Antimicrobial Peptides: Avant-Garde Antifungal Agents to Fight against Medically Important Candida Species
Abstract
:1. Introduction
2. Characteristics of Antimicrobial Peptides
3. Antimicrobial Peptides in Preclinical and Clinical Trials
3.1. Antimicrobial Peptides from Vertebrates
3.1.1. Antimicrobial Peptides from Mammals
3.1.2. Antimicrobial Peptides from Fish
3.2. Antimicrobial Peptides from Invertebrates
3.2.1. Antimicrobial Peptides from Mollusks
3.2.2. Antimicrobial Peptides from Arthropods
3.3. Antimicrobial Peptides from Plants and Bacteria
3.4. Other AMPs
4. Antimicrobial Peptides in Combination Therapies
4.1. Echinocandins in Combination Therapies
4.2. Lactoferrin-Derivatives in Combination Therapies
4.3. Other AMPs in Combination Therapies
5. Conclusions
6. Future Directions
Author Contributions
Funding
Institutional Review Board Statement
Informed Consent Statement
Data Availability Statement
Conflicts of Interest
References
- Kumamoto, C.A.; Gresnigt, M.S.; Hube, B. The gut, the bad and the harmless: Candida albicans as a commensal and opportunistic pathogen in the intestine. Curr. Opin. Microbiol. 2020, 56, 7–15. [Google Scholar] [CrossRef] [PubMed]
- Yan, L.; Yang, C.; Tang, J. Disruption of the intestinal mucosal barrier in Candida albicans infections. Microbiol. Res. 2013, 168, 389–395. [Google Scholar] [CrossRef] [PubMed]
- Hazen, K.C.; Howell, S.A. Candida, Cryptococcus, and Other Yeasts of Medical Importance. In Manual of Clinical Microbiology, 9th ed.; Murray, P.R., Bach, E.J., Jorgensen, J.H., Pfaller, M.A., Landry, M.L., Eds.; ASM Press: Washington, DC, USA, 2007; pp. 1762–1788. [Google Scholar]
- Marco, F.; Lockhart, S.R.; Pfaller, M.A.; Pujol, C.; Rangel-Frausto, M.S.; Wiblin, T.; Blumberg, H.M.; Edwards, J.E.; Jarvis, W.; Saiman, L.; et al. Elucidating the origins of nosocomial infections with Candida albicans by DNA fingerprinting with the complex probe Ca3. J. Clin. Microbiol. 1999, 37, 2817–2828. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Höfs, S.; Mogavero, S.; Hube, B. Interaction of Candida albicans with host cells: Virulence factors, host defense, escape strategies, and the microbiota. J. Microbiol. 2016, 54, 149–169. [Google Scholar] [CrossRef]
- Calderone, R.A.; Clancy, C.J. Candida and Candidiasis; American Society for Microbiology Press: Washington, DC, USA, 2011. [Google Scholar]
- Bajpai, V.K.; Khan, I.; Shukla, S.; Kumar, P.; Rather, I.A.; Park, Y.; Huh, Y.S.; Han, Y.K. Invasive Fungal Infections and Their Epidemiology: Measures in the Clinical Scenario. Biotechnol. Bioprocess Eng. 2019, 24, 436–444. [Google Scholar] [CrossRef]
- Firacative, C. Invasive fungal disease in humans: Are we aware of the real impact? Mem. Inst. Oswaldo Cruz 2020, 115, e200430. [Google Scholar] [CrossRef]
- Brown, G.D.; Denning, D.W.; Gow, N.A.; Levitz, S.M.; Netea, M.G.; White, T.C. Hidden killers: Human fungal infections. Sci. Transl. Med. 2012, 4, 165rv113. [Google Scholar] [CrossRef] [Green Version]
- Bongomin, F.; Gago, S.; Oladele, R.O.; Denning, D.W. Global and multi-national prevalence of fungal diseases-estimate precision. J. Fungi 2017, 3, 57. [Google Scholar] [CrossRef]
- Pfaller, M.A.; Diekema, D.J.; Rinaldi, M.G.; Barnes, R.; Hu, B.; Veselov, A.V.; Tiraboschi, N.; Nagy, E.; Gibbs, D.L. Results from the ARTEMIS DISK Global Antifungal Surveillance Study: A 6.5-year analysis of susceptibilities of Candida and other yeast species to fluconazole and voriconazole by standardized disk diffusion testing. J. Clin. Microbiol. 2005, 43, 5848–5859. [Google Scholar] [CrossRef] [Green Version]
- Satoh, K.; Makimura, K.; Hasumi, Y.; Nishiyama, Y.; Uchida, K.; Yamaguchi, H. Candida auris sp. nov., a novel ascomycetous yeast isolated from the external ear canal of an inpatient in a Japanese hospital. Microbiol. Immunol. 2009, 53, 41–44. [Google Scholar] [CrossRef]
- Pappas, P.G.; Kauffman, C.A.; Andes, D.R.; Clancy, C.J.; Marr, K.A.; Ostrosky-Zeichner, L.; Reboli, A.C.; Schuster, M.G.; Vazquez, J.A.; Walsh, T.J.; et al. Clinical practice guideline for the management of candidiasis: 2016 update by the Infectious Diseases Society of America. Clin. Infect. Dis. 2016, 62, e1–e50. [Google Scholar] [CrossRef] [Green Version]
- Letscher-Bru, V.; Herbrecht, R. Caspofungin: The first representative of a new antifungal class. J. Antimicrob. Chemother. 2003, 51, 513–521. [Google Scholar] [CrossRef] [Green Version]
- Anderson, T.M.; Clay, M.C.; Cioffi, A.G.; Diaz, K.A.; Hisao, G.S.; Tuttle, M.D.; Nieuwkoop, A.J.; Comellas, G.; Maryum, N.; Wang, S.; et al. Amphotericin forms an extramembranous and fungicidal sterol sponge. Nat. Chem. Biol. 2014, 10, 400–406. [Google Scholar] [CrossRef]
- Lepesheva, G.I.; Hargrove, T.Y.; Kleshchenko, Y.; Nes, W.D.; Villalta, F.; Waterman, M.R. CYP51: A major drug target in the cytochrome P450 superfamily. Lipids 2008, 43, 1117–1125. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Allen, D.; Wilson, D.; Drew, R.; Perfect, J. Azole antifungals: 35 years of invasive fungal infection management. Expert Rev. Anti Infect. Ther. 2015, 13, 787–798. [Google Scholar] [CrossRef] [PubMed]
- Rodriguez, G.P.; Romanova, N.V.; Bao, G.; Rouf, N.C.; Kow, Y.W.; Crouse, G.F. Mismatch repair-dependent mutagenesis in nondividing cells. Proc. Natl. Acad. Sci. USA 2012, 109, 6153–6158. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- CDC. 2019 AR Threats Report. Available online: https://www.cdc.gov/drugresistance/biggest-threats.html#candida (accessed on 29 September 2022).
