Assistance for Folding of Disease-Causing Plasma Membrane Proteins
Abstract
:1. Introduction
2. Membrane Proteins
Protein Biosynthesis
3. Membrane Protein Folding
3.1. Quality Control Systems for Membrane Protein Folding
3.2. Membrane Protein Modifications
3.3. Membrane Protein Expression and Stability
4. Physiological Consequences of Protein Misfolding
4.1. Effects on Membranes
4.2. Effect on Protein Structure and Assembly
5. Aid for Misfolded Proteins
5.1. Molecular Chaperones Associated with Plasma Membrane Protein Biogenesis
5.1.1. Hsp70
5.1.2. Hsp90
5.1.3. Co-Chaperones Cooperating in Membrane Protein Folding
5.2. Chemical Chaperones
5.3. Pharmacological Chaperones
6. Conclusions
Author Contributions
Funding
Acknowledgments
Conflicts of Interest
References
- Muro, E.; Atilla-Gokcumen, G.E.; Eggert, U.S. Lipids in cell biology: How can we understand them better? Mol. Biol. Cell 2014, 25, 1819–1823. [Google Scholar] [CrossRef] [PubMed]
- O’Brien, J.S. Cell membranes—Composition: Structure: Function. J. Theor. Biol. 1967, 15, 307–324. [Google Scholar] [CrossRef]
- Engelman, D.M. Membranes are more mosaic than fluid. Nature 2005, 438, 578–580. [Google Scholar] [CrossRef] [PubMed]
- Deisenhofer, J.; Epp, O.; Miki, K.; Huber, R.; Michel, H. Structure of the protein subunits in the photosynthetic reaction centre of Rhodopseudomonas viridis at 3Å resolution. Nature 1985, 318, 618–624. [Google Scholar] [CrossRef]
- Block, R.C.; Dorsey, E.R.; Beck, C.A.; Brenna, J.T.; Shoulson, I. Altered cholesterol and fatty acid metabolism in Huntington disease. J. Clin. Lipidol. 2010, 4, 17–23. [Google Scholar] [CrossRef] [Green Version]
- Di Paolo, G.; Kim, T.-W. Linking lipids to Alzheimer’s disease: Cholesterol and beyond. Nat. Rev. Neurosci. 2011, 12, 284–296. [Google Scholar] [CrossRef]
- Lee, S.; Zheng, H.; Shi, L.; Jiang, Q.-X. Reconstitution of a Kv channel into lipid membranes for structural and functional studies. J. Vis. Exp. 2013, e50436. [Google Scholar] [CrossRef] [Green Version]
- Jiang, Q.-X. Cholesterol-dependent gating effects on ion channels. Adv. Exp. Med. Biol. 2019, 1115, 167–190. [Google Scholar] [CrossRef]
- Finol-Urdaneta, R.K.; McArthur, J.R.; Juranka, P.F.; French, R.J.; Morris, C.E. Modulation of KvAP unitary conductance and gating by 1-alkanols and other surface active agents. Biophys. J. 2010, 98, 762–772. [Google Scholar] [CrossRef] [Green Version]
- Balijepalli, R.C.; Delisle, B.P.; Balijepalli, S.Y.; Foell, J.D.; Slind, J.K.; Kamp, T.J.; January, C.T. Kv11.1 (ERG1) K+ channels localize in cholesterol and sphingolipid enriched membranes and are modulated by membrane cholesterol. Channels 2007, 1, 263–272. [Google Scholar] [CrossRef] [Green Version]
- Abi-Char, J.; Maguy, A.; Coulombe, A.; Balse, E.; Ratajczak, P.; Samuel, J.-L.; Nattel, S.; Hatem, S.N. Membrane cholesterol modulates Kv1.5 potassium channel distribution and function in rat cardiomyocytes. J. Physiol. 2007, 582, 1205–1217. [Google Scholar] [CrossRef] [PubMed]
- Poveda, J.A.; Giudici, A.M.; Renart, M.L.; Millet, O.; Morales, A.; González-Ros, J.M.; Oakes, V.; Furini, S.; Domene, C. Modulation of the potassium channel KcsA by anionic phospholipids: Role of arginines at the non-annular lipid binding sites. Biochim. Biophys. Acta Biomembr. 2019, 1861, 183029. [Google Scholar] [CrossRef] [PubMed]
- Milescu, M.; Vobecky, J.; Roh, S.H.; Kim, S.H.; Jung, H.J.; Kim, J., II; Swartz, K.J. Tarantula toxins interact with voltage sensors within lipid membranes. J. Gen. Physiol. 2007, 130, 497–511. [Google Scholar] [CrossRef] [Green Version]
