Challenge in the Discovery of New Drugs: Antimicrobial Peptides against WHO-List of Critical and High-Priority Bacteria
Abstract
:1. Introduction
2. Why Are AMPs Highlighted in the Development of New Antibiotics?
3. Critical Bacterial Resistance
4. AMP Applications in Critical-Priority Bacteria
5. AMP Applications against High-Priority Bacteria
5.1. Vancomycin-Resistant Enterococcus Faecium (VRE)
5.2. Clarithromycin-Resistant Helicobacter pylori
5.3. Fluoroquinolone-Resistant Salmonella
5.4. Staphylococcus aureus
6. Challenges and Perspectives
7. Conclusions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
References
- Montalvo-Quirós, S.; Gómez-Graña, S.; Vallet-Regí, M.; Prados-Rosales, R.C.; González, B.; Luque-Garcia, J.L. Mesoporous silica nanoparticles containing silver as novel antimycobacterial agents against Mycobacterium tuberculosis. Colloids Surf. B Biointerfaces 2021, 197, 111405. [Google Scholar] [CrossRef] [PubMed]
- Perez, F.; Bonomo, R.A. Evidence to improve the treatment of infections caused by carbapenem-resistant Gram-negative bacteria. Lancet Infect. Dis. 2018, 18, 358–360. [Google Scholar] [CrossRef]
- Riduan, S.N.; Armugam, A.; Zhang, Y. Antibiotic resistance mitigation: The development of alternative general strategies. J. Mater. Chem. B 2020, 8, 6317–6321. [Google Scholar] [CrossRef]
- Johnson, T.J.; Logue, C.M.; Johnson, J.R.; Kuskowski, M.A.; Sherwood, J.S.; Barnes, H.J.; Debroy, C.; Wannemuehler, Y.M.; Obata-Yasuoka, M.; Spanjaard, L.; et al. Associations between multidrug resistance, plasmid content, and virulence potential among extraintestinal pathogenic and commensal Escherichia coli from humans and poultry. Foodborne Pathog. Dis. 2012, 9, 37–46. [Google Scholar] [CrossRef] [Green Version]
- Roque-Borda, C.A.; Silva, H.R.L.; Crusca Junior, E.; Serafim, J.A.; Meneguin, A.B.; Chorilli, M.; Macedo, W.C.; Teixeira, S.R.; Guastalli, E.A.L.; Soares, N.M.; et al. Alginate-based microparticles coated with HPMCP/AS cellulose-derivatives enable the Ctx(Ile21)-Ha antimicrobial peptide application as a feed additive. Int. J. Biol. Macromol. 2021, 183, 1236–1247. [Google Scholar] [CrossRef] [PubMed]
- Bo, J.; Yang, Y.; Zheng, R.; Fang, C.; Jiang, Y.; Liu, J.; Chen, M.; Hong, F.; Bailey, C.; Segner, H.; et al. Antimicrobial activity and mechanisms of multiple antimicrobial peptides isolated from rockfish Sebastiscus marmoratus. Fish Shellfish Immunol. 2019, 93, 1007–1017. [Google Scholar] [CrossRef]
- Abbas, A.; Lichtman, A.; Pillai, S. Cellular and Molecular Immunology, 8th ed.; Elsevier: Amsterdam, The Netherlands, 2014; ISBN 9780323316149. [Google Scholar]
- Sierra, J.M.; Viñas, M. Future prospects for Antimicrobial peptide development: Peptidomimetics and antimicrobial combinations. Expert Opin. Drug Discov. 2021, 1–4. [Google Scholar] [CrossRef]
- Kumar, T.V.V.; Sanil, G. A Review of the Mechanism of Action of Amphibian Antimicrobial Peptides Focusing on Peptide-Membrane Interaction and Membrane Curvature. Curr. Protein Pept. Sci. 2017, 18, 1263–1272. [Google Scholar] [CrossRef]
- Patocka, J.; Nepovimova, E.; Klimova, B.; Wu, Q.; Kuca, K. Antimicrobial Peptides: Amphibian Host Defense Peptides. Curr. Med. Chem. 2018, 26, 5924–5946. [Google Scholar] [CrossRef]
- Magana, M.; Pushpanathan, M.; Santos, A.L.; Leanse, L.; Fernandez, M.; Ioannidis, A.; Giulianotti, M.A.; Apidianakis, Y.; Bradfute, S.; Ferguson, A.L.; et al. The value of antimicrobial peptides in the age of resistance. Lancet Infect. Dis. 2020, 20, e216–e230. [Google Scholar] [CrossRef]
- Seyfi, R.; Kahaki, F.A.; Ebrahimi, T.; Montazersaheb, S.; Eyvazi, S.; Babaeipour, V.; Tarhriz, V. Antimicrobial Peptides (AMPs): Roles, Functions and Mechanism of Action. Int. J. Pept. Res. Ther. 2020, 26, 1451–1463. [Google Scholar] [CrossRef]
- Nguyen, L.T.; Haney, E.F.; Vogel, H.J. The expanding scope of antimicrobial peptide structures and their modes of action. Trends Biotechnol. 2011, 29, 464–472. [Google Scholar] [CrossRef]
- Mahlapuu, M.; Håkansson, J.; Ringstad, L.; Björn, C. Antimicrobial peptides: An emerging category of therapeutic agents. Front. Cell. Infect. Microbiol. 2016, 6, 194. [Google Scholar] [CrossRef] [Green Version]
- Münzker, L.; Oddo, A.; Hansen, P.R. Chemical synthesis of antimicrobial peptides. In Methods in Molecular Biology; Humana Press Inc.: Totowa, NJ, USA, 2017; Volume 1548, pp. 35–49. [Google Scholar]
- Bozelli, J.C.; Salay, L.C.; Arcisio-Miranda, M.; Procopio, J.; Riciluca, K.C.T.; Silva Junior, P.I.; Nakaie, C.R.; Schreier, S. A comparison of activity, toxicity, and conformation of tritrpticin and two TOAC-labeled analogues. Effects on the mechanism of action. Biochim. Biophys. Acta Biomembr. 2020, 1862, 183110. [Google Scholar] [CrossRef]
- Vicente, E.F.; Sahu, I.D.; Costa-Filho, A.J.; Cilli, E.M.; Lorigan, G.A. Conformational changes of the Hs DHODH N-terminal Microdomain via DEER Spectroscopy. J. Phys. Chem. B 2015, 119, 8693–8697. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Basso, L.G.M.; Mendes, L.F.S.; Costa-Filho, A.J. The two sides of a lipid-protein story. Biophys. Rev. 2016, 8, 179–191. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Vicente, E.F.; Sahu, I.D.; Crusca, E.; Basso, L.G.M.; Munte, C.E.; Costa-Filho, A.J.; Lorigan, G.A.; Cilli, E.M. HsDHODH Microdomain-Membrane Interactions Influenced by the Lipid Composition. J. Phys. Chem. B 2017, 121, 11085–11095. [Google Scholar] [CrossRef] [PubMed]
- Kang, H.-K.; Kim, C.; Ho Seo, C.; Park, Y. The therapeutic applications of antimicrobial peptides (AMPs): A patent review. J. Microbiol. 2017, 55, 1–12. [Google Scholar] [CrossRef]
- WHO. Global Priority List of Antibiotic-Resistant Bacteria to Guide Research, Discovery, and Development of New Antibiotics; World Health Organization: Geneva, Switzerland, 2017. [Google Scholar]
- Andrei, S.; Valeanu, L.; Chirvasuta, R.; Stefan, M.-G. New FDA approved antibacterial drugs: 2015–2017. Discoveries 2018, 6, e81. [Google Scholar] [CrossRef]
- Andrei, S.; Droc, G.; Stefan, G. FDA approved antibacterial drugs: 2018–2019. Discoveries 2019, 7, e102. [Google Scholar] [CrossRef] [PubMed]
- New Drugs at FDA: CDER’s New Molecular Entities and New Therapeutic Biological Products|FDA. Available online: https://www.fda.gov/drugs/development-approval-process-drugs/new-drugs-fda-cders-new-molecular-entities-and-new-therapeutic-biological-products (accessed on 7 May 2021).