- Lee, K.K.; Maccallum, D.M.; Jacobsen, M.D.; Walker, L.A.; Odds, F.C.; Gow, N.A.; Munro, C.A. Elevated cell wall chitin in Candida albicans confers echinocandin resistance in vivo. Antimicrob. Agents Chemother. 2012, 56, 208–217. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Suwunnakorn, S.; Wakabayashi, H.; Kordalewska, M.; Perlin, D.S.; Rustchenko, E. FKS2 and FKS3 Genes of Opportunistic Human Pathogen Candida albicans Influence Echinocandin Susceptibility. Antimicrob. Agents Chemother. 2018, 62, e02299-17. [Google Scholar] [CrossRef] [Green Version]
- Pristov, K.E.; Ghannoum, M.A. Resistance of Candida to azoles and echinocandins worldwide. Clin. Microbiol. Infect. 2019, 25, 792–798. [Google Scholar] [CrossRef]
- Flowers, S.A.; Colon, B.; Whaley, S.G.; Schuler, M.A.; Rogers, P.D. Contribution of clinically derived mutations in ERG11 to azole resistance in Candida albicans. Antimicrob. Agents Chemother. 2015, 59, 450–460. [Google Scholar] [CrossRef] [Green Version]
- Pfaller, M.A.; Diekema, D.J.; Gibbs, D.L.; Newell, V.A.; Ellis, D.; Tullio, V.; Rodloff, A.; Fu, W.; Ling, T.A.; Global Antifungal Surveillance, G. Results from the ARTEMIS DISK Global Antifungal Surveillance Study, 1997 to 2007: A 10.5-year analysis of susceptibilities of Candida Species to fluconazole and voriconazole as determined by CLSI standardized disk diffusion. J. Clin. Microbiol. 2010, 48, 1366–1377. [Google Scholar] [CrossRef] [Green Version]
- Ostrowsky, B.; Greenko, J.; Adams, E.; Quinn, M.; O'Brien, B.; Chaturvedi, V.; Berkow, E.; Vallabhaneni, S.; Forsberg, K.; Chaturvedi, S.; et al. Candida auris Isolates Resistant to Three Classes of Antifungal Medications—New York, 2019. MMWR Morb. Mortal. Wkly. Rep. 2020, 69, 6–9. [Google Scholar] [CrossRef] [Green Version]
- Hancock, R.E.; Diamond, G. The role of cationic antimicrobial peptides in innate host defences. Trends Microbiol. 2000, 8, 402–410. [Google Scholar] [CrossRef]
- Wang, G.; Li, X.; Wang, Z. APD3: The antimicrobial peptide database as a tool for research and education. Nucleic Acids Res. 2016, 44, D1087–D1093. [Google Scholar] [CrossRef] [Green Version]
- Matsuzaki, K. Why and how are peptide-lipid interactions utilized for self-defense? Magainins and tachyplesins as archetypes. Biochim. Biophys. Acta 1999, 1462, 1–10. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Gaidukov, L.; Fish, A.; Mor, A. Analysis of membrane-binding properties of dermaseptin analogues: Relationships between binding and cytotoxicity. Biochemistry 2003, 42, 12866–12874. [Google Scholar] [CrossRef] [PubMed]
- Straus, S.K.; Hancock, R.E. Mode of action of the new antibiotic for Gram-positive pathogens daptomycin: Comparison with cationic antimicrobial peptides and lipopeptides. Biochim. Biophys. Acta 2006, 1758, 1215–1223. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Rosenfeld, Y.; Papo, N.; Shai, Y. Endotoxin (lipopolysaccharide) neutralization by innate immunity host-defense peptides. Peptide properties and plausible modes of action. J. Biol. Chem. 2006, 281, 1636–1643. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Zasloff, M. Antimicrobial peptides of multicellular organisms. Nature 2002, 415, 389–395. [Google Scholar] [CrossRef] [PubMed]
- Wang, G. Antimicrobial Peptides: Discovery, Design and Novel Therapeutic Strategies, 2nd ed.; CABI: Wallingford, UK, 2017. [Google Scholar]
- Roy, H.; Dare, K.; Ibba, M. Adaptation of the bacterial membrane to changing environments using aminoacylated phospholipids. Mol. Microbiol. 2009, 71, 547–550. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Johnston, P.R.; Dobson, A.J.; Rolff, J. Genomic Signatures of Experimental Adaptation to Antimicrobial Peptides in Staphylococcus aureus. G3 2016, 6, 1535–1539. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- El Shazely, B.; Urbanski, A.; Johnston, P.R.; Rolff, J. In vivo exposure of insect AMP resistant Staphylococcus aureus to an insect immune system. Insect Biochem. Mol. Biol. 2019, 110, 60–68. [Google Scholar] [CrossRef] [PubMed]
- Bacalum, M.; Radu, M. Cationic Antimicrobial Peptides Cytotoxicity on Mammalian Cells: An Analysis Using Therapeutic Index Integrative Concept. Int. J. Pept. Res. Ther. 2015, 21, 47–55. [Google Scholar] [CrossRef]
- Farzanegan, A.; Roudbary, M.; Falahati, M.; Khoobi, M.; Gholibegloo, E.; Farahyar, S.; Karimi, P.; Khanmohammadi, M. Synthesis, characterization and antifungal activity of a novel formulated nanocomposite containing Indolicidin and Graphene oxide against disseminated candidiasis. J. Mycol. Med. 2018, 28, 628–636. [Google Scholar] [CrossRef] [PubMed]
- Lupetti, A.; Brouwer, C.P.; Bogaards, S.J.; Welling, M.M.; de Heer, E.; Campa, M.; van Dissel, J.T.; Friesen, R.H.; Nibbering, P.H. Human lactoferrin-derived peptide's antifungal activities against disseminated Candida albicans infection. J. Infect. Dis. 2007, 196, 1416–1424. [Google Scholar] [CrossRef] [Green Version]
- Li, R.; Qiao, M.; Li, S.; Wei, A.; Ren, S.; Tao, M.; Zhao, Y.; Zhang, L.; Huang, L.; Shen, Y. Antifungal Peptide CGA-N9 Protects Against Systemic Candidiasis in Mice. Int. J. Pept. Res. Ther. 2022, 28, 58. [Google Scholar] [CrossRef]
- Li, R.; Zhang, L.; Zhang, H.; Yi, Y.; Wang, L.; Chen, L.; Zhang, L. Protective effect of a novel antifungal peptide derived from human chromogranin a on the immunity of mice infected with Candida krusei. Exp. Ther. Med. 2017, 13, 2429–2434. [Google Scholar] [CrossRef] [Green Version]
- Li, X.; Hu, Q.; Lin, Q.; Luo, J.; Xu, J.; Chen, L.; Xu, L.; Lin, X. Inhibition of Candida albicans in vivo and in vitro by antimicrobial peptides chromogranin A-N12 through microRNA-155/suppressor of cytokine signaling 1 axis. Bioengineered 2022, 13, 2513–2524. [Google Scholar] [CrossRef]
- Jia, F.; Wang, J.; Peng, J.; Zhao, P.; Kong, Z.; Wang, K.; Yan, W.; Wang, R. The in vitro, in vivo antifungal activity and the action mode of Jelleine-I against Candida species. Amino Acids 2018, 50, 229–239. [Google Scholar] [CrossRef]
- Tavares, P.M.; Thevissen, K.; Cammue, B.P.; Francois, I.E.; Barreto-Bergter, E.; Taborda, C.P.; Marques, A.F.; Rodrigues, M.L.; Nimrichter, L. In vitro activity of the antifungal plant defensin RsAFP2 against Candida isolates and its in vivo efficacy in prophylactic murine models of candidiasis. Antimicrob. Agents Chemother. 2008, 52, 4522–4525. [Google Scholar] [CrossRef] [Green Version]