- Kim, R.Y.; Pless, S.A.; Kurata, H.T. PIP2 mediates functional coupling and pharmacology of neuronal KCNQ channels. Proc. Natl. Acad. Sci. USA 2017, 114, E9702–E9711. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Delgado-Ramírez, M.; López-Izquierdo, A.; Rodríguez-Menchaca, A.A. Dual regulation of hEAG1 channels by phosphatidylinositol 4,5-bisphosphate. Biochem. Biophys. Res. Commun. 2018, 503, 2531–2535. [Google Scholar] [CrossRef]
- Bissig, C.; Gruenberg, J. Lipid sorting and multivesicular endosome biogenesis. Cold Spring Harb. Perspect. Biol. 2013, 5, a016816. [Google Scholar] [CrossRef] [Green Version]
- Huang, C.-L. Complex roles of PIP2 in the regulation of ion channels and transporters. Am. J. Physiol. Renal Physiol. 2007, 293, F1761–F1765. [Google Scholar] [CrossRef] [Green Version]
- Thapa, N.; Sun, Y.; Schramp, M.; Choi, S.; Ling, K.; Anderson, R.A. Phosphoinositide signaling regulates the exocyst complex and polarized integrin trafficking in directionally migrating cells. Dev. Cell 2012, 22, 116–130. [Google Scholar] [CrossRef] [Green Version]
- Hernández-Araiza, I.; Morales-Lázaro, S.L.; Canul-Sánchez, J.A.; Islas, L.D.; Rosenbaum, T. Role of lysophosphatidic acid in ion channel function and disease. J. Neurophysiol. 2018, 120, 1198–1211. [Google Scholar] [CrossRef]
- Bukiya, A.N.; Dopico, A.M. Regulation of BK Channel activity by cholesterol and its derivatives. Adv. Exp. Med. Biol. 2019, 1115, 53–75. [Google Scholar] [CrossRef]
- Stevens, T.J.; Arkin, I.T. Do more complex organisms have a greater proportion of membrane proteins in their genomes? Proteins 2000, 39, 417–420. [Google Scholar] [CrossRef]
- von Heijne, G.; Gavel, Y. Topogenic signals in integral membrane proteins. Eur. J. Biochem. 1988, 174, 671–678. [Google Scholar] [CrossRef] [PubMed]
- Haynes, C.M.; Petrova, K.; Benedetti, C.; Yang, Y.; Ron, D. ClpP Mediates activation of a mitochondrial unfolded protein response in C. elegans. Dev. Cell 2007, 13, 467–480. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Ron, D.; Walter, P. Signal integration in the endoplasmic reticulum unfolded protein response. Nat. Rev. Mol. Cell Biol. 2007, 8, 519–529. [Google Scholar] [CrossRef]
- Sardiello, M.; Palmieri, M.; di Ronza, A.; Medina, D.L.; Valenza, M.; Gennarino, V.A.; Di Malta, C.; Donaudy, F.; Embrione, V.; Polishchuk, R.S.; et al. A gene network regulating lysosomal biogenesis and function. Science 2009, 325, 473–477. [Google Scholar] [CrossRef] [Green Version]
- Johnson, A.E.; van Waes, M.A. The Translocon: A Dynamic gateway at the ER membrane. Annu. Rev. Cell Dev. Biol. 1999, 15, 799–842. [Google Scholar] [CrossRef]
- Stefani, M.; Rigacci, S. Protein folding and aggregation into amyloid: The interference by natural phenolic compounds. Int. J. Mol. Sci. 2013, 14, 12411–12457. [Google Scholar] [CrossRef] [Green Version]
- Singer, S.J. The Structure and insertion of integral proteins in membranes. Annu. Rev. Cell Biol. 1990, 6, 247–296. [Google Scholar] [CrossRef]
- Sabatini, D.D.; Kreibich, G.; Morimoto, T.; Adesnik, M. Mechanisms for the incorporation of proteins in membranes and organelles. J. Cell Biol. 1982, 92, 1–22. [Google Scholar] [CrossRef] [Green Version]
- Blobel, G. Protein Targeting (Nobel Lecture). ChemBioChem 2000, 1, 86–102. [Google Scholar] [CrossRef]
- Peer, W.A. Plasma Membrane Protein Trafficking BT—The Plant Plasma Membrane; Murphy, A.S., Schulz, B., Peer, W., Eds.; Springer: Berlin/Heidelberg, Germany, 2011; pp. 31–56. ISBN 978-3-642-13431-9. [Google Scholar]