- Ullah, H.; Ali, S. Classification of Anti-Bacterial Agents and Their Functions. In Antibacterial Agents; InTech: London, UK, 2017; Volume 10. [Google Scholar]
- Tacconelli, E.; Carrara, E.; Savoldi, A.; Harbarth, S.; Mendelson, M.; Monnet, D.L.; Pulcini, C.; Kahlmeter, G.; Kluytmans, J.; Carmeli, Y.; et al. Discovery, research, and development of new antibiotics: The WHO priority list of antibiotic-resistant bacteria and tuberculosis. Lancet Infect. Dis. 2018, 18, 318–327. [Google Scholar] [CrossRef]
- Cardoso, P.; Glossop, H.; Meikle, T.G.; Aburto-Medina, A.; Conn, C.E.; Sarojini, V.; Valery, C. Molecular engineering of antimicrobial peptides: Microbial targets, peptide motifs and translation opportunities. Biophys. Rev. 2021, 13, 1–35. [Google Scholar] [CrossRef] [PubMed]
- Silva, T.B.; Monteiro, M.C.; Borges, R.D.; Barros, T.G.; Carneiro, A.D.; Barros, C.A. Theoretical and practical study of the cefoxitin-Escherichia coli PBP5 complex interaction by molecular dynamics to obtain computational prototype of antimicrobial susceptibility to Gram negative bacteria. Chem. Biol. Drug Des. 2020, 96, 1095–1102. [Google Scholar] [CrossRef] [PubMed]
- Evans, B.A.; Hamouda, A.; Amyes, G.B.S. The Rise of Carbapenem-Resistant Acinetobacter baumannii. Curr. Pharm. Des. 2013, 19, 223–238. [Google Scholar] [CrossRef]
- El-Gamal, M.I.; Brahim, I.; Hisham, N.; Aladdin, R.; Mohammed, H.; Bahaaeldin, A. Recent updates of carbapenem antibiotics. Eur. J. Med. Chem. 2017, 131, 185–195. [Google Scholar] [CrossRef]
- Bhowmick, T.; Weinstein, M.P. Microbiology of Meropenem-Vaborbactam: A Novel Carbapenem Beta-Lactamase Inhibitor Combination for Carbapenem-Resistant Enterobacterales Infections. Infect. Dis. Ther. 2020, 9, 757–767. [Google Scholar] [CrossRef] [PubMed]
- Sims, M.; Mariyanovski, V.; McLeroth, P.; Akers, W.; Lee, Y.-C.; Brown, M.L.; Du, J.; Pedley, A.; Kartsonis, N.A.; Paschke, A. Prospective, randomized, double-blind, Phase 2 dose-ranging study comparing efficacy and safety of imipenem/cilastatin plus relebactam with imipenem/cilastatin alone in patients with complicated urinary tract infections. J. Antimicrob. Chemother. 2017, 72, 2616–2626. [Google Scholar] [CrossRef] [Green Version]
- Kaye, K.; File, T.; Boucher, H.W.; Brown, M.; Aggrey, A.; Khan, I.; Joeng, H.-K.; Tipping, R.; Du, J.; Young, K.; et al. 1339. Results for the Supplemental Microbiological Modified Intent-to-Treat (SmMITT) Population of the RESTORE-IMI 1 Trial of Imipenem/Cilastatin/Relebactam (IMI/REL) vs. Imipenem/Cilastatin Plus Colistin (IMI+CST) in Patients with Imipenem-Nonsusceptible (NS) Bacterial Infections. Open Forum Infect. Dis. 2018, 5, S409. [Google Scholar] [CrossRef] [Green Version]
- Newman, L.M.; Wang, S.A.; Ohye, R.G.; O’Connor, N.; Lee, M.V.; Weinstock, H.S. The epidemiology of fluoroquinolone-resistant Neisseria gonorrhoeae in Hawaii, 2001. Clin. Infect. Dis. 2004, 38, 649–654. [Google Scholar] [CrossRef] [Green Version]
- Niero, G.; Bortolaia, V.; Vanni, M.; Intorre, L.; Guardabassi, L.; Piccirillo, A. High diversity of genes and plasmids encoding resistance to third-generation cephalosporins and quinolones in clinical Escherichia coli from commercial poultry flocks in Italy. Vet. Microbiol. 2018, 216, 93–98. [Google Scholar] [CrossRef]
- Palma, N.; Pons, M.J.; Gomes, C.; Mateu, J.; Riveros, M.; García, W.; Jacobs, J.; García, C.; Ochoa, T.J.; Ruiz, J. Resistance to quinolones, cephalosporins and macrolides in Escherichia coli causing bacteraemia in Peruvian children. J. Glob. Antimicrob. Resist. 2017, 11, 28–33. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Jacoby, G.A. Mechanisms of Resistance to Quinolones. Clin. Infect. Dis. 2005, 41, S120–S126. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Kampshoff, F.; Willcox, M.D.P.; Dutta, D. A Pilot Study of the Synergy between Two Antimicrobial Peptides and Two Common Antibiotics. Antibiotics 2019, 8, 60. [Google Scholar] [CrossRef] [Green Version]
- Blaskovich, M.A.T.; Hansford, K.A.; Butler, M.S.; Jia, Z.; Mark, A.E.; Cooper, M.A. Developments in Glycopeptide Antibiotics. ACS Infect. Dis. 2018, 4, 715–735. [Google Scholar] [CrossRef] [Green Version]
- Santos-Beneit, F.; Ordóñez-Robles, M.; Martín, J.F. Glycopeptide resistance: Links with inorganic phosphate metabolism and cell envelope stress. Biochem. Pharmacol. 2017, 133, 74–85. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Umstätter, F.; Domhan, C.; Hertlein, T.; Ohlsen, K.; Mühlberg, E.; Kleist, C.; Zimmermann, S.; Beijer, B.; Klika, K.D.; Haberkorn, U.; et al. Vancomycin Resistance Is Overcome by Conjugation of Polycationic Peptides. Angew. Chem. Int. Ed. 2020, 59, 8823–8827. [Google Scholar] [CrossRef] [Green Version]
- Xuan, S.H.; Wu, L.P.; Zhou, Y.G.; Xiao, M.B. Detection of clarithromycin-resistant Helicobacter pylori in clinical specimens by molecular methods: A review. J. Glob. Antimicrob. Resist. 2016, 4, 35–41. [Google Scholar] [CrossRef]
- Hirata, K.; Suzuki, H.; Nishizawa, T.; Tsugawa, H.; Muraoka, H.; Saito, Y.; Matsuzaki, J.; Hibi, T. Contribution of efflux pumps to clarithromycin resistance in Helicobacter pylori. J. Gastroenterol. Hepatol. 2010, 25, S75–S79. [Google Scholar] [CrossRef]
- Narayana, J.L.; Huang, H.N.; Wu, C.J.; Chen, J.Y. Efficacy of the antimicrobial peptide TP4 against Helicobacter pylori infection: In vitro membrane perturbation via micellization and in vivo suppression of host immune responses in a mouse model. Oncotarget 2015, 6, 12936–12954. [Google Scholar] [CrossRef] [Green Version]
- Elbehiry, A.; Marzouk, E.; Moussa, I.M.; Dawoud, T.M.; Mubarak, A.S.; Al-Sarar, D.; Alsubki, R.A.; Alhaji, J.H.; Hamada, M.; Abalkhail, A.; et al. Acinetobacter baumannii as a community foodborne pathogen: Peptide mass fingerprinting analysis, genotypic of biofilm formation and phenotypic pattern of antimicrobial resistance. Saudi J. Biol. Sci. 2021, 28, 1158–1166. [Google Scholar] [CrossRef]
- Aygün, G.; Demirkiran, O.; Utku, T.; Mete, B.; Ürkmez, S.; Yilmaz, M.; Yaşar, H.; Dikmen, Y.; Öztürk, R. Environmental contamination during a carbapenem-resistant Acinetobacter baumannii outbreak in an intensive care unit. J. Hosp. Infect. 2002, 52, 259–262. [Google Scholar] [CrossRef] [PubMed]
- Gehrlein, M.; Leying, H.; Cullmann, W.; Wendt, S.; Opferkuch, W. Imipenem Resistance in Acinetobacter baumanii Is Due to Altered Penicillin-Binding Proteins. Chemotherapy 1991, 37, 405–412. [Google Scholar] [CrossRef]
- Vashist, J.; Tiwari, V.; Das, R.; Kapil, A.; Rajeswari, M.R. Analysis of penicillin-binding proteins (PBPs) in carbapenem resistant Acinetobacter baumannii. Indian J. Med. Res. 2011, 133, 332–338. [Google Scholar] [PubMed]
