The Role of GPR15 Function in Blood and Vasculature
Abstract
:1. GPR15
2. Endogenous GPR15 Ligands and Binding Protein
Amino Acid Residues | Reference | |
---|---|---|
GPR15 activating protein (ligand) | ||
C10orf99 (GPR15L) | MRLLVLSSLLCILLLCFSIFSTEGKRRPAKAWSGRRTRLCCHRVPSPNSTNLKGHHVRLCKPCKLEPEPRLWVVPGALPQV | [15] |
TME5 | QMFCNQTACPADCDPNTQASCECPEGYILDDGFIC | [16] |
TME5C | ECPEGYILDDGFICTDIDE | [16] |
gp120 V3(HIV) | CTRPNNNTRKGHIGP TTSIIGDIRQAHC | [12] |
GPR15 binding protein | ||
CysC95-146 | RTTCTKTQPNLDNCPFHDQPHLKRKAFCSFIYAVPWQGTMTLSKSTCQDA | [14] |
2.1. Physiological Ligand Found in Colon—C10orf99 (GPR15L)
2.2. The Synthesized Ligand Applied as Anticoagulant—Thrombomodulin
2.3. The GPR15 Binding Protein—Cystatin C Fragment
3. Physiological Role of GPR15 Ligands in Vascular Tissue
3.1. C10orf99
3.2. Thrombomodulin Peptides
4. Influences on GPR15 Expression
4.1. Endocytosis
4.2. Enhancers
4.2.1. Enhancers—Upregulation of the Frequency of GPR15+ Cells
4.2.2. Enhancers—Upregulation of GPR15 Expression
4.3. Inhibitors
4.4. DNA Methylation
4.5. Degeneration of Cells
5. Open Questions Relating to GPR15 Receptor Binding in Blood and Vasculature
- (i).
- In contrast to large rTM, such as ART-123, TME5 has no anticoagulant activity by failing to bind thrombin. Nevertheless, it might be of interest how the affinity of rTM to thrombin or GPR15 influences rTM binding patterns to these two binding proteins in blood vessels.
- (ii).
- It also remains to be determined whether natural soluble TM fragments are capable of affecting endothelial cells via their GPR15 receptor and whether soluble TM fragments are the most prominent natural ligands of GPR15 for ECs.
- (iii).
- Still unresolved is the effect of rTM when used as an antithrombotic drug for the physiological function of GPR15+ lymphocytes. It should be shown that rTM would not impede the homing of these lymphocytes into other tissues in particular into the colon and, as a consequence, would not affect tissue homeostasis in the colon.
- (iv).
- The role and effect of C10orf99 on endothelial cells has not yet been described. A putative physiological effect on ECs, however, could be expected at sites with microbial contact, such as injured epidermis, colon, oral cavity, and esophagus, where C10orf99 is secreted to a greater extent by epithelial cells.
- (v).
- Additionally open is whether GPR15+ lymphocytes bind to the TM at the lumen surface of endothelial cells or to thrombomodulin-expressing monocytes in blood.
- (vi).
- Especially for subjects with a higher risk of acquiring vascular diseases, such as atherosclerosis, it is certainly of interest whether the cytoprotective effect of GPR15 activation in ECs can be used to prevent disease-promoting endothelial dysfunction.