- Rossi, D.C.; Munoz, J.E.; Carvalho, D.D.; Belmonte, R.; Faintuch, B.; Borelli, P.; Miranda, A.; Taborda, C.P.; Daffre, S. Therapeutic use of a cationic antimicrobial peptide from the spider Acanthoscurria gomesiana in the control of experimental candidiasis. BMC Microbiol. 2012, 12, 28. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Ribeiro, P.D.; Medina-Acosta, E. Prevention of lethal murine candidiasis using HP (2-20), an antimicrobial peptide derived from the N-terminus of Helicobacter pylori ribosomal protein L1. Peptides 2003, 24, 1807–1814. [Google Scholar] [CrossRef] [PubMed]
- Liao, H.; Liu, S.; Wang, H.; Su, H.; Liu, Z. Efficacy of Histatin5 in a murine model of vulvovaginal candidiasis caused by Candida albicans. Pathog. Dis. 2017, 75, ftx072. [Google Scholar] [CrossRef] [Green Version]
- Vrablikova, A.; Czernekova, L.; Cahlikova, R.; Novy, Z.; Petrik, M.; Imran, S.; Novak, Z.; Krupka, M.; Cerovsky, V.; Turanek, J.; et al. Lasioglossins LLIII affect the morphogenesis of Candida albicans and reduces the duration of experimental vaginal candidiasis in mice. Microbiol. Immunol. 2017, 61, 474–481. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Zhu, J.; Huang, Y.; Chen, M.; Hu, C.; Chen, Y. Functional synergy of antimicrobial peptides and chlorhexidine acetate against Gram-negative/Gram-positive bacteria and a fungus in vitro and in vivo. Infect. Drug Resist. 2019, 12, 3227–3239. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Duncan, V.; Smith, D.; Simpson, L.; Lovie, E.; Katvars, L.; Berge, L.; Robertson, J.; Smith, S.; Munro, C.; Mercer, D.; et al. Preliminary Characterization of NP339, a Novel Polyarginine Peptide with Broad Antifungal Activity. Antimicrob. Agents Chemother. 2021, 65, e0234520. [Google Scholar] [CrossRef] [PubMed]
- Muralidharan, R.; Bobek, L.A. Antifungal activity of human salivary mucin-derived peptide, MUC7 12-mer, in a murine model of oral candidiasis. J. Pept. Res. 2005, 66, 82–89. [Google Scholar] [CrossRef]
- He, J.; Thomas, M.A.; de Anda, J.; Lee, M.W.; Van Why, E.; Simpson, P.; Wong, G.C.L.; Grayson, M.H.; Volkman, B.F.; Huppler, A.R. Chemokine CCL28 Is a Potent Therapeutic Agent for Oropharyngeal Candidiasis. Antimicrob. Agents Chemother. 2020, 64, e00210-20. [Google Scholar] [CrossRef]
- Tanaka, T.; Okutomi, T.; Wakabayashi, H. Condition for effective inhibition of Candida albicans growth by lactoferricin B and its therapeutic activity with fluconazole against oral candidiasis in mice. Med. Mycol. Res. 2011, 2, 33–41. [Google Scholar]
- Nagao, J.I.; Cho, T.; Mitarai, M.; Iohara, K.; Hayama, K.; Abe, S.; Tanaka, Y. Antifungal activity in vitro and in vivo of a salmon protamine peptide and its derived cyclic peptide against Candida albicans. FEMS Yeast Res. 2017, 17, fow099. [Google Scholar] [CrossRef] [Green Version]
- Shin, S.H.; Lee, Y.S.; Shin, Y.P.; Kim, B.; Kim, M.H.; Chang, H.R.; Jang, W.S.; Lee, I.H. Therapeutic efficacy of halocidin-derived peptide HG1 in a mouse model of Candida albicans oral infection. J. Antimicrob. Chemother. 2013, 68, 1152–1160. [Google Scholar] [CrossRef] [PubMed]
- Gong, Y.; Li, H.; Wu, F.; Li, Y.; Zhang, S. Fungicidal Activity of AP10W, a Short Peptide Derived from AP-2 Complex Subunit mu-A, In Vitro and In Vivo. Biomolecules 2022, 12, 965. [Google Scholar] [CrossRef] [PubMed]
- Li, Z.; Jing, X.; Yuan, Y.; Shui, Y.; Li, S.; Zhao, Z.; Deng, B.; Zhang, W. In vitro and in vivo Activity of Phibilin Against Candida albicans. Front. Microbiol. 2022, 13, 862834. [Google Scholar] [CrossRef] [PubMed]
- Song, C.; Wen, R.; Zhou, J.; Zeng, X.; Kou, Z.; Zhang, J.; Wang, T.; Chang, P.; Lv, Y.; Wu, R. Antibacterial and Antifungal Properties of a Novel Antimicrobial Peptide GK-19 and Its Application in Skin and Soft Tissue Infections Induced by MRSA or Candida albicans. Pharmaceutics 2022, 14, 1937. [Google Scholar] [CrossRef] [PubMed]
- Tsai, P.W.; Yang, C.Y.; Chang, H.T.; Lan, C.Y. Human antimicrobial peptide LL-37 inhibits adhesion of Candida albicans by interacting with yeast cell-wall carbohydrates. PLoS ONE 2011, 6, e17755. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Xu, K.; Wang, H.; Liu, L.; Xu, W.; Sheng, J.; Fan, W.; Yang, Y.Y.; Li, L. Efficacy of CG(3)R(6)TAT nanoparticles self-assembled from a novel antimicrobial peptide for the treatment of Candida albicans meningitis in rabbits. Chemotherapy 2011, 57, 417–425. [Google Scholar] [CrossRef] [PubMed]
- Wu, H.; Liu, S.; Wiradharma, N.; Ong, Z.Y.; Li, Y.; Yang, Y.Y.; Ying, J.Y. Short Synthetic alpha-Helical-Forming Peptide Amphiphiles for Fungal Keratitis Treatment In Vivo. Adv. Healthc. Mater. 2017, 6, 1600777. [Google Scholar] [CrossRef]
- Basso, V.; Tran, D.Q.; Schaal, J.B.; Tran, P.; Eriguchi, Y.; Ngole, D.; Cabebe, A.E.; Park, A.Y.; Beringer, P.M.; Ouellette, A.J.; et al. Rhesus Theta Defensin 1 Promotes Long Term Survival in Systemic Candidiasis by Host Directed Mechanisms. Sci. Rep. 2019, 9, 16905. [Google Scholar] [CrossRef] [Green Version]
- Lee, W.; Lee, D.G. Fungicidal mechanisms of the antimicrobial peptide Bac8c. Biochim. Biophys. Acta 2015, 1848, 673–679. [Google Scholar] [CrossRef] [Green Version]
- Zapotoczna, M.; Forde, E.; Hogan, S.; Humphreys, H.; O'Gara, J.P.; Fitzgerald-Hughes, D.; Devocelle, M.; O'Neill, E. Eradication of Staphylococcus aureus Biofilm Infections Using Synthetic Antimicrobial Peptides. J. Infect. Dis. 2017, 215, 975–983. [Google Scholar] [CrossRef] [Green Version]
- Den Hertog, A.L.; van Marle, J.; Veerman, E.C.; Valentijn-Benz, M.; Nazmi, K.; Kalay, H.; Grun, C.H.; Hof, W.V.; Bolscher, J.G.; Amerongen, A.V.N. The human cathelicidin peptide LL-37 and truncated variants induce segregation of lipids and proteins in the plasma membrane of Candida albicans. Biol. Chem. 2006, 387, 1495–1502. [Google Scholar] [CrossRef]
- Tsai, P.W.; Cheng, Y.L.; Hsieh, W.P.; Lan, C.Y. Responses of Candida albicans to the human antimicrobial peptide LL-37. J. Microbiol. 2014, 52, 581–589. [Google Scholar] [CrossRef] [PubMed]
- Jacob, B.; Park, I.S.; Bang, J.K.; Shin, S.Y. Short KR-12 analogs designed from human cathelicidin LL-37 possessing both antimicrobial and antiendotoxic activities without mammalian cell toxicity. J. Pept. Sci. 2013, 19, 700–707. [Google Scholar] [CrossRef] [PubMed]