- Mwangi, J.; Yin, Y.; Wang, G.; Yang, M.; Li, Y.; Zhang, Z.; Lai, R. The antimicrobial peptide ZY4 combats multidrugresistant Pseudomonas aeruginosa and Acinetobacter baumannii infection. Proc. Natl. Acad. Sci. USA 2019, 116, 26516–26522. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Martinez, M.; Gonçalves, S.; Felício, M.R.; Maturana, P.; Santos, N.C.; Semorile, L.; Hollmann, A.; Maffía, P.C. Synergistic and antibiofilm activity of the antimicrobial peptide P5 against carbapenem-resistant Pseudomonas aeruginosa. Biochim. Biophys. Acta Biomembr. 2019, 1861, 1329–1337. [Google Scholar] [CrossRef]
- Bessa, L.J.; Eaton, P.; Dematei, A.; Plácido, A.; Vale, N.; Gomes, P.; Delerue-Matos, C.; SA Leite, J.R.; Gameiro, P. Synergistic and antibiofilm properties of ocellatin peptides against multidrug-resistant Pseudomonas aeruginosa. Future Microbiol. 2018, 13, 151–163. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Grassi, L.; Maisetta, G.; Maccari, G.; Esin, S.; Batoni, G. Analogs of the Frog-skin Antimicrobial Peptide Temporin 1Tb Exhibit a Wider Spectrum of Activity and a Stronger Antibiofilm Potential as Compared to the Parental Peptide. Front. Chem. 2017, 5, 24. [Google Scholar] [CrossRef] [Green Version]
- Eftekhar, F.; Naseh, Z. Extended-spectrum β-lactamase and carbapenemase production among burn and non-burn clinical isolates of Klebsiella pneumoniae. Iran. J. Microbiol. 2015, 7, 144–149. [Google Scholar]
- Suay-García, B.; Pérez-Gracia, M.T. Present and future of carbapenem-resistant Enterobacteriaceae (CRE) infections. Antibiotics 2019, 8, 122. [Google Scholar] [CrossRef] [Green Version]
- Fleeman, R.M.; Macias, L.A.; Brodbelt, J.S.; Davies, B.W. Defining principles that influence antimicrobial peptide activity against capsulated Klebsiella pneumoniae. Proc. Natl. Acad. Sci. USA 2020, 117, 27620–27626. [Google Scholar] [CrossRef] [PubMed]
- Abraham, P.; Jose, L.; Maliekal, T.T.; Kumar, R.A.; Kumar, K.S. B1CTcu5: A frog-derived brevinin-1 peptide with anti-tuberculosis activity. Peptides 2020, 132, 170373. [Google Scholar] [CrossRef] [PubMed]
- Maitra, A.; Nukala, S.; Dickman, R.; Martin, L.T.; Munshi, T.; Gupta, A.; Shepherd, A.J.; Arnvig, K.B.; Tabor, A.B.; Keep, N.H.; et al. Characterization of the MurT/GatD complex in Mycobacterium tuberculosis towards validating a novel anti-tubercular drug target. JAC-Antimicrob. Resist. 2021, 3, dlab028. [Google Scholar] [CrossRef]
- Marin-Luevano, S.P.; Rodriguez-Carlos, A.; Jacobo-Delgado, Y.; Valdez-Miramontes, C.; Enciso-Moreno, J.A.; Rivas-Santiago, B. Steroid hormone modulates the production of cathelicidin and human β-defensins in lung epithelial cells and macrophages promoting Mycobacterium tuberculosis killing. Tuberculosis 2021, 128, 1472–9792. [Google Scholar] [CrossRef] [PubMed]
- Orme, I. Search for new drugs for treatment of tuberculosis. Antimicrob. Agents Chemother. 2001, 45, 1943–1946. [Google Scholar] [PubMed] [Green Version]
- Zeng, P.; Yi, L.; Xu, J.; Gao, W.; Xu, C.; Chen, S.; Chan, K.F.; Wong, K.Y. Investigation of antibiofilm activity, antibacterial activity, and mechanistic studies of an amphiphilic peptide against Acinetobacter baumannii. Biochim. Biophys. Acta Biomembr. 2021, 1863, 183600. [Google Scholar] [CrossRef]
- Zhong, C.; Zhang, F.; Yao, J.; Zhu, Y.; Zhu, N.; Zhang, Y.; Liu, H.; Gou, S.; Ni, J. Antimicrobial peptides with symmetric structures against multidrug-resistant bacteria while alleviating antimicrobial resistance. Biochem. Pharmacol. 2021, 186, 114470. [Google Scholar] [CrossRef] [PubMed]
- Um, J.; Manguy, J.; Anes, J.; Jacquier, J.C.; Hurley, D.; Dillon, E.T.; Wynne, K.; Fanning, S.; O’Sullivan, M.; Shields, D.C. Enriching antimicrobial peptides from milk hydrolysates using pectin/alginate food-gels. Food Chem. 2021, 352, 129220. [Google Scholar] [CrossRef]
- Witherell, K.S.; Price, J.; Bandaranayake, A.D.; Olson, J.; Call, D.R. In vitro activity of antimicrobial peptide CDP-B11 alone and in combination with colistin against colistin-resistant and multidrug-resistant Escherichia coli. Sci. Rep. 2021, 11, 2151. [Google Scholar] [CrossRef] [PubMed]
- Jahangiri, A.; Neshani, A.; Mirhosseini, S.A.; Ghazvini, K.; Zare, H.; Sedighian, H. Synergistic effect of two antimicrobial peptides, Nisin and P10 with conventional antibiotics against extensively drug-resistant Acinetobacter baumannii and colistin-resistant Pseudomonas aeruginosa isolates. Microb. Pathog. 2021, 150, 104700. [Google Scholar] [CrossRef]
- Ramos-Martín, F.; Herrera-León, C.; Antonietti, V.; Sonnet, P.; Sarazin, C.; D’amelio, N. Antimicrobial peptide k11 selectively recognizes bacterial biomimetic membranes and acts by twisting their bilayers. Pharmaceuticals 2021, 14, 1. [Google Scholar] [CrossRef]
- Hirano, M.; Saito, C.; Yokoo, H.; Goto, C.; Kawano, R.; Misawa, T.; Demizu, Y. Development of Antimicrobial Stapled Peptides Based on Magainin 2 Sequence. Molecules 2021, 26, 444. [Google Scholar] [CrossRef]
- Azoulay, Z.; Aibinder, P.; Gancz, A.; Moran-Gilad, J.; Navon-Venezia, S.; Rapaport, H. Assembly of cationic and amphiphilic β-sheet FKF tripeptide confers antibacterial activity. Acta Biomater. 2021, 1968–1976. [Google Scholar] [CrossRef]
- Liu, W.; Wu, Z.; Mao, C.; Guo, G.; Zeng, Z.; Fei, Y.; Wan, S.; Peng, J.; Wu, J. Antimicrobial Peptide Cec4 Eradicates the Bacteria of Clinical Carbapenem-Resistant Acinetobacter baumannii Biofilm. Front. Microbiol. 2020, 11, 1532. [Google Scholar] [CrossRef] [PubMed]
- Peng, J.; Long, H.; Liu, W.; Wu, Z.; Wang, T.; Zeng, Z.; Guo, G.; Wu, J. Antibacterial mechanism of peptide Cec4 against Acinetobacter baumannii. Infect. Drug Resist. 2019, 12, 2417–2428. [Google Scholar] [CrossRef] [Green Version]
- Di, Y.P.; Lin, Q.; Chen, C.; Montelaro, R.C.; Doi, Y.; Deslouches, B. Enhanced therapeutic index of an antimicrobial peptide in mice by increasing safety and activity against multidrug-resistant bacteria. Sci. Adv. 2020, 6, eaay6817. [Google Scholar] [CrossRef] [PubMed]
- Swedan, S.; Shubair, Z.; Almaaytah, A. Synergism of cationic antimicrobial peptide WLBU2 with antibacterial agents against biofilms of multi-drug resistant Acinetobacter baumannii and Klebsiella pneumoniae. Infect. Drug Resist. 2019, 12, 2019–2030. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Thomsen, T.; Mendel, H.; Al-Mansour, W.; Oddo, A.; Løbner-Olesen, A.; Hansen, P. Analogues of a Cyclic Antimicrobial Peptide with a Flexible Linker Show Promising Activity against Pseudomonas aeruginosa and Staphylococcus aureus. Antibiotics 2020, 9, 366. [Google Scholar] [CrossRef] [PubMed]