- Morozova, D.; Guigas, G.; Weiss, M. Dynamic structure formation of peripheral membrane proteins. PLoS Comput. Biol. 2011, 7, e1002067. [Google Scholar] [CrossRef] [PubMed]
- Hayer, A.; Stoeber, M.; Bissig, C.; Helenius, A. Biogenesis of caveolae: Stepwise assembly of large caveolin and cavin complexes. Traffic 2010, 11, 361–382. [Google Scholar] [CrossRef]
- Monier, S.; Dietzen, D.J.; Hastings, W.R.; Lublin, D.M.; Kurzchalia, T. V Oligomerization of VIP21-caveolin in vitro is stabilized by long chain fatty acylation or cholesterol. FEBS Lett. 1996, 388, 143–149. [Google Scholar] [CrossRef] [Green Version]
- Busija, A.R.; Patel, H.H.; Insel, P.A. Caveolins and cavins in the trafficking, maturation, and degradation of caveolae: Implications for cell physiology. Am. J. Physiol. Cell Physiol. 2017, 312, C459–C477. [Google Scholar] [CrossRef] [PubMed]
- Pestova, T.V.; Kolupaeva, V.G.; Lomakin, I.B.; Pilipenko, E.V.; Shatsky, I.N.; Agol, V.I.; Hellen, C.U. Molecular mechanisms of translation initiation in eukaryotes. Proc. Natl. Acad. Sci. USA 2001, 98, 7029–7036. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Hegde, R.S.; Keenan, R.J. Tail-anchored membrane protein insertion into the endoplasmic reticulum. Nat. Rev. Mol. Cell Biol. 2011, 12, 787–798. [Google Scholar] [CrossRef] [Green Version]
- Kapp, K.; Schrempf, S.; Lemberg, M.; Dobberstein, B. Post-targeting functions of signal peptides. In Protein Transport into the Endoplasmic Reticulum; Landes Bioscience: Austin, TX, USA, 2000. [Google Scholar]
- Liu, X.; Zheng, X.F.S. Endoplasmic reticulum and golgi localization sequences for mammalian target of rapamycin. Mol. Biol. Cell 2007, 18, 1073–1082. [Google Scholar] [CrossRef] [Green Version]
- Frangioni, J.V.; Beahm, P.H.; Shifrin, V.; Jost, C.A.; Neel, B.G. The nontransmembrane tyrosine phosphatase PTP-1B localizes to the endoplasmic reticulum via its 35 amino acid C-terminal sequence. Cell 1992, 68, 545–560. [Google Scholar] [CrossRef]
- Pottekat, A.; Menon, A.K. Subcellular localization and targeting of N-acetylglucosaminyl phosphatidylinositol de-N-acetylase, the second enzyme in the glycosylphosphatidylinositol biosynthetic pathway. J. Biol. Chem. 2004, 279, 15743–15751. [Google Scholar] [CrossRef] [Green Version]
- Ercan, E.; Momburg, F.; Engel, U.; Temmerman, K.; Nickel, W.; Seedorf, M. A conserved, lipid-mediated sorting mechanism of yeast Ist2 and mammalian STIM proteins to the peripheral ER. Traffic 2009, 10, 1802–1818. [Google Scholar] [CrossRef]
- Sun, Q.; Ju, T.; Cummings, R.D. The transmembrane domain of the molecular chaperone Cosmc directs its localization to the endoplasmic reticulum. J. Biol. Chem. 2011, 286, 11529–11542. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Haugsten, E.M.; Malecki, J.; Bjørklund, S.M.S.; Olsnes, S.; Wesche, J. Ubiquitination of fibroblast growth factor receptor 1 is required for its intracellular sorting but not for its endocytosis. Mol. Biol. Cell 2008, 19, 3390–3403. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Watanabe, K.; Nagaoka, T.; Strizzi, L.; Mancino, M.; Gonzales, M.; Bianco, C.; Salomon, D.S. Characterization of the glycosylphosphatidylinositol-anchor signal sequence of human Cryptic with a hydrophilic extension. Biochim. Biophys. Acta 2008, 1778, 2671–2681. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Lanza, F.; De La Salle, C.; Baas, M.-J.; Schwartz, A.; Boval, B.; Cazenave, J.-P.; Caen, J.P. A Leu7Pro mutation in the signal peptide of platelet glycoprotein (GP)IX in a case of Bernard-Soulier syndrome abolishes surface expression of the GPIb-V-IX complex. Br. J. Haematol. 2002, 118, 260–266. [Google Scholar] [CrossRef]