- Kim, E.Y.; Rajasekaran, G.; Shin, S.Y. LL-37-derived short antimicrobial peptide KR-12-a5 and its d-amino acid substituted analogs with cell selectivity, anti-biofilm activity, synergistic effect with conventional antibiotics, and anti-inflammatory activity. Eur. J. Med. Chem. 2017, 136, 428–441. [Google Scholar] [CrossRef] [PubMed]
- Caiaffa, K.S.; Massunari, L.; Danelon, M.; Abuna, G.F.; Bedran, T.B.L.; Santos-Filho, N.A.; Spolidorio, D.M.P.; Vizoto, N.L.; Cilli, E.M.; Duque, C. KR-12-a5 is a non-cytotoxic agent with potent antimicrobial effects against oral pathogens. Biofouling 2017, 33, 807–818. [Google Scholar] [CrossRef] [Green Version]
- Li, H.; Zhang, S.; Nie, B.; Long, T.; Qu, X.; Yue, B. KR-12-a5 Reverses Adverse Effects of Lipopolysaccharides on HBMSC Osteogenic Differentiation by Influencing BMP/Smad and P38 MAPK Signaling Pathways. Front. Pharmacol. 2019, 10, 639. [Google Scholar] [CrossRef]
- Sang, Y.; Ortega, M.T.; Rune, K.; Xiau, W.; Zhang, G.; Soulages, J.L.; Lushington, G.H.; Fang, J.; Williams, T.D.; Blecha, F.; et al. Canine cathelicidin (K9CATH): Gene cloning, expression, and biochemical activity of a novel pro-myeloid antimicrobial peptide. Dev. Comp. Immuno.l 2007, 31, 1278–1296. [Google Scholar] [CrossRef]
- Barreras-Serrano, A.; Tamayo-Sosa, A.R.; Villar-Pérez, V.M.d.; Castellanos-Félix, A.A.; Tinoco-Gracia, L.R.H.-P.; Melgarejo, T. Evaluation of antimicrobial peptide K9CATH in a murine model of mastitis. Thai J. Vet. Med. 2017, 47, 279–284. [Google Scholar]
- Tamayo-Sosa, A.R.; Villar-Pérez, V.M.d.; Barreras-Serrano, A.; Hernandez-Pando, R.; Olivas-Valdez, J.A.; Melgarejo, T. Evaluation of the K9CATH peptide in the treatment of experimental pulmonary tuberculosis. Afr. J. Microbiol. Res. 2012, 6, 6726–6729. [Google Scholar] [CrossRef] [Green Version]
- Jin, L.; Bai, X.; Luan, N.; Yao, H.; Zhang, Z.; Liu, W.; Chen, Y.; Yan, X.; Rong, M.; Lai, R.; et al. A Designed Tryptophan- and Lysine/Arginine-Rich Antimicrobial Peptide with Therapeutic Potential for Clinical Antibiotic-Resistant Candida albicans Vaginitis. J. Med. Chem. 2016, 59, 1791–1799. [Google Scholar] [CrossRef]
- Falla, T.J.; Karunaratne, D.N.; Hancock, R.E. Mode of action of the antimicrobial peptide indolicidin. J. Biol. Chem. 1996, 271, 19298–19303. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Ladokhin, A.S.; Selsted, M.E.; White, S.H. Bilayer interactions of indolicidin, a small antimicrobial peptide rich in tryptophan, proline, and basic amino acids. Biophys. J. 1997, 72, 794–805. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Subbalakshmi, C.; Sitaram, N. Mechanism of antimicrobial action of indolicidin. FEMS Microbiol. Lett. 1998, 160, 91–96. [Google Scholar] [CrossRef] [PubMed]
- Fritsche, T.R.; Rhomberg, P.R.; Sader, H.S.; Jones, R.N. Antimicrobial activity of omiganan pentahydrochloride tested against contemporary bacterial pathogens commonly responsible for catheter-associated infections. J. Antimicrob. Chemother. 2008, 61, 1092–1098. [Google Scholar] [CrossRef] [Green Version]
- Nibbering, P.H.; Ravensbergen, E.; Welling, M.M.; van Berkel, L.A.; van Berkel, P.H.; Pauwels, E.K.; Nuijens, J.H. Human lactoferrin and peptides derived from its N terminus are highly effective against infections with antibiotic-resistant bacteria. Infect. Immun. 2001, 69, 1469–1476. [Google Scholar] [CrossRef] [Green Version]
- Langham, A.A.; Ahmad, A.S.; Kaznessis, Y.N. On the nature of antimicrobial activity: A model for protegrin-1 pores. J. Am. Chem. Soc. 2008, 130, 4338–4346. [Google Scholar] [CrossRef] [Green Version]
- Cho, Y.; Turner, J.S.; Dinh, N.N.; Lehrer, R.I. Activity of protegrins against yeast-phase Candida albicans. Infect. Immun. 1998, 66, 2486–2493. [Google Scholar] [CrossRef] [Green Version]
- Patiño-Rodríguez, O.; Ortega-Berlanga, B.; Llamas-González, Y.Y.; Flores-Valdez, M.A.; Herrera-Díaz, A.; Montes-de-Oca-Luna, R.; Korban, S.S.; Alpuche-Solís, Á.G. Transient expression and characterization of the antimicrobial peptide protegrin-1 in Nicotiana tabacum for control of bacterial and fungal mammalian pathogens. Plant Cell Tissue Organ Cult. 2013, 115, 99–106. [Google Scholar] [CrossRef]
- Steinstraesser, L.; Burghard, O.; Nemzek, J.; Fan, M.H.; Merry, A.; Remick, D.I.; Su, G.L.; Steinau, H.U.; Wang, S.C. Protegrin-1 increases bacterial clearance in sepsis but decreases survival. Crit. Care Med. 2003, 31, 221–226. [Google Scholar] [CrossRef]
- Steinberg, D.A.; Hurst, M.A.; Fujii, C.A.; Kung, A.H.; Ho, J.F.; Cheng, F.C.; Loury, D.J.; Fiddes, J.C. Protegrin-1: A broad-spectrum, rapidly microbicidal peptide with in vivo activity. Antimicrob. Agents Chemother. 1997, 41, 1738–1742. [Google Scholar] [CrossRef] [Green Version]
- Trotti, A.; Garden, A.; Warde, P.; Symonds, P.; Langer, C.; Redman, R.; Pajak, T.F.; Fleming, T.R.; Henke, M.; Bourhis, J.; et al. A multinational, randomized phase III trial of iseganan HCl oral solution for reducing the severity of oral mucositis in patients receiving radiotherapy for head-and-neck malignancy. Int. J. Radiat. Oncol. Biol. Phys. 2004, 58, 674–681. [Google Scholar] [CrossRef]
- Giles, F.J.; Miller, C.B.; Hurd, D.D.; Wingard, J.R.; Fleming, T.R.; Sonis, S.T.; Bradford, W.Z.; Pulliam, J.G.; Anaissie, E.J.; Beveridge, R.A.; et al. A phase III, randomized, double-blind, placebo-controlled, multinational trial of iseganan for the prevention of oral mucositis in patients receiving stomatotoxic chemotherapy (PROMPT-CT trial). Leuk. Lymphoma 2003, 44, 1165–1172. [Google Scholar] [CrossRef]
- Xu, T.; Levitz, S.M.; Diamond, R.D.; Oppenheim, F.G. Anticandidal activity of major human salivary histatins. Infect. Immun. 1991, 59, 2549–2554. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Puri, S.; Edgerton, M. How does it kill?: Understanding the candidacidal mechanism of salivary histatin 5. Eukaryot Cell 2014, 13, 958–964. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Baev, D.; Rivetta, A.; Vylkova, S.; Sun, J.N.; Zeng, G.F.; Slayman, C.L.; Edgerton, M. The TRK1 potassium transporter is the critical effector for killing of Candida albicans by the cationic protein, Histatin 5. J. Biol. Chem. 2004, 279, 55060–55072. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Xue, Y.P.; Kao, M.C.; Lan, C.Y. Novel mitochondrial complex I-inhibiting peptides restrain NADH dehydrogenase activity. Sci. Rep. 2019, 9, 13694. [Google Scholar] [CrossRef] [Green Version]