- Riool, M.; de Breij, A.; Kwakman, P.H.S.; Schonkeren-Ravensbergen, E.; de Boer, L.; Cordfunke, R.A.; Malanovic, N.; Drijfhout, J.W.; Nibbering, P.H.; Zaat, S.A.J. Thrombocidin-1-derived antimicrobial peptide TC19 combats superficial multi-drug resistant bacterial wound infections. Biochim. Biophys. Acta Biomembr. 2020, 1862, 183282. [Google Scholar] [CrossRef]
- Parducho, K.R.; Beadell, B.; Ybarra, T.K.; Bush, M.; Escalera, E.; Trejos, A.T.; Chieng, A.; Mendez, M.; Anderson, C.; Park, H.; et al. The Antimicrobial Peptide Human Beta-Defensin 2 Inhibits Biofilm Production of Pseudomonas aeruginosa Without Compromising Metabolic Activity. Front. Immunol. 2020, 11, 805. [Google Scholar] [CrossRef] [PubMed]
- Jangra, M.; Raka, V.; Nandanwar, H. In Vitro Evaluation of Antimicrobial Peptide Tridecaptin M in Combination with Other Antibiotics against Multidrug Resistant Acinetobacter baumannii. Molecules 2020, 25, 3255. [Google Scholar] [CrossRef] [PubMed]
- Hazam, P.K.; Chen, J.Y. Therapeutic utility of the antimicrobial peptide Tilapia Piscidin 4 (TP4). Aquac. Rep. 2020, 17, 100409. [Google Scholar] [CrossRef]
- Liu, L.; Liu, J.; Cui, Q.; Jia, B.Y.; Pei, Z.H.; Odah, K.A.; Wang, Y.M.; Dong, W.L.; Kong, L.C.; Ma, H.X. Design and Characterization of a Novel Hybrid Antimicrobial Peptide OM19R Based on Oncocin and MDAP-2. Int. J. Pept. Res. Ther. 2020, 26, 1839–1846. [Google Scholar] [CrossRef]
- Tai, H.-M.; Huang, H.-N.; Tsai, T.-Y.; You, M.-F.; Wu, H.-Y.; Rajanbabu, V.; Chang, H.-Y.; Pan, C.-Y.; Chen, J.-Y. Dietary supplementation of recombinant antimicrobial peptide Epinephelus lanceolatus piscidin improves growth performance and immune response in Gallus gallus domesticus. PLoS ONE 2020, 15, e0230021. [Google Scholar] [CrossRef] [Green Version]
- Taheri, B.; Mohammadi, M.; Momenzadeh, N.; Farshadzadeh, Z.; Roozbehani, M.; Dehghani, P.; Hajian, S.; Darvishi, S.; Shamseddin, J. Substitution of lysine for isoleucine at the center of the nonpolar face of the antimicrobial peptide, piscidin-1, leads to an increase in the rapidity of bactericidal activity and a reduction in toxicity. Infect. Drug Resist. 2019, 12, 1629–1647. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Porto, W.F.; Irazazabal, L.N.; Humblot, V.; Haney, E.F.; Ribeiro, S.M.; Hancock, R.E.W.; Ladram, A.; Franco, O.L. EcDBS1R6: A novel cationic antimicrobial peptide derived from a signal peptide sequence. Biochim. Biophys. Acta Gen. Subj. 2020, 1864, 129633. [Google Scholar] [CrossRef] [PubMed]
- Peláez Coyotl, E.A.; Barrios Palacios, J.; Muciño, G.; Moreno-Blas, D.; Costas, M.; Montiel Montes, T.; Diener, C.; Uribe-Carvajal, S.; Massieu, L.; Castro-Obregón, S.; et al. Antimicrobial Peptide against Mycobacterium Tuberculosis That Activates Autophagy Is an Effective Treatment for Tuberculosis. Pharmaceutics 2020, 12, 1071. [Google Scholar] [CrossRef] [PubMed]
- Pierce, S.; Jennings, M.P.; Juliano, S.A.; Angeles-Boza, A.M. Peptide-Ruthenium Conjugate as an Efficient Photosensitizer for the Inactivation of Multidrug-Resistant Bacteria. Inorg. Chem. 2020, 59, 14866–14870. [Google Scholar] [CrossRef]
- Ocampo-Ibáñez, I.D.; Liscano, Y.; Rivera-Sánchez, S.P.; Oñate-Garzón, J.; Lugo-Guevara, A.D.; Flórez-Elvira, L.J.; Lesmes, M.C. A Novel Cecropin D-Derived Short Cationic Antimicrobial Peptide Exhibits Antibacterial Activity against Wild-Type and Multidrug-Resistant Strains of Klebsiella pneumoniae and Pseudomonas aeruginosa. Evol. Bioinform. 2020, 16, 117693432093626. [Google Scholar] [CrossRef]
- Brunetti, J.; Carnicelli, V.; Ponzi, A.; Di Giulio, A.; Lizzi, A.R.; Cristiano, L.; Cresti, L.; Cappello, G.; Pollini, S.; Mosconi, L.; et al. Antibacterial and Anti-Inflammatory Activity of an Antimicrobial Peptide Synthesized with D Amino Acids. Antibiotics 2020, 9, 840. [Google Scholar] [CrossRef]
- Yin, Q.; Wu, S.; Wu, L.; Wang, Z.; Mu, Y.; Zhang, R.; Dong, C.; Zhou, B.; Zhao, B.; Zheng, J.; et al. A novel in silico antimicrobial peptide DP7 combats MDR Pseudomonas aeruginosa and related biofilm infections. J. Antimicrob. Chemother. 2020, 75, 3248–3259. [Google Scholar] [CrossRef]
- Ohno, M.K.; Kirikae, T.; Yoshihara, E.; Kirikae, F.; Ishida, I. Addition of L-cysteine to the N- or C-terminus of the all-D-enantiomer [D(KLAKLAK)2] increases antimicrobial activities against multidrug-resistant Pseudomonas aeruginosa, Acinetobacter baumannii and Escherichia coli. PeerJ 2020, 8, e10176. [Google Scholar] [CrossRef]
- Nagarajan, D.; Roy, N.; Kulkarni, O.; Nanajkar, N.; Datey, A.; Ravichandran, S.; Thakur, C.; Sandeep, T.; Aprameya, I.V.; Sarma, S.P.; et al. W76: A designed antimicrobial peptide to combat carbapenem- And tigecycline-resistant Acinetobacter baumannii. Sci. Adv. 2019, 5, eaax1946. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Mohan, N.M.; Zorgani, A.; Jalowicki, G.; Kerr, A.; Khaldi, N.; Martins, M. Unlocking NuriPep 1653 From Common Pea Protein: A Potent Antimicrobial Peptide to Tackle a Pan-Drug Resistant Acinetobacter baumannii. Front. Microbiol. 2019, 10, 2086. [Google Scholar] [CrossRef]
- Qi, J.; Gao, R.; Liu, C.; Shan, B.; Gao, F.; He, J.; Yuan, M.; Xie, H.; Jin, S.; Ma, Y. Potential role of the antimicrobial peptide tachyplesin III against multidrug-resistant P. aeruginosa and A. baumannii coinfection in an animal model. Infect. Drug Resist. 2019, 12, 2865–2874. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Pashaei, F.; Bevalian, P.; Akbari, R.; Pooshang Bagheri, K. Single dose eradication of extensively drug resistant Acinetobacter spp. In a mouse model of burn infection by melittin antimicrobial peptide. Microb. Pathog. 2019, 127, 60–69. [Google Scholar] [CrossRef]
- Morroni, G.; Simonetti, O.; Brenciani, A.; Brescini, L.; Kamysz, W.; Kamysz, E.; Neubauer, D.; Caffarini, M.; Orciani, M.; Giovanetti, E.; et al. In vitro activity of Protegrin-1, alone and in combination with clinically useful antibiotics, against Acinetobacter baumannii strains isolated from surgical wounds. Med. Microbiol. Immunol. 2019, 208, 877–883. [Google Scholar] [CrossRef]
- Jaśkiewicz, M.; Neubauer, D.; Kazor, K.; Bartoszewska, S.; Kamysz, W. Antimicrobial Activity of Selected Antimicrobial Peptides Against Planktonic Culture and Biofilm of Acinetobacter baumannii. Probiotics Antimicrob. Proteins 2019, 11, 317–324. [Google Scholar] [CrossRef] [Green Version]