6. Conclusions
Funding
Institutional Review Board Statement
Informed Consent Statement
Conflicts of Interest
References
- Clayton, F.; Kotler, D.P.; Kuwada, S.K.; Morgan, T.; Stepan, C.; Kuang, J.; Le, J.; Fantini, J. Gp120-induced Bob/GPR15 activation: A possible cause of human immunodeficiency virus enteropathy. Am. J. Pathol. 2001, 159, 1933–1939. [Google Scholar] [CrossRef]
- Bauer, M.; Linsel, G.; Fink, B.; Offenberg, K.; Hahn, A.M.; Sack, U.; Knaack, H.; Eszlinger, M.; Herberth, G. A varying T cell subtype explains apparent tobacco smoking induced single CpG hypomethylation in whole blood. Clin. Epigenetics 2015, 7, 81. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Bauer, M.; Hackermuller, J.; Schor, J.; Schreiber, S.; Fink, B.; Pierzchalski, A.; Herberth, G. Specific induction of the unique GPR15 expression in heterogeneous blood lymphocytes by tobacco smoking. Biomarkers 2018, 24, 217–224. [Google Scholar] [CrossRef] [PubMed]
- Koks, S.; Koks, G. Activation of GPR15 and its involvement in the biological effects of smoking. Exp. Biol. Med. 2017, 242, 1207–1212. [Google Scholar] [CrossRef] [Green Version]
- Jegodzinski, L.; Sezin, T.; Loser, K.; Mousavi, S.; Zillikens, D.; Sadik, C.D. The G Protein-Coupled Receptor (GPR) 15 Counteracts Antibody-Mediated Skin Inflammation. Front Immunol. 2020, 11, 1858. [Google Scholar] [CrossRef]
- Kim, S.V.; Xiang, W.V.; Kwak, C.; Yang, Y.; Lin, X.W.; Ota, M.; Sarpel, U.; Rifkin, D.B.; Xu, R.; Littman, D.R. GPR15-mediated homing controls immune homeostasis in the large intestine mucosa. Science 2013, 340, 1456–1459. [Google Scholar] [CrossRef] [Green Version]
- Deng, H.K.; Unutmaz, D.; KewalRamani, V.N.; Littman, D.R. Expression cloning of new receptors used by simian and human immunodeficiency viruses. Nature 1997, 388, 296–300. [Google Scholar] [CrossRef]
- Gomi, K.; Zushi, M.; Honda, G.; Kawahara, S.; Matsuzaki, O.; Kanabayashi, T.; Yamamoto, S.; Maruyama, I.; Suzuki, K. Antithrombotic effect of recombinant human thrombomodulin on thrombin-induced thromboembolism in mice. Blood 1990, 75, 1396–1399. [Google Scholar] [CrossRef] [Green Version]
- Pan, B.; Wang, X.; Nishioka, C.; Honda, G.; Yokoyama, A.; Zeng, L.; Xu, K.; Ikezoe, T. G-protein coupled receptor 15 mediates angiogenesis and cytoprotective function of thrombomodulin. Sci. Rep. 2017, 7, 692. [Google Scholar] [CrossRef]
- Suply, T.; Hannedouche, S.; Carte, N.; Li, J.; Grosshans, B.; Schaefer, M.; Raad, L.; Beck, V.; Vidal, S.; Hiou-Feige, A.; et al. A natural ligand for the orphan receptor GPR15 modulates lymphocyte recruitment to epithelia. Sci. Signal 2017, 10, 496. [Google Scholar] [CrossRef]
- Blaak, H.; Boers, P.H.; Gruters, R.A.; Schuitemaker, H.; van der Ende, M.E.; Osterhaus, A.D. CCR5, GPR15, and CXCR6 are major coreceptors of human immunodeficiency virus type 2 variants isolated from individuals with and without plasma viremia. J. Virol. 2005, 79, 1686–1700. [Google Scholar] [CrossRef] [Green Version]
- Xiang, Y.; Liu, W.; Chen, Y.; Zhang, C.; Su, W.; Zhang, Y.; Sun, J.; Gao, F.; Jiang, C. The variable loop 3 in the envelope glycoprotein is critical for the atypical coreceptor usage of an HIV-1 strain. PLoS ONE 2014, 9, e98058. [Google Scholar] [CrossRef]
- Pan, W.; Cheng, Y.; Zhang, H.; Liu, B.; Mo, X.; Li, T.; Li, L.; Cheng, X.; Zhang, L.; Ji, J.; et al. CSBF/C10orf99, a novel potential cytokine, inhibits colon cancer cell growth through inducing G1 arrest. Sci. Rep. 2014, 4, 6812. [Google Scholar] [CrossRef] [PubMed]
- Hayn, M.; Blötz, A.; Rodríguez, A.; Vidal, S.; Preising, N.; Ständker, L.; Wiese, S.; Stürzel, C.M.; Harms, M.; Gross, R.; et al. Natural cystatin C fragments inhibit GPR15-mediated HIV and SIV infection without interfering with GPR15L signaling. Proc. Natl. Acad. Sci. USA 2021, 118, e2023776118. [Google Scholar] [CrossRef] [PubMed]