- Jang, W.S.; Li, X.S.; Sun, J.N.; Edgerton, M. The P-113 fragment of histatin 5 requires a specific peptide sequence for intracellular translocation in Candida albicans, which is independent of cell wall binding. Antimicrob. Agents Chemother. 2008, 52, 497–504. [Google Scholar] [CrossRef] [Green Version]
- Wang, H.; Ai, L.; Zhang, Y.; Cheng, J.; Yu, H.; Li, C.; Zhang, D.; Pan, Y.; Lin, L. The Effects of Antimicrobial Peptide Nal-P-113 on Inhibiting Periodontal Pathogens and Improving Periodontal Status. Biomed. Res. Int. 2018, 2018, 1805793. [Google Scholar] [CrossRef] [Green Version]
- Van Dyke, T.; Paquette, D.; Grossi, S.; Braman, V.; Massaro, J.; D’Agostino, R.; Dibart, S.; Friden, P. Clinical and microbial evaluation of a histatin-containing mouthrinse in humans with experimental gingivitis: A phase-2 multi-center study. J. Clin. Periodontol. 2002, 29, 168–176. [Google Scholar] [CrossRef]
- Paquette, D.W.; Simpson, D.M.; Friden, P.; Braman, V.; Williams, R.C. Safety and clinical effects of topical histatin gels in humans with experimental gingivitis. J. Clin. Periodontol. 2002, 29, 1051–1058. [Google Scholar] [CrossRef]
- Situ, H.; Wei, G.; Smith, C.J.; Mashhoon, S.; Bobek, L.A. Human salivary MUC7 mucin peptides: Effect of size, charge and cysteine residues on antifungal activity. Biochem. J. 2003, 375, 175–182. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Wei, G.X.; Campagna, A.N.; Bobek, L.A. Factors affecting antimicrobial activity of MUC7 12-mer, a human salivary mucin-derived peptide. Ann. Clin. Microbiol. Antimicrob. 2007, 6, 14. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Bellamy, W.; Wakabayashi, H.; Takase, M.; Kawase, K.; Shimamura, S.; Tomita, M. Killing of Candida albicans by lactoferricin B, a potent antimicrobial peptide derived from the N-terminal region of bovine lactoferrin. Med. Microbiol. Immunol. 1993, 182, 97–105. [Google Scholar] [CrossRef] [PubMed]
- Bjorn, C.; Mahlapuu, M.; Mattsby-Baltzer, I.; Hakansson, J. Anti-infective efficacy of the lactoferrin-derived antimicrobial peptide HLR1r. Peptides 2016, 81, 21–28. [Google Scholar] [CrossRef] [PubMed]
- Kondori, N.; Baltzer, L.; Dolphin, G.T.; Mattsby-Baltzer, I. Fungicidal activity of human lactoferrin-derived peptides based on the antimicrobial alphabeta region. Int. J. Antimicrob. Agents 2011, 37, 51–57. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Pawar, S.; Markowitz, K.; Velliyagounder, K. Effect of human lactoferrin on Candida albicans infection and host response interactions in experimental oral candidiasis in mice. Arch. Oral Biol. 2022, 137, 105399. [Google Scholar] [CrossRef]
- Lupetti, A.; Paulusma-Annema, A.; Welling, M.M.; Senesi, S.; van Dissel, J.T.; Nibbering, P.H. Candidacidal activities of human lactoferrin peptides derived from the N terminus. Antimicrob. Agents Chemother. 2000, 44, 3257–3263. [Google Scholar] [CrossRef] [Green Version]
- Vylkova, S.; Li, X.S.; Berner, J.C.; Edgerton, M. Distinct antifungal mechanisms: Beta-defensins require Candida albicans Ssa1 protein, while Trk1p mediates activity of cysteine-free cationic peptides. Antimicrob. Agents Chemother. 2006, 50, 324–331. [Google Scholar] [CrossRef] [Green Version]
- Sun, X.L.; Baker, H.M.; Shewry, S.C.; Jameson, G.B.; Baker, E.N. Structure of recombinant human lactoferrin expressed in Aspergillus awamori. Acta Crystallogr. D Biol. Crystallogr. 1999, 55, 403–407. [Google Scholar] [CrossRef]
- Guntupalli, K.; Dean, N.; Morris, P.E.; Bandi, V.; Margolis, B.; Rivers, E.; Levy, M.; Lodato, R.F.; Ismail, P.M.; Reese, A.; et al. A phase 2 randomized, double-blind, placebo-controlled study of the safety and efficacy of talactoferrin in patients with severe sepsis. Crit. Care Med. 2013, 41, 706–716. [Google Scholar] [CrossRef]
- Lugardon, K.; Raffner, R.; Goumon, Y.; Corti, A.; Delmas, A.; Bulet, P.; Aunis, D.; Metz-Boutigue, M.H. Antibacterial and antifungal activities of vasostatin-1, the N-terminal fragment of chromogranin A. J. Biol. Chem. 2000, 275, 10745–10753. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Li, R.; Chen, C.; Zhu, S.; Wang, X.; Yang, Y.; Shi, W.; Chen, S.; Wang, C.; Yan, L.; Shi, J. CGA-N9, an antimicrobial peptide derived from chromogranin A: Direct cell penetration of and endocytosis by Candida tropicalis. Biochem. J. 2019, 476, 483–497. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Li, R.; Chen, C.; Zhang, B.; Jing, H.; Wang, Z.; Wu, C.; Hao, P.; Kuang, Y.; Yang, M. The chromogranin A-derived antifungal peptide CGA-N9 induces apoptosis in Candida tropicalis. Biochem. J. 2019, 476, 3069–3080. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Li, R.; Zhang, R.; Yang, Y.; Wang, X.; Yi, Y.; Fan, P.; Liu, Z.; Chen, C.; Chang, J. CGA-N12, a peptide derived from chromogranin A, promotes apoptosis of Candida tropicalis by attenuating mitochondrial functions. Biochem. J. 2018, 475, 1385–1396. [Google Scholar] [CrossRef] [Green Version]
- Li, R.; Liu, Z.; Dong, W.; Zhang, L.; Zhang, B.; Li, D.; Fu, C. The antifungal peptide CGA-N12 inhibits cell wall synthesis of Candida tropicalis by interacting with KRE9. Biochem. J. 2020, 477, 747–762. [Google Scholar] [CrossRef] [Green Version]
- Li, R.-f.; Li, C.-n.; Lu, Z.-f.; Zhang, H.-r.; Zhang, R.-l.; Zheng-wei, L. Curative effect of antifungal peptide CGA-N12 on mice systemically infected with Candida tropicalis. Prog. Vet. Med. 2017, 4, 62–67. [Google Scholar]
- Gong, Y.; Li, H.; Wu, F.; Zhang, X.; Zhou, Y.; Zhang, S. A short peptide derived from zebrafish AP-2 complex subunit mu-A AP2M1A354–382 has antimicrobial activity against multi-drug resistant bacteria. Pept. Sci. 2022, 114, e24258. [Google Scholar] [CrossRef]
- Shin, Y.P.; Park, H.J.; Shin, S.H.; Lee, Y.S.; Park, S.; Jo, S.; Lee, Y.H.; Lee, I.H. Antimicrobial activity of a halocidin-derived peptide resistant to attacks by proteases. Antimicrob. Agents Chemother. 2010, 54, 2855–2866. [Google Scholar] [CrossRef] [Green Version]
- Jang, W.S.; Kim, H.K.; Lee, K.Y.; Kim, S.A.; Han, Y.S.; Lee, I.H. Antifungal activity of synthetic peptide derived from halocidin, antimicrobial peptide from the tunicate, Halocynthia aurantium. FEBS Lett. 2006, 580, 1490–1496. [Google Scholar] [CrossRef] [Green Version]