- Mardirossian, M.; Sola, R.; Beckert, B.; Collis, D.W.P.; Di Stasi, A.; Armas, F.; Hilpert, K.; Wilson, D.N.; Scocchi, M. Proline-Rich Peptides with Improved Antimicrobial Activity against E. coli, K. pneumoniae, and A. baumannii. ChemMedChem 2019, 14, 2025–2033. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Sharma, D.; Choudhary, M.; Vashistt, J.; Shrivastava, R.; Bisht, G.S. Cationic antimicrobial peptide and its poly-N-substituted glycine congener: Antibacterial and antibiofilm potential against A. baumannii. Biochem. Biophys. Res. Commun. 2019, 518, 472–478. [Google Scholar] [CrossRef] [PubMed]
- Mant, C.T.; Jiang, Z.; Gera, L.; Davis, T.; Nelson, K.L.; Bevers, S.; Hodges, R.S. De Novo Designed Amphipathic α-Helical Antimicrobial Peptides Incorporating Dab and Dap Residues on the Polar Face to Treat the Gram-Negative Pathogen, Acinetobacter baumannii. J. Med. Chem. 2019, 62, 3354–3366. [Google Scholar] [CrossRef] [PubMed]
- das Neves, R.C.; Mortari, M.R.; Schwartz, E.F.; Kipnis, A.; Junqueira-Kipnis, A.P. Antimicrobial and Antibiofilm Effects of Peptides from Venom of Social Wasp and Scorpion on Multidrug-Resistant Acinetobacter baumannii. Toxins (Basel) 2019, 11, 216. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Xiong, Y.Q.; Li, L.; Zhou, Y.; Kraus, C.N. Efficacy of ARV-1502, a Proline-Rich Antimicrobial Peptide, in a Murine Model of Bacteremia Caused by Multi-Drug Resistant (MDR) Acinetobacter baumannii. Molecules 2019, 24, 2820. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Dolzani, L.; Milan, A.; Scocchi, M.; Lagatolla, C.; Bressan, R.; Benincasa, M. Sub-MIC effects of a proline-rich antibacterial peptide on clinical isolates of Acinetobacter baumannii. J. Med. Microbiol. 2019, 68, 1253–1265. [Google Scholar] [CrossRef]
- Subramanian, D.; Chakkyarath, V.; Kumaravel, S.M.; Venkatesan, B.P.; Natarajan, J. Design, Synthesis and Evaluation of Antimicrobial Database-Derived Peptides Against Drug-Resistant Gram-Positive and Gram-Negative Pathogens. Int. J. Pept. Res. Ther. 2021, 1–10. [Google Scholar] [CrossRef]
- Tenland, E.; Pochert, A.; Krishnan, N.; Umashankar Rao, K.; Kalsum, S.; Braun, K.; Glegola-Madejska, I.; Lerm, M.; Robertson, B.D.; Lindén, M.; et al. Effective delivery of the anti-mycobacterial peptide NZX in mesoporous silica nanoparticles. PLoS ONE 2019, 14, e0212858. [Google Scholar] [CrossRef] [Green Version]
- Munk, J.K.; Uggerhøj, L.E.; Poulsen, T.J.; Frimodt-Møller, N.; Wimmer, R.; Nyberg, N.T.; Hansen, P.R. Synthetic analogs of anoplin show improved antimicrobial activities. J. Pept. Sci. 2013, 19, 669–675. [Google Scholar] [CrossRef]
- Singh, K.; Kumar, S.; Shekhar, S.; Dhawan, B.; Dey, S. Synthesis and Biological Evaluation of Novel Peptide BF2 as an Antibacterial Agent against Clinical Isolates of Vancomycin-Resistant Enterococci. J. Med. Chem. 2014, 2, 1–6. [Google Scholar] [CrossRef] [PubMed]
- Flamm, R.K.; Rhomberg, P.R.; Simpson, K.M.; Farrell, D.J.; Sader, H.S.; Jones, R.N. In Vitro Spectrum of Pexiganan Activity When Tested Against Pathogens from Diabetic Foot Infections and with Selected Resistance Mechanisms. Antimicrob. Agents Chemother. 2015, 59, 1751–1754. [Google Scholar] [CrossRef] [Green Version]
- Delpech, G.; Bistoletti, M.; Ceci, M.; Lissarrague, S.; Bruni, S.S.; Sparo, M. Bactericidal Activity and Synergy Studies of PeptideAP-CECT7121 Against Multi-resistant Bacteria Isolatedfrom Human and Animal Soft Tissue Infections. Probiotics Antimicrob. Prot. 2017, 9, 355–362. [Google Scholar] [CrossRef] [PubMed]
- Wu, C.-L.; Hsueh, J.-Y.; Yip, B.-S.; Chih, Y.-H.; Peng, K.-L.; Cheng, J.-W. Antimicrobial Peptides Display Strong Synergy with Vancomycin Against Vancomycin-Resistant E. faecium, S. aureus, and Wild-Type E. coli. Int. J. Mol. Sci. 2020, 21, 4578. [Google Scholar] [CrossRef]
- Wang, S.; Fang, Q.; Lu, Z.; Gao, Y.; Trembleau, L.; Ebel, R.; Andersen, J.H.; Philips, C.; Law, S.; Deng, H. Discovery and biosynthetic investigation of a new antibacterial dehydrated non-ribosomal tripeptide. Angew. Chem. Int. Ed. 2021, 60, 3229–3237. [Google Scholar] [CrossRef]
- Jiang, M.; Mas, L.; Huang, Y.; Wu, H.; Dou, J.; Zhou, C. Antimicrobial activities of peptide Cbf-K16 against drug-resistant Helicobacter pylori infection in vitro and in vivo. Microb. Pathog. 2020, 138, 103847. [Google Scholar] [CrossRef] [PubMed]
- Szabo, D.; Ostorhazi, E.; Binas, A.; Rozgonyi, F.; Kocsis, B.; Cassone, M.; Wade, J.D.; Nolte, O.; Otvos, L. The designer proline-rich antibacterial peptide A3-APO is effective against systemic Escherichia coli infections in different mouse models. Int. J. Antimicrob. Agents 2010, 35, 357–361. [Google Scholar] [CrossRef] [PubMed]
- Sader, H.S.; Pignatari, A.C.C. E Test: A Novel Technique for Antimicrobial Suseptibility Testing. São Paulo Med. J. 1994, 112, 635–638. [Google Scholar] [CrossRef]
- Hirsch, R.; Wiesner, J.; Marker, A.; Pfeifer, Y.; Bauer, A.; Hammann, P.E.; Vilcinksas, A. Profiling antimicrobial peptides from the medical maggot Lucilia sericata as potential antibiotics for MDR Gram-negative bacteria. J. Antimicrob. Chemother. 2019, 74, 96–107. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Bocian, A.; Hus, K.K. Antibacterial properties of snake venom components. Chem. Pap. 2020, 74, 407–419. [Google Scholar] [CrossRef] [Green Version]
- Choi, J.H.; Jang, A.Y.; Lin, S.; Lim, S.; Kim, D.; Park, K.; Han, S.M.; Yeo, J.H.; Seo, H.S. Melittin, a honeybee venom-derived antimicrobial peptide, may target methicillin-resistant Staphylococcus aureus. Mol. Med. Rep. 2015, 12, 6483–6490. [Google Scholar] [CrossRef] [Green Version]
- Sang, Y.; Blecha, F. Antimicrobial peptides and bacteriocins: Alternatives to traditional antibiotics. Anim. Health Res. Rev. 2008, 9, 227–235. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Van Dijk, A.; Veldhuizen, E.J.A.; Haagsman, H.P. Avian defensins. Vet. Immunol. Immunopathol. 2008, 124, 1–18. [Google Scholar] [CrossRef]
- Hakimi Alni, R.; Tavasoli, F.; Barati, A.; Shahrokhi Badarbani, S.; Salimi, Z.; Babaeekhou, L. Synergistic activity of melittin with mupirocin: A study against methicillin-resistant S. Aureus (MRSA) and methicillin-susceptible S. Aureus (MSSA) isolates. Saudi J. Biol. Sci. 2020, 27, 2580–2585. [Google Scholar] [CrossRef] [PubMed]
- Al-Ani, I.; Zimmermann, S.; Reichling, J.; Wink, M. Pharmacological synergism of bee venom and melittin with antibiotics and plant secondary metabolites against multi-drug resistant microbial pathogens. Phytomedicine 2015, 22, 245–255. [Google Scholar] [CrossRef]
- Elsalem, L.; Khasawneh, A.; Al Sheboul, S. WLBU2 Antimicrobial Peptide as a Potential Therapeutic for Treatment of Resistant Bacterial Infections. 2020. Available online: http://cms.galenos.com.tr/Uploads/Article_42858/TJPS-0-0-En.pdf (accessed on 7 May 2021).