- Yang, M.; Tang, M.; Ma, X.; Yang, L.; He, J.; Peng, X.; Guo, G.; Zhou, L.; Luo, N.; Yuan, Z.; et al. AP-57/C10orf99 is a new type of multifunctional antimicrobial peptide. Biochem. Biophys. Res. Commun. 2015, 457, 347–352. [Google Scholar] [CrossRef]
- Wang, X.; Pan, B.; Honda, G.; Wang, X.; Hashimoto, Y.; Ohkawara, H.; Xu, K.; Zeng, L.; Ikezoe, T. Cytoprotective and pro-angiogenic functions of thrombomodulin are preserved in the C loop of the fifth epidermal growth factor-like domain. Haematologica 2018, 103, 1730–1740. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Okamoto, Y.; Shikano, S. Differential phosphorylation signals control endocytosis of GPR15. Mol. Biol. Cell 2017, 28, 2267–2281. [Google Scholar] [CrossRef]
- Ammitzbøll, C.; von Essen, M.R.; Börnsen, L.; Petersen, E.R.; McWilliam, O.; Ratzer, R.; Romme Christensen, J.; Oturai, A.B.; Søndergaard, H.B.; Sellebjerg, F. GPR15(+) T cells are Th17 like, increased in smokers and associated with multiple sclerosis. J Autoimmun. 2019, 97, 114–121. [Google Scholar] [CrossRef]
- Ocon, B.; Pan, J.; Dinh, T.T.; Chen, W.; Ballet, R.; Bscheider, M.; Habtezion, A.; Tu, H.; Zabel, B.A.; Butcher, E.C. A Mucosal and Cutaneous Chemokine Ligand for the Lymphocyte Chemoattractant Receptor GPR15. Front Immunol. 2017, 8, 1111. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Reimann, E.; Lättekivi, F.; Keermann, M.; Abram, K.; Kõks, S.; Kingo, K.; Fazeli, A. Multicomponent Biomarker Approach Improves the Accuracy of Diagnostic Biomarkers for Psoriasis Vulgaris. Acta Derm. Venereol. 2019, 99, 1258–1265. [Google Scholar] [CrossRef] [PubMed]
- Sezin, T.; Kempen, L.; Meyne, L.M.; Mousavi, S.; Zillikens, D.; Sadik, C.D. GPR15 is not critically involved in the regulation of murine psoriasiform dermatitis. J. Dermatol. Sci. 2019, 94, 196–204. [Google Scholar] [CrossRef] [Green Version]
- Chen, C.; Wu, N.; Duan, Q.; Yang, H.; Wang, X.; Yang, P.; Zhang, M.; Liu, J.; Liu, Z.; Shao, Y.; et al. C10orf99 contributes to the development of psoriasis by promoting the proliferation of keratinocytes. Sci. Rep. 2018, 8, 8590. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Okamoto, Y.; Shikano, S. Tyrosine sulfation and O-glycosylation of chemoattractant receptor GPR15 differentially regulate interaction with GPR15L. J. Cell. Sci. 2021, 134. [Google Scholar] [CrossRef]
- Saito, H.; Maruyama, I.; Shimazaki, S.; Yamamoto, Y.; Aikawa, N.; Ohno, R.; Hirayama, A.; Matsuda, T.; Asakura, H.; Nakashima, M.; et al. Efficacy and safety of recombinant human soluble thrombomodulin (ART-123) in disseminated intravascular coagulation: Results of a phase III, randomized, double-blind clinical trial. J. Thromb. Haemost. 2007, 5, 31–41. [Google Scholar] [CrossRef]
- Ohlin, A.K.; Larsson, K.; Hansson, M. Soluble thrombomodulin activity and soluble thrombomodulin antigen in plasma. J Thromb. Haemost. 2005, 3, 976–982. [Google Scholar] [CrossRef] [PubMed]
- Dittman, W.A.; Majerus, P.W. Structure and function of thrombomodulin: A natural anticoagulant. Blood. 1990, 75, 329–336. [Google Scholar] [CrossRef] [Green Version]
- Onopiuk, A.; Tokarzewicz, A.; Gorodkiewicz, E. Cystatin C: A kidney function biomarker. Adv. Clin. Chem. 2015, 68, 57–69. [Google Scholar] [CrossRef]
- Turk, V.; Stoka, V.; Vasiljeva, O.; Renko, M.; Sun, T.; Turk, B.; Turk, D. Cysteine cathepsins: From structure, function and regulation to new frontiers. Biochim. Biophys. Acta 2012, 1824, 68–88. [Google Scholar] [CrossRef] [Green Version]