- Cabrera, M.P.; Baldissera, G.; Silva-Goncalves, L.D.C.; Souza, B.M.; Riske, K.A.; Palma, M.S.; Ruggiero, J.R.; Arcisio-Miranda, M. Combining experimental evidence and molecular dynamic simulations to understand the mechanism of action of the antimicrobial octapeptide jelleine-I. Biochemistry 2014, 53, 4857–4868. [Google Scholar] [CrossRef]
- Park, S.C.; Kim, M.H.; Hossain, M.A.; Shin, S.Y.; Kim, Y.; Stella, L.; Wade, J.D.; Park, Y.; Hahm, K.S. Amphipathic alpha-helical peptide, HP (2-20), and its analogues derived from Helicobacter pylori: Pore formation mechanism in various lipid compositions. Biochim. Biophys. Acta 2008, 1778, 229–241. [Google Scholar] [CrossRef] [PubMed]
- Memariani, H.; Memariani, M. Anti-fungal properties and mechanisms of melittin. Appl. Microbiol. Biotechnol. 2020, 104, 6513–6526. [Google Scholar] [CrossRef] [PubMed]
- Lee, W.R.; Kim, K.H.; An, H.J.; Kim, J.Y.; Chang, Y.C.; Chung, H.; Park, Y.Y.; Lee, M.L.; Park, K.K. The protective effects of melittin on Propionibacterium acnes-induced inflammatory responses in vitro and in vivo. J. Investig. Dermatol. 2014, 134, 1922–1930. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Pashaei, F.; Bevalian, P.; Akbari, R.; Bagheri, K.P. Single dose eradication of extensively drug resistant Acinetobacter spp. In a mouse model of burn infection by melittin antimicrobial peptide. Microb. Pathog. 2019, 127, 60–69. [Google Scholar] [CrossRef] [PubMed]
- Andra, J.; Berninghausen, O.; Leippe, M. Cecropins, antibacterial peptides from insects and mammals, are potently fungicidal against Candida albicans. Med. Microbiol. Immunol. 2001, 189, 169–173. [Google Scholar] [CrossRef] [PubMed]
- Yun, J.; Lee, D.G. Cecropin A-induced apoptosis is regulated by ion balance and glutathione antioxidant system in Candida albicans. IUBMB Life 2016, 68, 652–662. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Zhai, Z.; Zhang, F.; Cao, R.; Ni, X.; Xin, Z.; Deng, J.; Wu, G.; Ren, W.; Yin, Y.; Deng, B. Cecropin A Alleviates Inflammation Through Modulating the Gut Microbiota of C57BL/6 Mice With DSS-Induced IBD. Front. Microbiol. 2019, 10, 1595. [Google Scholar] [CrossRef]
- Battista, F.; Oliva, R.; Del Vecchio, P.; Winter, R.; Petraccone, L. Insights into the Action Mechanism of the Antimicrobial Peptide Lasioglossin III. Int. J. Mol. Sci. 2021, 22, 2857. [Google Scholar] [CrossRef]
- Cerovsky, V.; Budesinsky, M.; Hovorka, O.; Cvacka, J.; Voburka, Z.; Slaninova, J.; Borovickova, L.; Fucik, V.; Bednarova, L.; Votruba, I.; et al. Lasioglossins: Three novel antimicrobial peptides from the venom of the eusocial bee Lasioglossum laticeps (Hymenoptera: Halictidae). ChemBioChem 2009, 10, 2089–2099. [Google Scholar] [CrossRef]
- Miranda, A.; Jouvensal, L.; Vovelle, F.; Bulet, P.; Daffre, S. A powerful antimicrobial peptide isolated from the Brazilian tarantula spider Acanthoscurria gomesiana. In Animal Toxins: State of the Art. Perspectives in Health and Biotechnology; UFMG: Belo Horizonte, Brazil, 2009; pp. 227–247. [Google Scholar]
- Terras, F.R.; Schoofs, H.M.; De Bolle, M.F.; Van Leuven, F.; Rees, S.B.; Vanderleyden, J.; Cammue, B.P.; Broekaert, W.F. Analysis of two novel classes of plant antifungal proteins from radish (Raphanus sativus L.) seeds. J. Biol. Chem. 1992, 267, 15301–15309. [Google Scholar] [CrossRef]
- Thevissen, K.; Tavares, P.d.M.; Xu, D.; Blankenship, J.; Vandenbosch, D.; Idkowiak-Baldys, J.; Govaert, G.; Bink, A.; Rozental, S.; de Groot, P.W.; et al. The plant defensin RsAFP2 induces cell wall stress, septin mislocalization and accumulation of ceramides in Candida albicans. Mol. Microbiol. 2012, 84, 166–180. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Zhao, L.; Huang, Y.; Gao, S.; Cui, Y.; He, D.; Wang, L.; Chen, Y. Comparison on effect of hydrophobicity on the antibacterial and antifungal activities of α-helical antimicrobial peptides. Sci. China Chem. 2013, 56, 1307–1314. [Google Scholar] [CrossRef]
- Pharma, D. XF-73 (Exeporfinium Chloride). Available online: https://www.destinypharma.com/platform/xf-73-exeporfinium-chloride/ (accessed on 19 September 2022).
- Maisch, T.; Bosl, C.; Szeimies, R.M.; Lehn, N.; Abels, C. Photodynamic effects of novel XF porphyrin derivatives on prokaryotic and eukaryotic cells. Antimicrob. Agents Chemother. 2005, 49, 1542–1552. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Gonzales, F.P.; Felgentrager, A.; Baumler, W.; Maisch, T. Fungicidal photodynamic effect of a twofold positively charged porphyrin against Candida albicans planktonic cells and biofilms. Future Microbiol. 2013, 8, 785–797. [Google Scholar] [CrossRef] [PubMed]
- Eisenberg, D.; Wesson, M. The most highly amphiphilic alpha-helices include two amino acid segments in human immunodeficiency virus glycoprotein 41. Biopolymers 1990, 29, 171–177. [Google Scholar] [CrossRef]
- Deslouches, B.; Clancy, C.; Nguyen, M.; Cheng, S.; Mietzner, T. The antimicrobial peptide Wlbu2 is active against Candida spp. Cryptococcus neoformans and leading causes of bacterial sepsis. In Proceedings of the Infectious Diseases Society of America 2008 Annual Meeting, Washington, DC, USA, 25–28 October 2008. [Google Scholar]
- Bell, G.; Gouyon, P.H. Arming the enemy: The evolution of resistance to self-proteins. Microbiology 2003, 149, 1367–1375. [Google Scholar] [CrossRef] [Green Version]
- Wang, H.; Xu, K.; Liu, L.; Tan, J.P.; Chen, Y.; Li, Y.; Fan, W.; Wei, Z.; Sheng, J.; Yang, Y.Y.; et al. The efficacy of self-assembled cationic antimicrobial peptide nanoparticles against Cryptococcus neoformans for the treatment of meningitis. Biomaterials 2010, 31, 2874–2881. [Google Scholar] [CrossRef]
- Liu, L.; Xu, K.; Wang, H.; Tan, P.K.; Fan, W.; Venkatraman, S.S.; Li, L.; Yang, Y.Y. Self-assembled cationic peptide nanoparticles as an efficient antimicrobial agent. Nat. Nanotechnol. 2009, 4, 457–463. [Google Scholar] [CrossRef]
- Wiradharma, N.; Khoe, U.; Hauser, C.A.; Seow, S.V.; Zhang, S.; Yang, Y.Y. Synthetic cationic amphiphilic alpha-helical peptides as antimicrobial agents. Biomaterials 2011, 32, 2204–2212. [Google Scholar] [CrossRef]
- NovaBiotics. NovaBiotics Awarded £1.8m in Small Business Research Innovation-Innovate UK Grant Funding to Advance Its Antifungal Drug Candidate, Novamycin. Available online: https://novabiotics.co.uk/novabiotics-awarded-1-8m-in-small-business-research-innovation-innovate-uk-grant-funding-to-advance-its-antifungal-drug-candidate-novamycin/ (accessed on 21 September 2022).