- Luo, W.; Marsh-Armstrong, N.; Rattner, A.; Nathans, J. An outer segment localization signal at the C terminus of the photoreceptor-specific retinol dehydrogenase. J. Neurosci. 2004, 24, 2623–2632. [Google Scholar] [CrossRef] [Green Version]
- Klapisz, E.; Ziari, M.; Wendum, D.; Koumanov, K.; Brachet-Ducos, C.; Olivier, J.L.; Béréziat, G.; Trugnan, G.; Masliah, J. N-terminal and C-terminal plasma membrane anchoring modulate differently agonist-induced activation of cytosolic phospholipase A2. Eur. J. Biochem. 1999, 265, 957–966. [Google Scholar] [CrossRef] [Green Version]
- Zlatkine, P.; Mehul, B.; Magee, A.I. Retargeting of cytosolic proteins to the plasma membrane by the Lck protein tyrosine kinase dual acylation motif. J. Cell Sci. 1997, 110 Pt 5, 673–679. [Google Scholar]
- Beau, I.; Groyer-Picard, M.-T.; Desroches, A.; Condamine, E.; Leprince, J.; Tomé, J.-P.; Dessen, P.; Vaudry, H.; Misrahi, M. The basolateral sorting signals of the thyrotropin and luteinizing hormone receptors: An unusual family of signals sharing an unusual distal intracellular localization, but unrelated in their structures. Mol. Endocrinol. 2004, 18, 733–746. [Google Scholar] [CrossRef] [Green Version]
- Nadler, L.S.; Kumar, G.; Nathanson, N.M. Identification of a basolateral sorting signal for the M3 muscarinic acetylcholine receptor in Madin-Darby canine kidney cells. J. Biol. Chem. 2001, 276, 10539–10547. [Google Scholar] [CrossRef] [Green Version]
- Iverson, H.A.; Fox, D., 3rd; Nadler, L.S.; Klevit, R.E.; Nathanson, N.M. Identification and structural determination of the M(3) muscarinic acetylcholine receptor basolateral sorting signal. J. Biol. Chem. 2005, 280, 24568–24575. [Google Scholar] [CrossRef] [Green Version]
- King, B.R.; Guda, C. ngLOC: An n-gram-based Bayesian method for estimating the subcellular proteomes of eukaryotes. Genome Biol. 2007, 8, R68. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Blobel, G. Intracellular protein topogenesis. Proc. Natl. Acad. Sci. USA 1980, 77, 1496–1500. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Balogh, I.; Maráz, A. Presence of STA gene sequences in brewer’s yeast genome. Lett. Appl. Microbiol. 2018, 22, 400–404. [Google Scholar] [CrossRef] [PubMed]
- Lamriben, L.; Graham, J.B.; Adams, B.M.; Hebert, D.N. N-Glycan-based ER molecular chaperone and protein quality control system: The calnexin binding cycle. Traffic 2016, 17, 308–326. [Google Scholar] [CrossRef] [Green Version]
- Saraogi, I.; Shan, S. Molecular mechanism of co-translational protein targeting by the signal recognition particle. Traffic 2011, 12, 535–542. [Google Scholar] [CrossRef] [Green Version]
- Reindl, M.; Hänsch, S.; Weidtkamp-Peters, S.; Schipper, K. A Potential lock-type mechanism for unconventional secretion in fungi. Int. J. Mol. Sci. 2019, 20, 460. [Google Scholar] [CrossRef] [Green Version]
- Chartron, J.W.; Gonzalez, G.M.; Clemons Jr, W.M. A structural model of the Sgt2 protein and its interactions with chaperones and the Get4/Get5 complex. J. Biol. Chem. 2011, 286, 34325–34334. [Google Scholar] [CrossRef] [Green Version]
- Grudnik, P.; Bange, G.; Sinning, I. Protein targeting by the signal recognition particle. Biol. Chem. 2009, 390, 775–782. [Google Scholar] [CrossRef]
