | 16 μM | [37] | – | |
VRSA-12 | 16 μM | [37] | – | |
VISA-4 | 8 μM | [37] | – | |
VISA-5 | 8 μM | [37] | – | |
VISA-6 | 8 μM | [37] | – | |
MP196 | VISA-16 | 16 μg/mL | [51] | Light hemolytic effect on cell lines of breast cancer. Acute toxicity in mice cells. |
VISA-17 | 64 μg/mL | [51] | ||
P-113 | VRSA-20 | >64 μg/mL | [43] | – |
VRSA-21 | >64 μg/mL | [43] | – | |
VRSA-22 | >64 μg/mL | [43] | – | |
VISA-12 | >64 μg/mL | [43] | – | |
VISA-13 | >64 μg/mL | [43] | – | |
VISA-14 | >64 μg/mL | [43] | – | |
Phe-P-113 | VRSA-20 | >64 μg/mL | [43] | – |
VRSA-21 | >64 μg/mL | [43] | – | |
VRSA-22 | >64 μg/mL | [43] | – | |
VISA-12 | >64 μg/mL | [43] | – | |
VISA-13 | >64 μg/mL | [43] | – | |
VISA-14 | >64 μg/mL | [43] | – | |
Bip-P-113 | VRSA-20 | 16 μg/mL | [43] | – |
VRSA-21 | 16 μg/mL | [43] | – | |
VRSA-22 | 8 μg/mL | [43] | – | |
VISA-12 | 16 μg/mL | [43] | – | |
VISA-13 | 16 μg/mL | [43] | – | |
VISA-14 | 8 μg/mL | [43] | – | |
Dip-P-113 | VRSA-20 | 32 μg/mL | [43] | – |
VRSA-21 | 32 μg/mL | [43] | – | |
VRSA-22 | 32 μg/mL | [43] | – | |
VISA-12 | 16 μg/mL | [43] | – | |
VISA-13 | 16 μg/mL | [43] | – | |
VISA-14 | 16 μg/mL | [43] | – | |
Nal-P-113 | VRSA-20 | 8 μg/mL | [43] | – |
VRSA-21 | 8 μg/mL | [43] | – | |
VRSA-22 | 16 μg/mL | [43] | – | |
VISA-12 | 8 μg/mL | [43] | – | |
VISA-13 | 8 μg/mL | [43] | – | |
VISA-14 | 8 μg/mL | [43] | – | |
Lipopeptide 1 | VRSA-15 | 0.5 μM | [40] | Low toxicity in human embryonic and kidney cells |
VRSA-16 | 0.7 μM | [40] | ||
VRSA-17 | 0.9 μM | [40] | ||
Lipopeptide 2 | VRSA-15 | 2.8 μM | [40] | Low toxicity in human embryonic and kidney cells |
VRSA-16 | 1.9 μM | [40] | ||
VRSA-17 | 2.8 μM | [40] | ||
Lipopeptide 3 | VRSA-15 | >30 μM | [40] | Low toxicity in human embryonic and kidney cells |
VRSA-16 | >30 μM | [40] | ||
VRSA-17 | >30 μM | [40] | ||
Lipopeptide 4 | VRSA-15 | >30 μM | [40] | Low toxicity in human embryonic and kidney cells |
VRSA-16 | >30 μM | [40] | ||
VRSA-17 | >30 μM | [40] | ||
Lipopeptide 5 | VRSA-15 | 0.2 μM | [40] | Low toxicity in human embryonic and kidney cells |
VRSA-16 | 0.1 μM | [40] | ||
VRSA-17 | 0.1 μM | [40] | ||
Lipopeptide 6 | VRSA-15 | 2.8 μM | [40] | Low toxicity in human embryonic and kidney cells |
VRSA-16 | 1.9 μM | [40] | ||
VRSA-17 | 1.9 μM | [40] | ||
C14-KK | VISA-31 | 12.5 μM | [59] | Strong hemolytic effect on human erythrocytes |
C14-RRR | VISA-31 | 3.1 μM | [59] | Strong hemolytic effect on human erythrocytes |
C14-LK | VISA-31 | 1.56 μM | [59] | Strong hemolytic effect on human erythrocytes |
C14-RW | VISA-31 | >12.5 μM | [59] | Strong hemolytic effect on human erythrocytes |
C14-WR | VISA-31 | 3.1 μM | [59] | Strong hemolytic effect on human erythrocytes |
C14-KWI | VISA-31 | 12.5 μM | [59] | Strong hemolytic effect on human erythrocytes |
C14-LKK | VISA-31 | 3.1 μM | [59] | Strong hemolytic effect on human erythrocytes |
RRIKA | VISA-33 | 2 μM | [47] | Low hemolytic activity, but show toxicity in mammalian cell lines |
VRSA-29 | 4 μM | [47] | ||
VRSA-30 | 4 μM | [47] | ||
VRSA-31 | 4 μM | [47] | ||
VRSA-32 | 4 μM | [47] | ||
VRSA-33 | 4 μM | [47] | ||
RR | VISA-33 | 16 μM | [47] | Low hemolytic activity, but show toxicity in mammalian cell lines |
VRSA-29 | 32 μM | [47] | ||
VRSA-30 | 16 μM | [47] | ||
VRSA-31 | 16 μM | [47] | ||
VRSA-32 | 32 μM | [47] | ||
VRSA-33 | 32 μM | [47] |
AMP Name | 3D Structure | Sequence | L | C | IP | H | %H | Reference |
---|---|---|---|---|---|---|---|---|
Cecropin A | | GIGKFLHSAKKFGKAFVGEIMNS | 23 | +6 | 10.6 | 40.19 | 43.48 | [37] |
Agelaia-MPI | | INWLKLGKAIIDAL | 14 | +1 | 9.9 | 45.73 | 64.29 | [48] |