- Meneguin, A.B.; Beyssac, E.; Garrait, G.; Hsein, H.; Cury, B.S.F. Retrograded starch/pectin coated gellan gum-microparticles for oral administration of insulin: A technological platform for protection against enzymatic degradation and improvement of intestinal permeability. Eur. J. Pharm. Biopharm. 2018, 123, 84–94. [Google Scholar] [CrossRef] [Green Version]
- Roque Borda, C.A.; Saraiva de Mesquita Souza, M.; Monte, F.M.D.; Rodrigues Alves, L.B.; de Almeida, A.M.; Santiago Ferreira, T.; Spina de Lima, T.; Pereira Benevides, V.; Memrava Cabrera, J.; Meneguin, A.B.; et al. Application of HPMCAS-coated Ctx(Ile21)-Ha peptide microparticles as a potential use to prevent systemic infection caused by Salmonella Enteritidis in poultry. bioRxiv 2021. [Google Scholar] [CrossRef]
- Roque Borda, C.A.; Pereira, L.P.; Lopes Guastalli, E.A.; Soares, N.M.; Mac-Lean, P.A.B.; Salgado, D.D.; Meneguin, A.B.; Chorilli, M.; Vicente, E.F. HPMCP-coated microcapsules containing the Ctx(Ile 21 )-Ha antimicrobial peptide reduces the mortality rate caused by resistant Salmonella Enteritidis in poultry. bioRxiv 2021. [Google Scholar] [CrossRef]
- Lei, J.; Sun, L.C.; Huang, S.; Zhu, C.; Li, P.; He, J.; Mackey, V.; Coy, D.H.; He, Q.Y. The antimicrobial peptides and their potential clinical applications. Am. J. Transl. Res. 2019, 11, 3919. [Google Scholar] [PubMed]
Drug | Approval Date | FDA-Approved Application | Mechanism of Action | Antibacterial Activity |
---|---|---|---|---|
cefiderocol | 14 November 2019 | To treat patients with complicated urinary tract infections who have limited or no alternative treatment options |
| Gram-negative: Escherichia coli, Enterobacter cloacae complex, Klebsiella pneumoniae, Proteus mirabilis, Pseudomonas aeruginosa, Acinetobacter baumannii, Citrobacter freundii complex, Citrobacter koseri, Klebsiella aerogenes, Klebsiella oxytoca, Morganella morganii, Proteus vulgaris, Providencia rettgeri, Serratia marcescens, Stenotrophomonas maltophilia. |
imipenem, cilastatin, and relebactam | 16 July 2019 | To treat complicated urinary tract and complicated intra-abdominal infections |
| Complicated Urinary Tract Infections and Complicated Intra-abdominal Infections. Some important bacters: Citrobacter freundii, Klebsiella aerogenes, Enterobacter cloacae, Escherichia coli, Klebsiella oxytoca, Klebsiella pneumoniae, Pseudomonas aeruginosa, Bacteroides caccae, Bacteroides fragilis, Bacteroides ovatus, Bacteroides stercoris, Bacteroides thetaiotaomicron, Bacteroides uniformis, Bacteroides vulgatus, Fusobacterium nucleatum, Parabacteroides distasonis. Enterococcus faecalis, Methicillin-susceptible Staphylococcus aureus, Streptococcus anginosus, Streptococcus constellatus. Citrobacter koseri, Enterobacter asburiae, etc. |
lefamulin | 19 August 2019 | To treat adults with community-acquired bacterial pneumonia |
| S. pneumoniae, H. Influenzae, and M. pneumoniae (including macrolide-resistant strains), and bacteriostatic against S. aureus, and S. pyogenes at clinically relevant concentrations |
pretomanid | 14 August 2019 | For treatment-resistant forms of tuberculosis that affect the lungs |
| Mutations in five M. tuberculosis genes (ddn, fgd1, fbiA, fbiB, and fbiC) have been associated with pretomanid resistance. |
omadacycline | 2 October 2018 | To treat community-acquired bacterial pneumonia and acute bacterial skin and skin structure infections |
| Gram-positive bacteria that carried ribosomal protection genes (tet M) and efflux genes (tet K and tet L), and in Enterobactericeae that carried the tetB efflux gene. Some S. aureus, S. pneumoniae, and H. influenzae strains carrying macrolide resistance genes (erm A, B, and/or C), or ciprofloxacin resistance genes (gyrA and parC) and beta-lactamase-positive H. influenzae. |
eravacycline | 27 August 2018 | To treat complicated intra-abdominal infections in patients 18 years of age and older |
| In general, is bacteriostatic against Gram-positive bacteria (e.g., Staphylococcus aureus and Enterococcus faecalis); however, in vitro bactericidal activity has been demonstrated against certain strains of Escherichia coli and K. pneumoniae. |
plazomicin | 25 June 2018 | To treat adults with complicated urinary tract infections |
| Enterobacteriaceae in the presence of certain beta-lactamases, including extended-spectrum beta-lactamases (TEM, SHV, CTX-M, AmpC), serine carbapenemases (KPC-2, KPC-3), and oxacillinase (OXA-48). Bacteria producing metallo-beta-lactamases often co-express 16S rRNA methyltransferase, conferring resistance to plazomicin. |
secnidazole | 15 September 2017 | To treat bacterial vaginosis |
| Bacteroides spp., Gardnerella vaginalis, Prevotella spp., Mobiluncus spp., Megasphaera-like type I/II |
meropenem and vaborbactam | 29 August 2017 | To treat adults with complicated urinary tract infections |
| Gram-negative bacteria: Enterobacter cloacae species complex, Escherichia coli, Klebsiella pneumoniae, Citrobacter freundii, Citrobacter koseri, Enterobacter aerogenes, Klebsiella oxytoca, Morganella morganii, Proteus mirabilis, Providencia spp., Pseudomonas aeruginosa, Serratia marcescens. |
delafloxacin | 19 June 2017 | To treat patients with acute bacterial skin infections |
| Gram-positive bacteria Staphylococcus aureus (including methicillin-resistant and methicillin-sensitive strains), Staphylococcus haemolyticus, Staphylococcus lugdunensis, Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus anginosus Group (including S. anginosus, S. intermedius, and S. constellatus), Enterococcus faecalis, Streptococcus dysgalactiae. Gram-negative bacteria E. coli, K. pneumoniae, Enterobacter cloacae, P. aeruginosa, Enterobacter aerogenes, Haemophilus parainfluenzae, Klebsiella oxytoca, Proteus mirabilis. |
Group | Sub-Group | Classification | Main Drugs | |
---|---|---|---|---|
Antimicrobial agents | ß-Lactamic | Penicillins | natural penicillins or benzilpenicillins | crystalline penicillin |
penicillin G procaine | ||||
benzathine penicillin G | ||||
penicillin V | ||||
aminopenicillins | ampicillin | |||
amoxicillin | ||||
penicillins resistant to penicillinases | oxacillin | |||
methicillin | ||||
carbenicillin | ||||
ticarcillin | ||||
piperacillin | ||||
Broad-spectrum penicillins | carboxypenicillins (carbenicillin and ticarcillin) | |||
ureido-penicillins (mezlocillin, piperacillin, and azlocillin) | ||||
Cephalosporins | 1st generation | cephalothin | ||
cefazolin | ||||
cephalexin | ||||
cefadroxil | ||||
2nd generation | cefoxitin | |||
cefuroxime | ||||
cefaclor | ||||
3rd generation | cefotaxime | |||
ceftriaxone | ||||
ceftazidime | ||||
4th generation | cefepime | |||