- Erlandsen, E.J.; Randers, E. Reference intervals for plasma cystatin C and plasma creatinine in adults using methods traceable to international calibrators and reference methods. J. Clin. Lab. Anal. 2018, 32, e22433. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Ikezoe, T. Advances in the diagnosis and treatment of disseminated intravascular coagulation in haematological malignancies. Int. J. Hematol. 2021, 113, 34–44. [Google Scholar] [CrossRef]
- Ikezoe, T.; Yang, J.; Nishioka, C.; Pan, B.; Xu, K.; Furihata, M.; Nakamura, K.; Yurimoto, H.; Sakai, Y.; Honda, G.; et al. The fifth epidermal growth factor-like region of thrombomodulin exerts cytoprotective function and prevents SOS in a murine model. Bone Marrow Transplant. 2017, 52, 73–79. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Pan, B.; Wang, X.; Kojima, S.; Nishioka, C.; Yokoyama, A.; Honda, G.; Xu, K.; Ikezoe, T. The Fifth Epidermal Growth Factor-like Region of Thrombomodulin Alleviates Murine Graft-versus-Host Disease in a G-Protein Coupled Receptor 15 Dependent Manner. Biol. Blood Marrow Transpl. 2017, 23, 746–756. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Pan, B.; Wang, X.; Kojima, S.; Nishioka, C.; Yokoyama, A.; Honda, G.; Xu, K.; Ikezoe, T. The fifth epidermal growth factor like region of thrombomodulin alleviates LPS-induced sepsis through interacting with GPR15. Thromb. Haemost. 2017, 117, 570–579. [Google Scholar] [CrossRef] [PubMed]
- Conway, E.M.; Van de Wouwer, M.; Pollefeyt, S.; Jurk, K.; Van Aken, H.; De Vriese, A.; Weitz, J.I.; Weiler, H.; Hellings, P.W.; Schaeffer, P.; et al. The lectin-like domain of thrombomodulin confers protection from neutrophil-mediated tissue damage by suppressing adhesion molecule expression via nuclear factor kappaB and mitogen-activated protein kinase pathways. J. Exp. Med. 2002, 196, 565–577. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Van Leeuwen-Kerkhoff, N.; Westers, T.M.; Poddighe, P.J.; de Gruijl, T.D.; Kordasti, S.; van de Loosdrecht, A.A. Thrombomodulin-expressing monocytes are associated with low-risk features in myelodysplastic syndromes and dampen excessive immune activation. Haematologica 2020, 105, 961–971. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Tobin, A.B. G-protein-coupled receptor phosphorylation: Where, when and by whom. Br. J. Pharmacol. 2008, 153, S167–S176. [Google Scholar] [CrossRef] [Green Version]
- Qian, Z.M.; Li, H.; Sun, H.; Ho, K. Targeted drug delivery via the transferrin receptor-mediated endocytosis pathway. Pharmacol. Rev. 2002, 54, 561–587. [Google Scholar] [CrossRef]
- Vink, J.M.; Jansen, R.; Brooks, A.; Willemsen, G.; van Grootheest, G.; de Geus, E.; Smit, J.H.; Penninx, B.W.; Boomsma, D.I. Differential gene expression patterns between smokers and non-smokers: Cause or consequence? Addict. Biol. 2017, 22, 550–560. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Andersen, A.M.; Lei, M.K.; Beach, S.R.H.; Philibert, R.A.; Sinha, S.; Colgan, J.D. Cigarette and Cannabis Smoking Effects on GPR15+ Helper T Cell Levels in Peripheral Blood: Relationships with Epigenetic Biomarkers. Genes 2020, 11, 149. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Koks, G.; Uudelepp, M.L.; Limbach, M.; Peterson, P.; Reimann, E.; Koks, S. Smoking-Induced Expression of the GPR15 Gene Indicates Its Potential Role in Chronic Inflammatory Pathologies. Am. J. Pathol. 2015, 185, 2898–2906. [Google Scholar] [CrossRef] [Green Version]
- Liamin, M.; Le Mentec, H.; Evrard, B.; Huc, L.; Chalmel, F.; Boutet-Robinet, E.; Le Ferrec, E.; Sparfel, L. Genome-Wide Transcriptional and Functional Analysis of Human T Lymphocytes Treated with Benzo[α]pyrene. Int. J. Mol. Sci. 2018, 19, 3626. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Cartwright, A.; Schmutz, C.; Askari, A.; Kuiper, J.H.; Middleton, J. Orphan receptor GPR15/BOB is up-regulated in rheumatoid arthritis. Cytokine 2014, 67, 53–59. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Nguyen, L.P.; Pan, J.; Dinh, T.T.; Hadeiba, H.; O’Hara, E., 3rd; Ebtikar, A.; Hertweck, A.; Gokmen, M.R.; Lord, G.M.; Jenner, R.G.; et al. Role and species-specific expression of colon T cell homing receptor GPR15 in colitis. Nat. Immunol. 2015, 16, 207–213. [Google Scholar] [CrossRef] [PubMed]