Protonectin | | ILGTILGLLKGL | 12 | +1 | 10.1 | 47.67 | 58.33 | [48] |
Protonectin-F | | IFGTILGFLKGL | 12 | +1 | 10.1 | 50.16 | 58.33 | [48] |
LL-37 | | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES | 37 | +6 | 11.1 | 35.14 | 34.62 | [41] |
LL-13 | | IGKEFKRIVQRIKDFLRNLVPRTES | 25 | +4 | 11.4 | 39.37 | 36.00 | [41] |
LL-17 | | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES | 13 | +4 | 12.2 | 35.69 | 46.15 | [41] |
Melittin | | GIGAVLKVLTTGLPALISWIKRKRQQ | 26 | +5 | 12.5 | 49.39 | 46.15 | [50] |
Hec | | FALALKALKKALKKLKKALKKAL | 23 | +9 | 11.4 | 39.47 | 60.87 | [35] |
Smp24 | | IWSFLIKAATKLLPSLFGGG-KKDS | 24 | +4 | 10.6 | 50.39 | 45.83 | [54] |
Ctriporin | | FLWGLIPGAVTSLIAISKK | 19 | +2 | 10.6 | 55.47 | 57.89 | [29] |
Magainin-2 | | GIGKFLHSAKKFGKAFVGEIMNS | 23 | +3 | 10.6 | 40.19 | 43.48 | [49] |
Temporin-CPa | | IPPFIKKVLTTVF | 13 | +2 | 10.6 | 41.02 | 53 | [56] |
Temporin-CPb | | FLPIVGRLISGIL | 13 | +1 | 11.1 | 46.35 | 61 | [56] |
Temporin-1Ga | | SILPTIVSFLSKVF | 14 | +1 | 10.1 | 52.43 | 57 | [56] |
Temporin-1OLa | | FLPFLKSILGKIL | 13 | +2 | 10.6 | 48.08 | 61 | [56] |
Temporin-1Spa | | FLSAITSILGKFF | 13 | +1 | 10.1 | 47.05 | 61 | [56] |
Temporin-1Oc | | FLPLLASLFSRLF | 13 | +1 | 11.1 | 59.16 | 69 | [56] |
FL9 | | GVVDILKGLAKDIAGHLASKVMNKL | 25 | +2 | 10.2 | 41.54 | 52 | [60] |
FL10 | | GVVDILKGALKDIAGHLASKVMNKL | 25 | +2 | 10.2 | 41.31 | 52 | [60] |
FA-12 | | GVVDILKGAAKAIAGHLASKVMNKL | 25 | +3 | 10.6 | 37.87 | 56 | [60] |
FL-14 | | GVVDILKGAAKDILGHLASKVMNKL | 25 | +2 | 10.2 | 41.54 | 52 | [60] |
CSPK-14 | | HYDPGDDSGNTG | 12 | −2.9 | 3.6 | 5.66 | 0 | [38] |
WR12 | | RWWRWWRRWWRR | 12 | +6 | 13.2 | 50.42 | 50.00 | [37] |
RR | | WLRRIKAWLRR | 11 | +5 | 13.0 | 33.04 | 54 | [47] |
RRIKA | | WLRRIKAWLRRIKA | 14 | +6 | 13.0 | 39.90 | 57 | [47] |
Formicin C | | ATCDLLSGTGVGHSACAAHCLLRGNRGGYCNGKGVCVCRN | 40 | +3 | 8.3 | 30.58 | 42.50 | [46] |
IP | | GFGCPFNQGACHRHCRSIGRRGGYCAGLFKQTCTCYSR | 38 | +6 | 9.3 | 29.58 | 34.21 | [34] |
IR | | GGYYCPFFQDKCHRHCRSFGRKAGYCGGFLKKTCICV | 37 | +6 | 9.2 | 36.11 | 37.84 | [34] |
HAE | | GCPLNQGACHNHCRSIGRRGGYCAGIIKQTCTCYRK | 36 | +6 | 9.3 | 23.43 | 33.33 | [41] |
OMBAC | | GFGCPFNQYECHAHCSGVPGYKGGYCKGLFKQTCNCY | 37 | +2 | 8.0 | 32.12 | 32.43 | [41] |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2021 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Hernández-Aristizábal, I.; Ocampo-Ibáñez, I.D. Antimicrobial Peptides with Antibacterial Activity against Vancomycin-Resistant Staphylococcus aureus Strains: Classification, Structures, and Mechanisms of Action. Int. J. Mol. Sci. 2021, 22, 7927. https://doi.org/10.3390/ijms22157927
Hernández-Aristizábal I, Ocampo-Ibáñez ID. Antimicrobial Peptides with Antibacterial Activity against Vancomycin-Resistant Staphylococcus aureus Strains: Classification, Structures, and Mechanisms of Action. International Journal of Molecular Sciences. 2021; 22(15):7927. https://doi.org/10.3390/ijms22157927
Chicago/Turabian StyleHernández-Aristizábal, Isabella, and Iván Darío Ocampo-Ibáñez. 2021. "Antimicrobial Peptides with Antibacterial Activity against Vancomycin-Resistant Staphylococcus aureus Strains: Classification, Structures, and Mechanisms of Action" International Journal of Molecular Sciences 22, no. 15: 7927. https://doi.org/10.3390/ijms22157927
APA StyleHernández-Aristizábal, I., & Ocampo-Ibáñez, I. D. (2021). Antimicrobial Peptides with Antibacterial Activity against Vancomycin-Resistant Staphylococcus aureus Strains: Classification, Structures, and Mechanisms of Action. International Journal of Molecular Sciences, 22(15), 7927. https://doi.org/10.3390/ijms22157927