- Livengood, S.J.; Drew, R.H.; Perfect, J.R. Combination Therapy for Invasive Fungal Infections. Curr. Fungal Infect. Rep. 2020, 14, 40–49. [Google Scholar] [CrossRef]
- Khalifa, H.O.; Majima, H.; Watanabe, A.; Kamei, K. In Vitro characterization of twenty-one antifungal combinations against echinocandin-resistant and -susceptible Candida glabrata. J. Fungi 2021, 7, 108. [Google Scholar] [CrossRef] [PubMed]
- Kovacs, R.; Nagy, F.; Toth, Z.; Bozo, A.; Balazs, B.; Majoros, L. Synergistic effect of nikkomycin Z with caspofungin and micafungin against Candida albicans and Candida parapsilosis biofilms. Lett. Appl. Microbiol. 2019, 69, 271–278. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Bidaud, A.L.; Djenontin, E.; Botterel, F.; Chowdhary, A.; Dannaoui, E. Colistin interacts synergistically with echinocandins against Candida auris. Int. J. Antimicrob. Agents 2020, 55, 105901. [Google Scholar] [CrossRef] [PubMed]
- Chen, Y.L.; Lehman, V.N.; Averette, A.F.; Perfect, J.R.; Heitman, J. Posaconazole exhibits in vitro and in vivo synergistic antifungal activity with caspofungin or FK506 against Candida albicans. PLoS ONE 2013, 8, e57672. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Kobayashi, T.; Kakeya, H.; Miyazaki, T.; Izumikawa, K.; Yanagihara, K.; Ohno, H.; Yamamoto, Y.; Tashiro, T.; Kohno, S. Synergistic antifungal effect of lactoferrin with azole antifungals against Candida albicans and a proposal for a new treatment method for invasive candidiasis. Jpn. J. Infect. Dis. 2011, 64, 292–296. [Google Scholar] [CrossRef]
- Kuipers, M.E.; de Vries, H.G.; Eikelboom, M.C.; Meijer, D.K.; Swart, P.J. Synergistic fungistatic effects of lactoferrin in combination with antifungal drugs against clinical Candida isolates. Antimicrob. Agents Chemother. 1999, 43, 2635–2641. [Google Scholar] [CrossRef] [Green Version]
- Fais, R.; Rizzato, C.; Franconi, I.; Tavanti, A.; Lupetti, A. Synergistic activity of the human Lactoferricin-derived peptide hLF1-11 in combination with caspofungin against Candida species. Microbiol. Spectr. 2022, 10, e0124022. [Google Scholar] [CrossRef]
- Lupetti, A.; Paulusma-Annema, A.; Welling, M.M.; Dogterom-Ballering, H.; Brouwer, C.P.; Senesi, S.; Van Dissel, J.T.; Nibbering, P.H. Synergistic activity of the N-terminal peptide of human lactoferrin and fluconazole against Candida species. Antimicrob. Agents Chemother. 2003, 47, 262–267. [Google Scholar] [CrossRef] [Green Version]
- Venkatesh, M.P.; Rong, L. Human recombinant lactoferrin acts synergistically with antimicrobials commonly used in neonatal practice against coagulase-negative staphylococci and Candida albicans causing neonatal sepsis. J. Med. Microbiol. 2008, 57, 1113–1121. [Google Scholar] [CrossRef] [Green Version]
- Wakabayashi, H.; Abe, S.; Teraguchi, S.; Hayasawa, H.; Yamaguchi, H. Inhibition of hyphal growth of azole-resistant strains of Candida albicans by triazole antifungal agents in the presence of lactoferrin-related compounds. Antimicrob. Agents Chemother. 1998, 42, 1587–1591. [Google Scholar] [CrossRef] [Green Version]
- Wakabayashi, H.; Abe, S.; Okutomi, T.; Tansho, S.; Kawase, K.; Yamaguchi, H. Cooperative anti-Candida effects of lactoferrin or its peptides in combination with azole antifungal agents. Microbiol. Immunol. 1996, 40, 821–825. [Google Scholar] [CrossRef]
- Rather, I.A.; Sabir, J.S.M.; Asseri, A.H.; Ali, S. Antifungal Activity of Human Cathelicidin LL-37, a Membrane Disrupting Peptide, by Triggering Oxidative Stress and Cell Cycle Arrest in Candida auris. J. Fungi 2022, 8, 204. [Google Scholar] [CrossRef]
- Zyrek, D.; Wajda, A.; Czechowicz, P.; Nowicka, J.; Jaskiewicz, M.; Neubauer, D.; Kamysz, W. The Antimicrobial Activity of Omiganan Alone and In Combination against Candida Isolated from Vulvovaginal Candidiasis and Bloodstream Infections. Antibiotics 2021, 10, 1001. [Google Scholar] [CrossRef]
- Wei, G.X.; Bobek, L.A. In vitro synergic antifungal effect of MUC7 12-mer with histatin-5 12-mer or miconazole. J. Antimicrob. Chemother. 2004, 53, 750–758. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Vriens, K.; Cools, T.L.; Harvey, P.J.; Craik, D.J.; Braem, A.; Vleugels, J.; De Coninck, B.; Cammue, B.P.; Thevissen, K. The radish defensins RsAFP1 and RsAFP2 act synergistically with caspofungin against Candida albicans biofilms. Peptides 2016, 75, 71–79. [Google Scholar] [CrossRef] [PubMed]
- Vankova, E.; Kasparova, P.; Dulickova, N.; Cerovsky, V. Combined effect of lasioglossin LL-III derivative with azoles against Candida albicans virulence factors: Biofilm formation, phospholipases, proteases and hemolytic activity. FEMS Yeast Res. 2020, 20, foaa020. [Google Scholar] [CrossRef] [PubMed]
- Zhu, J.; Huang, Y.; Hu, C.; Huang, Y.; Chen, M.; He, X.; Zhang, Y.; Wang, Y.; Chen, Y. Inhibitory Effects and Mechanism of the Combined Use of α-Helical Peptides HPRP-A1/HPRP-A2 and Chlorhexidine Acetate against Bacterial and Fungal Biofilms. Int. J. Pept. Res. Ther. 2021, 27, 527–542. [Google Scholar] [CrossRef]
Family/Source | Name | Sequence | Length | Candida Species Tested In Vitro |
---|---|---|---|---|
Defensins | RTD-1 | GFCRCLCRRGVCRCICTR | 18-mer | C. albicans, C. tropicalis |
Bac8c | RLWVLWRR | 8-mer | C. albicans, C. parapsilosis | |
Cathelicidins | LL-37 | [LL-37, 37 aa] | 37-mer | C. albicans |
KR-12-95 | KRIVKLILKWLR | 12-mer | C. albicans | |
K9CATH | RLKELITTGGQKIGEKIRRIGQRIKDFFKNLQPREEKS | 38-mer | C. albicans | |
ZY13 | VKRWKKWRWKWKKWV | 15-mer | C. albicans | |
Indolicidin | ILPWKWPWWPWRR | 13-mer | C. albicans | |
Omiganan | ILRWPWWPWRRK | 12-mer | C. albicans, C. glabrata | |
Protegrin-I | RGGRLCYCRRRFCVCVGR | 18-mer | C. albicans, C. tropicalis | |
Iseganan | RGGLCYCRGRFCVCVGR | 17-mer | C. albicans, C. glabrata, C. krusei | |
Histatins and mucins | Histatin-5 | DSHAKRHHGYKRKFHEKHHSHRGY | 24-mer | C. albicans, C. tropicalis, C. guillermondi |
PAC113 | AKRHHGYKRKFH | 12-mer | C. albicans, C. glabrata, C. krusei, C. parapsilosis, C. tropicalis | |