- Jiang, D.; Xie, X.; Lu, Z.; Liu, L.; Qu, Y.; Wu, S.; Li, Y.; Li, G.; Wang, H.; Xu, G. Establishment of a Colorectal Cancer-Related MicroRNA-mRNA Regulatory Network by Microarray and Bioinformatics. Front. Genet. 2020, 11, 560186. [Google Scholar] [CrossRef]
- Wang, Y.; Wang, X.; Xiong, Y.; Li, C.D.; Xu, Q.; Shen, L.; Chandra Kaushik, A.; Wei, D.Q. An Integrated Pan-Cancer Analysis and Structure-Based Virtual Screening of GPR15. Int. J. Mol. Sci. 2019, 20, 6226. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Bauer, M.; Fink, B.; Thurmann, L.; Eszlinger, M.; Herberth, G.; Lehmann, I. Tobacco smoking differently influences cell types of the innate and adaptive immune system-indications from CpG site methylation. Clin. Epigenetics 2015, 7, 83. [Google Scholar] [CrossRef] [Green Version]
- Sun, Y.V.; Smith, A.K.; Conneely, K.N.; Chang, Q.; Li, W.; Lazarus, A.; Smith, J.A.; Almli, L.M.; Binder, E.B.; Klengel, T.; et al. Epigenomic association analysis identifies smoking-related DNA methylation sites in African Americans. Hum. Genet. 2013, 132, 1027–1037. [Google Scholar] [CrossRef] [Green Version]
- Haase, T.; Müller, C.; Krause, J.; Röthemeier, C.; Stenzig, J.; Kunze, S.; Waldenberger, M.; Münzel, T.; Pfeiffer, N.; Wild, P.S.; et al. Novel DNA Methylation Sites Influence GPR15 Expression in Relation to Smoking. Biomolecules 2018, 8, 74. [Google Scholar] [CrossRef] [Green Version]
- Silva, C.P.; Kamens, H.M. Cigarette smoke-induced alterations in blood: A review of research on DNA methylation and gene expression. Exp. Clin. Psychopharmacol. 2021, 29, 116–135. [Google Scholar] [CrossRef]
- Bauer, M. Cell-type-specific disturbance of DNA methylation pattern: A chance to get more benefit from and to minimize cohorts for epigenome-wide association studies. Int. J. Epidemiol. 2018, 47, 917–927. [Google Scholar] [CrossRef]
- Adamczyk, A.; Pastille, E.; Kehrmann, J.; Vu, V.P.; Geffers, R.; Wasmer, M.H.; Kasper, S.; Schuler, M.; Lange, C.M.; Muggli, B.; et al. GPR15 Facilitates Recruitment of Regulatory T Cells to Promote Colorectal Cancer. Cancer Res. 2021, 81, 2970–2982. [Google Scholar] [CrossRef] [PubMed]
- Okamoto, Y.; Shikano, S. Phosphorylation-dependent C-terminal binding of 14-3-3 proteins promotes cell surface expression of HIV co-receptor GPR15. J. Biol. Chem. 2011, 286, 7171–7181. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Guo, Y.; Zhu, Q.; Chen, S.; Li, Y.; Fu, D.; Qiao, D.; Ni, C. Post-transcriptional suppression of G protein-coupled receptor 15 (GPR15) by microRNA-1225 inhibits proliferation, migration, and invasion of human colorectal cancer cells. 3 Biotech. 2021, 11, 139. [Google Scholar] [CrossRef] [PubMed]
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2021 by the author. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Bauer, M. The Role of GPR15 Function in Blood and Vasculature. Int. J. Mol. Sci. 2021, 22, 10824. https://doi.org/10.3390/ijms221910824
Bauer M. The Role of GPR15 Function in Blood and Vasculature. International Journal of Molecular Sciences. 2021; 22(19):10824. https://doi.org/10.3390/ijms221910824
Chicago/Turabian StyleBauer, Mario. 2021. "The Role of GPR15 Function in Blood and Vasculature" International Journal of Molecular Sciences 22, no. 19: 10824. https://doi.org/10.3390/ijms221910824
APA StyleBauer, M. (2021). The Role of GPR15 Function in Blood and Vasculature. International Journal of Molecular Sciences, 22(19), 10824. https://doi.org/10.3390/ijms221910824