Carbapenems | - | Imipenem | ||
meropenem | ||||
ertapenem | ||||
doripenem | ||||
biapenem | ||||
tebipenem | ||||
Monobactams | - | aztreonem | ||
Quinolones | - | - | levofloxacin | |
gatifloxacin | ||||
moxifloxacin | ||||
gemifloxacin | ||||
Glycopeptides | - | - | vancomycin | |
teicoplanin | ||||
branchplanin | ||||
Oxazolidinones | - | - | linezolid | |
Aminoglycosides | - | - | streptomycin | |
gentamicin | ||||
tobramycin | ||||
amikacin | ||||
netilmicin | ||||
paromomycin | ||||
spectinomycin | ||||
Macrolides | - | - | azithromycin | |
clarithromycin | ||||
erythromycin | ||||
spiramycin | ||||
myocamycin | ||||
roxithromycin | ||||
Lincosamines | - | - | lincomycin | |
Nitroimidazole | - | - | metronidazole | |
Chloramphenicol | - | - | chloramphenicol | |
Streptogramins | - | - | quinupristin | |
dalfopristin | ||||
Sulfonamides | - | - | sulfanilamide | |
sulfisoxazole | ||||
sulfacetamide | ||||
para-aminobenzoic acid | ||||
sulfadiazine and sulfamethoxazole | ||||
Tetracyclines | - | - | tetracyclines | |
New Antimicrobials | Glycylcyclines | - | tigecycline | |
Polymyxins | - | colistin (polymyxin E) | ||
polymyxin B | ||||
Daptomycin | - | daptomycin |
AMPs | Peptide Sequence | MIC (μg/mL) | System | Natural Source | PDR/MDR/XDR Bacteria | Ref. |
---|---|---|---|---|---|---|
ZY4 peptide | VCKRWKKWKRKWKKWCV In the sequence, disulfide bond (C-C) is formed by the Cystein. | 2.0–4.5 | In vitro/In vivo | Snake venom of Bungarus fasciatus | P. aeruginosa (CICC21625, CMCC10104, C1, C2, C3, and C5) | [49] |
4.6–9.4 | A. baumannii (22933, CN40, 18C116, 18C132, 18C135, and 18C136) | |||||
Zp3 | GIIAGIIIKIKK | 4 µM | In vitro/In vivo | NR | A. baumannii ATCC 19606 | [60] |
WWW Symmetric peptides | XRWWWRX (XRW), XWRWWWRWX (XWRW), XRRWWWRRX (XRRW) X = G, I, L, W, F, V, A | 2–>128 μM | In vitro/In vivo | NR | E. coli ATCC 25922, P. aeruginosa ATCC 27853/9027, Acinetobacter baumannii ATCC 19606, K. pneumoniae ATCC 700603, E. coli ML-35 ATCC 43837, E. coli 780/804, P. aeruginosa 50/73, A. baumannii 9931/97830 | [61] |
NR | HKEMPFPK, TTMPLW, YYQQKPVA, and AVPYPQR | 1.5–5 mg/mL | In vitro | Casein prediction | A. baumannii ATCC 19606, E. coli O157 NCTC 12900, P. aeruginosa PAO1 | [62] |
B1CTcu5 | LIAGLAANFLPQILCKIARKC | 12.5 | In vitro | Clinotarsus curtipes | M. tuberculosis | [56] |
Ctx(Ile21)-Ha | GWLDVAKKIGKAAFSVAKSFI | 64 µM | In vitro | Hypsiboas albopunctatus | A. baumannii MDR | [5] |
P. aeruginosa MDR | ||||||
CDP-B11 peptide | VRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK | 25 | In vitro | Cow | A. baumannii # 0035 | [63] |
100 | E. coli # 0061 | |||||
200 | E. coli # 0346, P. aeruginosa # 0054 y K. pneumoniae # 0347 | |||||
P10 + conventional antibiotics | LAREYKKIVEKLKRWLRQVLRTLR | 4–32 | LL-37 derivative | A. baumannii XDR 1, XDR 2, XDR 3, XDR 4, XDR 5, ATCC 19606. | [64] | |
8–16 | P. aeruginosa colistin resistant 1,2,3,4,5, and ATCC 27853. | |||||
K11 | KWKSFIKKLTKKFLHSAKKF | NR | In silico/In vitro | Cecropin A1, melittin, and magainin | A. baumannii, P. aeruginosa, and K. pneumoniae | [65] |
Magainin 2 (Mag2) (molecule and homologues) | GIGKFLHSAKKFGKAFVGEIMNS | 12.5 | In vitro | African clawed frog | P. aeruginosa | [66] |
GIKKFLKSXKKFVKXFK | 3125 | |||||
S5IKKS5LKSAKKFVKAFK | 1.56 | |||||
GIKKS5LKSS5KKFVKAFK | 0.78 | |||||
GIKKFLKS5AKKS5VKAFK | 0.78 | |||||
GIKKFLKSS5KKFS5KAFK | 3125 | |||||
GIKKFLKSAKKS5VKAS5K | 0.78 | |||||
GIKKR8LKSAKKS5VKAFK | 1.56 | |||||
GIKKFLKR8AKKFVKS5FK | 3125 | |||||
GIKKFLKSR8KKFVKAS5K | 3125 | |||||
Phe-Lys-Phe tripeptide | FKF | >45.4 µM | In vitro | NR | K. pneumoniae ATCC 13883 | [67] |
K. pneumoniae ATCC 700603 | ||||||
45.4 µM | E. coli ESBL 76 | |||||
E. coli ESBL 63 | ||||||
34.0 µM | A. baumannii 5025055 | |||||
P. aeruginosa 760111736 | ||||||
E. coli ATCC 25922 | ||||||
NR | In vivo | P. aeruginosa ATCC 27853 | ||||
Cec4 | GWLKKIGKKIERVGQNTRD ATIQAIGVAQQAANVAATLKGK | 4 | In vitro | NR | 200 biofilm-forming strains MDR and XDR of P. aeruginosa (clinic isolates) | [68,69] |
WLBU2 | RRWVRRVRRWVRRVVRVVRRWVRR | 1.5–3 µM | In vivo/In vitro | eCAP modified | 24 biofilm-forming strains MDR and XDR of A. baumannii | [70] |
42,500 | K. pneumoniae BAA-2146 and 700603 | [71] | ||||
10,625 | In vitro | A. baumannii BAA-1605 | ||||
BSI-9 analogs | K-Nal-KK-Bip-O2Oc-Nal-KS | 1–32 | In vitro | Cycllic peptide | S. aureus ATCC 29213 (SA) | [72] |
2–32 | P. aeruginosa ATCC 27853 | |||||
32–>64 | E. coli ATCC 29522 | |||||
A. baumannii ATCC 19606 | ||||||
TC19 | LRCMCIKWWSGKHPK | 3.75 µM | In vitro | Thrombocidin-1- human peptide-derived | E. coli ESBL | [73] |
In vivo | A. baumannii LUH15100 and S. aureus JAR060131 | |||||
PepC/PepW | ILIACLGLKLLRYRRIY/WWWA{Dab}YGL{Dab}LL{Dab}Y{Dab}{Dab}WY | 8 and 1 µM | In vivo/In vitro | NR | E. coli W3110 | [55] |
2 µM | A. baumannii 5075 | |||||
2 and 1 µM | A. baumannii 17978 | |||||
>128 and 2 µM | K. pneumoniae MKP103 | |||||
K. pneumoniae ATCC 1705 | ||||||
K. pneumoniae clinical isolate 1433 | ||||||
K. pneumoniae clinical isolate 1434 | ||||||
K. pneumoniae ATCC 43816 (K2 serotype/hypermucoviscous) | ||||||
64 and 2 µM | K. pneumoniae ATCC 13883 (K3 serotype) | |||||
Human β-defensin 2 | HBD2/L-HBD2 | 0.25–0.5 μM, | In vitro | Human | Pyorubin-producing P. aeruginosa strain | [74] |
Human β-defensin 3 | HBD3 | 1 μM | A. baumannii ATCC 19606 | |||
Tridecaptin M + rifampicin | Gdab*GS*W*SDabDab*IQIαI*S–D-aminoacids* | 16 | In vitro | Paenibacillus sp. M152 | [75] | |
Tilapia Piscidin 4 (TP4) | FIHHIIGGLFSAGKAIHRLIRRRRR | 0.52 | In vivo/In vitro | Nile Tilapia (Oreochromis niloticus) | P. aeruginosa (ATCC 19660) | [76] |
3125 | K. pneumoniae (YT32) | |||||
<1.56 | E. coli (YT39) | |||||
A. baumannii (Icu53) | ||||||
A. baumannii (Sk44) | ||||||
3127 | K. pneumoniae (NDM-1) | |||||
Oncocin | VDKPPYLPRPRPPRRIYNR | 8 μM | In vitro | Oncopeltus fasciatus (milkweed bug) | E. coli ATCC 25922 | [77] |
4 μM | K. pneumoniae ATCC 10031 | |||||
2 μM | K. pneumoniae CMCC 46117 | |||||
16 μM | E. coli ATCC 25922 (ΔSbmA) | |||||
MDAP-2 | SRDSRPVQPRVQPPPPPKQKPSIYDTPIRRPGGRKTMYA | 128 μM | In vitro | Musca domestica larvae | E. coli ATCC 25922 | |
512 μM | K. pneumoniae ATCC 10031 | |||||
K. pneumoniae CMCC 46117 | ||||||
256 μM | E. coli ATCC 25922 (ΔSbmA) | |||||
OM19R (MDAP-2 + Oncocin) | VDKPPYLPRPR PIRRPGGR | 1 μM | In vitro | hybrid | E. coli ATCC 25922 | |
256 μM | K. pneumoniae ATCC 10031 | |||||
K. pneumoniae CMCC 46117 | ||||||
E. coli ATCC 25922 (ΔSbmA) | ||||||
Piscidin 3 (g6498.t1) | CIMKHLRNLWNGAKAIYNGAKAGWTEFK | 45 | In vivo/In vitro | Oreochromis niloticus | P. aeruginosa | [78] |
Piscidin 1 homologues | I9A-piscidin-1 | 3.1 | In vitro | Clinical strain of colistin-resistant A. baumannii | [79] | |