- Keenan, R.J.; Freymann, D.M.; Stroud, R.M.; Walter, P. The signal recognition particle. Annu. Rev. Biochem. 2001, 70, 755–775. [Google Scholar] [CrossRef] [Green Version]
- Borgese, N.; Colombo, S.; Pedrazzini, E. The tale of tail-anchored proteins: Coming from the cytosol and looking for a membrane. J. Cell Biol. 2003, 161, 1013–1019. [Google Scholar] [CrossRef]
- Hartl, F.U.; Hayer-Hartl, M. Converging concepts of protein folding in vitro and in vivo. Nat. Struct. Mol. Biol. 2009, 16, 574. [Google Scholar] [CrossRef]
- Marzec, M.; Eletto, D.; Argon, Y. GRP94: An HSP90-like protein specialized for protein folding and quality control in the endoplasmic reticulum. Biochim. Biophys. Acta 2012, 1823, 774–787. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Tannous, A.; Pisoni, G.B.; Hebert, D.N.; Molinari, M. N-linked sugar-regulated protein folding and quality control in the ER. Semin. Cell Dev. Biol. 2015, 41, 79–89. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Simons, J.F.; Ferro-Novick, S.; Rose, M.D.; Helenius, A. BiP/Kar2p serves as a molecular chaperone during carboxypeptidase Y folding in yeast. J. Cell Biol. 1995, 130, 41–49. [Google Scholar] [CrossRef]
- Hurtley, S.M.; Bole, D.G.; Hoover-Litty, H.; Helenius, A.; Copeland, C.S. Interactions of misfolded influenza virus hemagglutinin with binding protein (BiP). J. Cell Biol. 1989, 108, 2117–2126. [Google Scholar] [CrossRef]
- Machamer, C.E.; Doms, R.W.; Bole, D.G.; Helenius, A.; Rose, J.K. Heavy chain binding protein recognizes incompletely disulfide-bonded forms of vesicular stomatitis virus G protein. J. Biol. Chem. 1990, 265, 6879–6883. [Google Scholar]
- Marquardt, T.; Helenius, A. Misfolding and aggregation of newly synthesized proteins in the endoplasmic reticulum. J. Cell Biol. 1992, 117, 505–513. [Google Scholar] [CrossRef] [Green Version]
- Singh, I.; Doms, R.W.; Wagner, K.R.; Helenius, A. Intracellular transport of soluble and membrane-bound glycoproteins: Folding, assembly and secretion of anchor-free influenza hemagglutinin. EMBO J. 1990, 9, 631–639. [Google Scholar] [CrossRef]
- Hammond, C.; Helenius, A. Quality control in the secretory pathway: Retention of a misfolded viral membrane glycoprotein involves cycling between the ER, intermediate compartment, and golgi apparatus. J. Cell Biol. 1994, 126, 41–52. [Google Scholar] [CrossRef]
- Pincus, D.; Chevalier, M.W.; Aragón, T.; van Anken, E.; Vidal, S.E.; El-Samad, H.; Walter, P. BiP binding to the ER-stress sensor Ire1 tunes the homeostatic behavior of the unfolded protein response. PLoS Biol. 2010, 8, e1000415. [Google Scholar] [CrossRef] [Green Version]
- Schönbrunner, E.R.; Schmid, F.X. Peptidyl-prolyl cis-trans isomerase improves the efficiency of protein disulfide isomerase as a catalyst of protein folding. Proc. Natl. Acad. Sci. USA 1992, 89, 4510–4513. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Cheng, H.N.; Bovey, F.A. Cis-Trans equilibrium and kinetic studies of acetyl-L-proline and glycyl-L-proline. Biopolymers 2018, 16, 1465–1472. [Google Scholar] [CrossRef] [PubMed]
- Horibe, T.; Yosho, C.; Okada, S.; Tsukamoto, M.; Nagai, H.; Hagiwara, Y.; Tujimoto, Y.; Kikuchi, M. The chaperone activity of protein disulfide isomerase is affected by cyclophilin B and cyclosporin a In vitro. J. Biochem. 2002, 132, 401–407. [Google Scholar] [CrossRef] [PubMed]
- Curran, J.; Mohler, P.J. Alternative paradigms for ion channelopathies: Disorders of ion channel membrane trafficking and posttranslational modification. Annu. Rev. Physiol. 2015, 77, 505–524. [Google Scholar] [CrossRef]