MUC7 12-mer | RKSYKCLHKRCR | 12-mer | C. albicans, C. glabrata | |
CCL28 | HRKKHHGKRNSNRAHQGKHETYGHKTPY | 28-mer | C. albicans | |
From milk and colostrum | Lactoferricin B | FKCRRWQWRMKKLGAPSITCVRRAF | 25-mer | C. albicans |
HLR1r | FQWQRNMRKVRGSRRRRG | 18-mer | C. albicans | |
HLopt2 | CFQWKRAMRKVR | 12-mer | C. albicans, C. glabrata, C. krusei | |
hLF1-11 | GRRRRSVQWCA | 11-mer | C. albicans | |
Chromogranins | CGA-N9 | RILSILRHQ | 9-mer | C. glabrata, C. parapsilosis, C. krusei, C. tropicalis |
CGA-N46 | PMPVSQECFETLRGHERILSILRHQNLLKELQDLALQGAKERAHQQ | 46-mer | C. albicans, C. glabrata, C. parapsilosis, C. krusei, C. tropicalis | |
CGA-N12 | ALQGAKERAHQQ | 12-mer | C. albicans, C. glabrata, C. parapsilosis, C. krusei, C. tropicalis | |
From fish | AP10W | WKIKRWAIWK | 10-mer | C. albicans |
Protamine | VSRRRRRRGGRRRR | 14-mer | C. albicans, C. glabrata, C. krusei, C. tropicalis | |
From mollusks | HG1 | KWLNALLHHGLNCAKGVLA | 19-mer | C. albicans, C. glabrata, C. krusei |
Phibilin | RGDILKRWAGHFSKLL | 16-mer | C. albicans | |
From arthropods | Jelleine-I | PFKLSLHL | 8-mer | C. albicans, C. glabrata, C. parapsilosis, C. krusei, C. tropicalis |
Melittin | GIGAVLKVLTTGLPALISWIKRKRQQ | 26-mer | C. albicans, C. parapsilosis | |
Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK | 37-mer | C. albicans | |
Lasioglossin III | VNWKKILGKIIKVVK | 15-mer | C. albicans, C. parapsilosis, C. tropicalis | |
Gomesin | XCRRLCYKQRCVTYCRGR | 18-mer | C. albicans, C. glabrata, C. tropicalis | |
GK-19 | GFLFKLIPKAIKKLISKFK | 19-mer | C. albicans, C. glabrata, C. krusei | |
From plants | RsAFP2 | PyroGlu-KLCQRPSGTWSGVCGNNNACKNQCIRLEKA RHGSCNYVFPAHKCICYFPC | 50-mer | C. albicans |
From bacteria | HP (2-20) | AKKVFKRLEKLFSKIQNDK | 19-mer | C. albicans |
HPRP-A1 | FKKLKKLFSKLWNWK | 15-mer | C. albicans | |
Other AMPs | XF-73 | KJLHJQGDBJNMPUXRFOENPRSAL | 25-mer | C. albicans |
WLBU2 | RRWVRRVRRWVRRVVRVVRRWVRR | 24-mer | Candida spp. | |
CG3R6TAT | Cholesterol-GGGRRRRRRYGRKKRRQRRR | 20-mer | C. albicans | |
C(LLKK)2C | LLKKLLKK | 8-mer | C. albicans | |
(LLKK)3C | LLKKLLKKLLKK | 12-mer | C. albicans | |
Novamycin | RRRRRRRRRRRRR | 13-mer | C. albicans, C. auris |
Disease Model | Animal | Candida Species | AMP (Reference) | Administration Route |
---|---|---|---|---|
Disseminated candidiasis | BALB/c mice | C. albicans | Indolicidin [38] | Intraperitoneal |
Swiss mice 1 | C. albicans2 | hLF1-11 [39] | Intravenous | |
BALB/c mice | C. tropicalis | CGA-N9 [40] | Intraperitoneal | |
Kunming mice | C. krusei | CGA-N46 [41] | Intraperitoneal | |
New Zealand white rabbits | C. albicans | CGA-N12 [42] | Intraperitoneal | |
Kunming mice 1 | C. albicans | Jelleine-I [43] | Intraperitoneal | |
Mice | C. albicans | RsAFP2 [44] | Intravenous | |
BALB/c mice | C. albicans | Gomesin [45] | Intraperitoneal | |
CBA/J mice | C. albicans | HP (2-20) [46] | Intraperitoneal and intravenous | |
Vulvovaginal candidiasis | BALB/c mice | C. albicans | Histatin-5 [47] | Vaginal perfusion |
DBA/2 mice | C. albicans | Lasioglossin III [48] | Intravaginal | |
BALB/c mice | C. albicans | Gomesin [45] | Vaginal cream | |
ICR mice | C. albicans | HPRP-A1 [49] | Intravaginal solution | |
BALB/c mice | C. albicans | Novamycin [50] | Vaginal solution | |
Oropharyngeal candidiasis | ICR mice | C. albicans | MUC7 12-mer [51] | Emulsion on the oral cavity |
C57BL/6J mice 3 | C. albicans | CCL28 [52] | Oral gel | |
ICR mice | C. albicans | Lactoferricin B [53] | Oral solution | |
ICR mice | C. albicans | Protamine [54] | Oral solution | |
ICR mice 4 | C. albicans | HG1 [55] | Oral rinse | |
CD1 mice | C. albicans | Novamycin [50] | Topical emulsion | |
Cutaneous candidiasis | ICR mice | C. albicans | AP10W [56] | Topical solution |
CD-4 mice | C. albicans | Phibilin [57] | Subcutaneous injection | |
Kunming mice | C. albicans | GK-19 [58] | Topical | |
Urinary tract candidiasis | BALB/c mice | C. albicans | LL-37 [59] | Transurethral catheter |
Candidal meningitis | New Zealand white rabbits | C. albicans | CG3R6TAT [60] | Intravenous |
Candidal keratitis | C57BL/6 mice | C. albicans | C(LLKK)2C [61] | Eye drops |
C57BL/6 mice | C. albicans | (LLKK)3C [61] | Eye drops |
Family/Source | Name | Clinical Trial ID | Condition or Disease | Phase | Formulation |
---|---|---|---|---|---|
Cathelicidins | LL-37 | NCT04098562 NCT02225366 | Diabetic foot ulcer Melanoma | Phase 2 Phase 1 and 2 | Topical cream Intratumoral injection |
Omiganan | NCT00231153 | Catheter infections | Phase 3 | Topical gel around the catheter insertion site | |
Iseganan | NCT00118781 | Pneumonia | Phase 2 and 3 | Topical application to the oral cavity | |
Histatins and mucins | PAC113 | NCT00659971 | Oral candidiasis | Phase 2 | Mouth rinse |
From milk and colostrum | hLF1-11 | NCT00509834 | Candidaemia | Phase 1 and 2 | Intravenous bolus |
Talactoferrin | NCT01273779 | Severe sepsis | Phase 2 and 3 | Oral treatment | |
Other AMPs | XF-73 | NCT03915470 | Staphylococcal and surgical site infections | Phase 2 | Nasal gel |
WLBU2 | NCT05137314 | Joint infection | Phase 1 | Irrigation solution |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2023 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Rodríguez-Castaño, G.P.; Rosenau, F.; Ständker, L.; Firacative, C. Antimicrobial Peptides: Avant-Garde Antifungal Agents to Fight against Medically Important Candida Species. Pharmaceutics 2023, 15, 789. https://doi.org/10.3390/pharmaceutics15030789
Rodríguez-Castaño GP, Rosenau F, Ständker L, Firacative C. Antimicrobial Peptides: Avant-Garde Antifungal Agents to Fight against Medically Important Candida Species. Pharmaceutics. 2023; 15(3):789. https://doi.org/10.3390/pharmaceutics15030789
Chicago/Turabian StyleRodríguez-Castaño, Gina P., Frank Rosenau, Ludger Ständker, and Carolina Firacative. 2023. "Antimicrobial Peptides: Avant-Garde Antifungal Agents to Fight against Medically Important Candida Species" Pharmaceutics 15, no. 3: 789. https://doi.org/10.3390/pharmaceutics15030789