I16A-piscidin-1 | ||||||
I9K-piscidin-1 | ||||||
I16K-piscidin-1 | ||||||
EcDBS1R6 | PMKKLFKLLARIAVKIPVW | 3 μM | In vitro/In silico | NR | E. coli ATCC 25922 | [80] |
6.25 μM | P. aeruginosa ATCC 27853 | |||||
3 μM | K. pneumoniae ATCC 13883 | |||||
3 μM | A. baumannii ATCC 19606 | |||||
Iztli peptide 1 (IP-1) | KFLNRFWHWLQLKPGQPMY | 8 μg/100 μL | In vitro | NR | M. tuberculosis H37Rv (ATCC 27294) | [81] |
Buforin II + monocarboxylic acid derivative | TRSSRAGLQFPVGRVHRLLRK | 1 μM | In vitro | NR | E. coli (MG 1655) | [82] |
2 μM | P. aeruginosa (AR 0229) | |||||
0.5 μM | E. coli (AR 0114) | |||||
A. baumannii (Naval-17) | ||||||
4 μM | K. pneumoniae (AR 0113) | |||||
CAMP-CecD | RNFFKRIRRAGKRIRKAI | 32 | In vitro/In silico | Cecropin D-Derived from insects | K. pneumoniae (wild-type KP) | [83] |
256 | K. pneumoniae (MDR-KP) | |||||
128 | E. coli ATCC 25922 | |||||
256 | K. pneumoniae (2146) | |||||
64 | P. aeruginosa (wild-type PA) | |||||
32 | P. aeruginosa (MDR-PA) | |||||
32 | P. aeruginosa (27853) | |||||
SET-M33 protease resistant | (KKIRVRLSA)4K2KβA-OH | 0.7–3 μM | In vivo/In vitro | NR | S. aureus (6 strains MDR/XDR) | [84] |
P. aeruginosa (7 strains MDR/XDR) | ||||||
3–6 μM | A. baumannii (3 strains MDR/XDR) | |||||
E. coli (8 strains MDR/XDR) | ||||||
K. pneumoniae (5 strains MDR/XDR) | ||||||
DP7 | VQWRIRVAVIRK | 16–32 | In vivo/In vitro/In silico | NR | P. aeruginosa (MDR various strains) | [85] |
DP7 + vancomycin or azithromycin | NR | S. aureus, P. aeruginosa, A. baumannii, and E. coli | ||||
DP-C and DP-C Dimer | [(KLAKLAK)*2-L-C] *D-amino acids (right-handed). | 16–32 | In vitro/In silico | NR | P. aeruginosa | [86] |
4–8 | A. baumannii | |||||
4–16 | E. coli | |||||
16–>128 | K. pneumoniae | |||||
Ω76 peptide | FLKAIKKFGKEFKKIGAKLK | 16 | In vivo/In vitro | Mag derivative | carbapenem and tigecycline-resistant A. baumannii | [87] |
128 | In vitro | K. pneumoniae | ||||
4 | E. coli | |||||
NuriPep 1653 | VRGLAPKKSLWPFGGPFKSPFN | 12 | In vitro | P54 nutrient reservoir protein of Pisum sativum | A. baumannii-resistant (ColRAB) PDR | [88] |
12 | A. baumannii susceptible (colSAB) | |||||
400 | K. pneumoniae 50183 | |||||
100 | E. coli ATCC 25922 | |||||
8 | P. aeruginosa ATCC 27853 | |||||
Tachyplesin III | KWCFRVCYRGICYRKCR | 10 mg/kg | In vivo | β-sheet AMP | P. aeruginosa 1409 | [89] |
A. baumannii 1409 | ||||||
Melittin | NR | 16 | In vivo/In vitro | NR | A. baumannii (XDR and MDR strains, clinic isolates) | [90] |
Protegrin-1 | RGGRLCYCRRRFCVCVGR | 4–8 | In vitro | β-sheet peptides (cathelicidin family) | A. baumannii (XDR and MDR strains from surgical wounds) | [91] |
Aurein 1.2 | GLFDIIKKIAESF-NH2 | 16 | In vitro | NR | A. baumannii ATCC 19606 | [92] |
CAMEL | KWKLFKKIGAVLKVL-NH2 | 2 | ||||
Citropin 1.1 | GLFDVIKKVASVIGGL-NH2 | 16 | ||||
LL-37 | LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES | 4 | ||||
Omiganan | ILRWPWWPWRRK-NH2 | 32 | ||||
r-Omiganan | KRRWPWWPWRLI-NH2 | 16 | ||||
Pexiganan | GIGKFLKKAKKFGKAFVKILKK-NH2 | 2 | ||||
Temporin A | FLPLIGRVLSGIL-NH2 | 128 | ||||
Bac5(1–17) native/Bac5-derivatives | wt, 258, 272, 278, 281, and 291 peptides | 2–16 | In vitro | NR | E. coli BW25113 | [93] |
E. coli C679-12 EAEC:0104 | ||||||
4–>64 | A. baumannii ATCC 19606 | |||||
1–16 | E. coli EURL-VTEC A07 EPEC:O111 | |||||
E. coli SSI-OO15 EIEC | ||||||
1–2 | E. coli SSI-NN14 ETEC | |||||
E. coli EA22 ETEC | ||||||
16–>64 | K. pneumoniae ATCC 700603 | |||||
P. aeruginosa ATCC 27853 | ||||||
8–>64 | E. coli EURL-VTEC C07 STEC:O157 | |||||
E. coli BW25113ΔsbmA | ||||||
SA4 peptide | IOWAGOLFOLFO-NH2 | 50 | In vitro | NR | A. baumannii (MDR1, MDR2, MDR3, and MDR4) | [94] |
SPO peptoid | nInOnWnAnGnOnLnFnOnLnFnO-NH2 | |||||
D87(Lys1–6 Arg-1) | Complex sequence (see reference) | 0.8 | In vitro | NR | 7 Strains of A. baumannii resistant to Polymyxin B and Colistin and 20 Worldwide 2016 and 2017 Isolates resistant to 18 Classical Antibiotics | [95] |
D84(Lys1–6 Lys-1) | 0.5–0.7 | |||||
D85(Lys1–6 Orn-1) | 0.5 | |||||
D86(Lys1–6 Dab-1) | 1.0 | |||||
D105(Lys1–6 Dap-1) | 1–1.2 | |||||
D101(Lys1Ser26-5 Lys-1) | 0.8–1 | |||||
D102(Lys1Ser26-5 Dab-1) | 0.6–0.7 | |||||
D85(K13A/K16A)-(Lys1–6 Orn-1) | 1.9–2 | |||||
D86(K13A/K16A)-(Lys1–6 Dab-1) | 0.9 | |||||
D105(K13A/K16A)-(Lys1–6 Dap-1) | 1.3–2 | |||||
Agelaia-MPI | INWLKLGKAIIDAL | 6.25–25 µM | In vitro | Agelaia pallipes pallipes | Clinical isolates of MDR A. baumannii identified as AB 02, AB 53, and AB 72 | [96] |
Polybia-MPII | INWLKLGKMVIDAL | 12.5–25 µM | Pseudopolybia vespiceps testacea | |||
Con10 | FWSFLVKAASKILPSLIGGGDDNKSSS | Opisthacanthus cayaporum | ||||
NDBP-5.8 | GILGKIWEGVKSLI | >25 µM | Opisthacanthus cayaporum | |||
Polydim-I | AVAGEKLWLLPHLLKMLLTPTP | Polybia dimorpha | ||||
ARV-1502 | Chex-RPDKPRPTLPRPRPPRPVR | 50 | In vivo | Insect | MDR A. baumannii Strain HUMC1 | [97] |
Bac7(1–35) | NR | 4 | In vitro | NR | A. baumannii XDR 420 | [98] |
A. baumannii MDR 7B | ||||||
2 | A. baumannii MDR AB5075 | |||||
A. baumannii MDR 215B | ||||||
P5 + meropenem | RIVQRIKKWLLKWKKLGY | 16 | In vitro | NR | P. aeruginosa M1351 | [50] |
PEP01 to PEP04 | GKIMYILTKKS, FGIKLRSVWKK, FGIKLRSVWKR, and FGIKLRKVWKD | 62.5–125 | In silico | NR | K. pneumoniae MTCC619 | [99] |
NZX | GFGCNGPWSEDDIQCHNHCKSIKGYKGGYCARGGFVCKCY Disulfide bonds at position C4–C30, C15–C37, C19–C39 | 1.6–3.2 µM | In vitro | Plectasin derivate | M. tuberculosis | [100] |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2021 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Roque-Borda, C.A.; da Silva, P.B.; Rodrigues, M.C.; Azevedo, R.B.; Di Filippo, L.; Duarte, J.L.; Chorilli, M.; Festozo Vicente, E.; Pavan, F.R. Challenge in the Discovery of New Drugs: Antimicrobial Peptides against WHO-List of Critical and High-Priority Bacteria. Pharmaceutics 2021, 13, 773. https://doi.org/10.3390/pharmaceutics13060773
Roque-Borda CA, da Silva PB, Rodrigues MC, Azevedo RB, Di Filippo L, Duarte JL, Chorilli M, Festozo Vicente E, Pavan FR. Challenge in the Discovery of New Drugs: Antimicrobial Peptides against WHO-List of Critical and High-Priority Bacteria. Pharmaceutics. 2021; 13(6):773. https://doi.org/10.3390/pharmaceutics13060773
Chicago/Turabian StyleRoque-Borda, Cesar Augusto, Patricia Bento da Silva, Mosar Corrêa Rodrigues, Ricardo Bentes Azevedo, Leonardo Di Filippo, Jonatas L. Duarte, Marlus Chorilli, Eduardo Festozo Vicente, and Fernando Rogério Pavan. 2021. "Challenge in the Discovery of New Drugs: Antimicrobial Peptides against WHO-List of Critical and High-Priority Bacteria" Pharmaceutics 13, no. 6: 773. https://doi.org/10.3390/pharmaceutics13060773