- Shao, S.; Hegde, R.S. Membrane protein insertion at the endoplasmic reticulum. Annu. Rev. Cell Dev. Biol. 2011, 27, 25–56. [Google Scholar] [CrossRef] [Green Version]
- Berner, N.; Reutter, K.-R.; Wolf, D.H. Protein quality control of the endoplasmic reticulum and ubiquitin-proteasome-triggered degradation of aberrant proteins: Yeast pioneers the path. Annu. Rev. Biochem. 2018, 87, 751–782. [Google Scholar] [CrossRef]
- Powers, E.T.; Morimoto, R.I.; Dillin, A.; Kelly, J.W.; Balch, W.E. Biological and chemical approaches to diseases of proteostasis deficiency. Annu. Rev. Biochem. 2009, 78, 959–991. [Google Scholar] [CrossRef] [Green Version]
- Labbadia, J.; Morimoto, R.I. The biology of proteostasis in aging and disease. Annu. Rev. Biochem. 2015, 84, 435–464. [Google Scholar] [CrossRef] [Green Version]
- Walker, L.C. Proteopathic strains and the heterogeneity of neurodegenerative diseases. Annu. Rev. Genet. 2016, 50, 329–346. [Google Scholar] [CrossRef]
- Aguzzi, A.; O’Connor, T. Protein aggregation diseases: Pathogenicity and therapeutic perspectives. Nat. Rev. Drug Discov. 2010, 9, 237. [Google Scholar] [CrossRef]
- Stefani, M.; Dobson, C.M. Protein aggregation and aggregate toxicity: New insights into protein folding, misfolding diseases and biological evolution. J. Mol. Med. 2003, 81, 678–699. [Google Scholar] [CrossRef] [PubMed]
- Walter, P.; Ron, D. The unfolded protein response: From stress pathway to homeostatic regulation. Science 2011, 334, 1081–1086. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Bravo, R.; Parra, V.; Gatica, D.; Rodriguez, A.E.; Torrealba, N.; Paredes, F.; Wang, Z.V.; Zorzano, A.; Hill, J.A.; Jaimovich, E.; et al. Endoplasmic reticulum and the unfolded protein response: Dynamics and metabolic integration. Int. Rev. Cell Mol. Biol. 2013, 301, 215–290. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Thibault, G.; Ismail, N.; Ng, D.T.W. The unfolded protein response supports cellular robustness as a broad-spectrum compensatory pathway. Proc. Natl. Acad. Sci. USA 2011, 108, 20597–20602. [Google Scholar] [CrossRef] [Green Version]
- Kopp, M.C.; Larburu, N.; Durairaj, V.; Adams, C.J.; Ali, M.M.U. UPR proteins IRE1 and PERK switch BiP from chaperone to ER stress sensor. Nat. Struct. Mol. Biol. 2019, 26, 1053–1062. [Google Scholar] [CrossRef] [PubMed]
- Nedelsky, N.B.; Todd, P.K.; Taylor, J.P. Autophagy and the ubiquitin-proteasome system: Collaborators in neuroprotection. Biochim. Biophys. Acta 2008, 1782, 691–699. [Google Scholar] [CrossRef] [Green Version]
- Smith, M.H.; Ploegh, H.L.; Weissman, J.S. Road to ruin: Targeting proteins for degradation in the endoplasmic reticulum. Science 2011, 334, 1086–1090. [Google Scholar] [CrossRef] [Green Version]
- Varshavsky, A. The ubiquitin system, an immense realm. Annu. Rev. Biochem. 2012, 81, 167–176. [Google Scholar] [CrossRef]
- Romine, I.C.; Wiseman, R.L. PERK Signaling regulates extracellular proteostasis of an amyloidogenic protein during endoplasmic reticulum stress. Sci. Rep. 2019, 9, 410. [Google Scholar] [CrossRef] [Green Version]
- Lu, P.D.; Harding, H.P.; Ron, D. Translation reinitiation at alternative open reading frames regulates gene expression in an integrated stress response. J. Cell Biol. 2004, 167, 27–33. [Google Scholar] [CrossRef]
- Walter, F.; O’Brien, A.; Concannon, C.G.; Düssmann, H.; Prehn, J.H.M. ER stress signaling has an activating transcription factor 6α (ATF6)-dependent “off-switch”. J. Biol. Chem. 2018, 293, 18270–18284. [Google Scholar] [CrossRef] [Green Version]
- Lee, K.; Tirasophon, W.; Shen, X.; Michalak, M.; Prywes, R.; Okada, T.; Yoshida, H.; Mori, K.; Kaufman, R.J. IRE1-mediated unconventional mRNA splicing and S2P-mediated ATF6 cleavage merge to regulate XBP1 in signaling the unfolded protein response. Genes Dev. 2002, 16, 452–466. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Nishikawa, S.I.; Fewell, S.W.; Kato, Y.; Brodsky, J.L.; Endo, T. Molecular chaperones in the yeast endoplasmic reticulum maintain the solubility of proteins for retrotranslocation and degradation. J. Cell Biol. 2001, 153, 1061–1070. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Elsasser, S.; Finley, D. Delivery of ubiquitinated substrates to protein-unfolding machines. Nat. Cell Biol. 2005, 7, 742–749. [Google Scholar] [CrossRef] [PubMed]
- Jakob, C.A.; Burda, P.; Roth, J.; Aebi, M. Degradation of misfolded endoplasmic reticulum glycoproteins in Saccharomyces cerevisiae is determined by a specific oligosaccharide structure. J. Cell Biol. 1998, 142, 1223–1233. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Sato, S.; Ward, C.L.; Krouse, M.E.; Wine, J.J.; Kopito, R.R. Glycerol reverses the misfolding phenotype of the most common cystic fibrosis mutation. J. Biol. Chem. 1996, 271, 635–638. [Google Scholar] [CrossRef] [Green Version]
- Wilkinson, S. ER-phagy: Shaping up and destressing the endoplasmic reticulum. FEBS J. 2019, 286, 2645–2663. [Google Scholar] [CrossRef] [Green Version]
- Jain, B.P. An overview of unfolded protein response signaling and its role in cancer. Cancer Biother. Radiopharm. 2017, 32, 275–281. [Google Scholar] [CrossRef]
- Kaushik, S.; Cuervo, A.M. Chaperone-mediated autophagy: A unique way to enter the lysosome world. Trends Cell Biol. 2012, 22, 407–417. [Google Scholar] [CrossRef] [Green Version]
- Fu, S.; Watkins, S.M.; Hotamisligil, G.S. The role of endoplasmic reticulum in hepatic lipid homeostasis and stress signaling. Cell Metab. 2012, 15, 623–634. [Google Scholar] [CrossRef] [Green Version]
- Garg, A.D.; Kaczmarek, A.; Krysko, O.; Vandenabeele, P.; Krysko, D.V.; Agostinis, P. ER stress-induced inflammation: Does it aid or impede disease progression? Trends Mol. Med. 2012, 18, 589–598. [Google Scholar] [CrossRef] [PubMed]
- Li, H.; Korennykh, A.V.; Behrman, S.L.; Walter, P. Mammalian endoplasmic reticulum stress sensor IRE1 signals by dynamic clustering. Proc. Natl. Acad. Sci. USA 2010, 107, 16113–16118. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Urano, F.; Wang, X.; Bertolotti, A.; Zhang, Y.; Chung, P.; Harding, H.P.; Ron, D. Coupling of stress in the ER to activation of JNK protein kinases by transmembrane protein kinase IRE1. Science 2000, 287, 664. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Valencia-Sanchez, M.A.; Liu, J.; Hannon, G.J.; Parker, R. Control of translation and mRNA degradation by miRNAs and siRNAs. Genes Dev. 2006, 20, 515–524. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Hara, T.; Hashimoto, Y.; Akuzawa, T.; Hirai, R.; Kobayashi, H.; Sato, K. Rer1 and calnexin regulate endoplasmic reticulum retention of a peripheral myelin protein 22 mutant that causes type 1A Charcot-Marie-Tooth disease. Sci. Rep. 2014, 4, 6992. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Briant, K.; Johnson, N.; Swanton, E. Transmembrane domain quality control systems operate at the endoplasmic reticulum and Golgi apparatus. PLoS ONE 2017, 12, e0173924. [Google Scholar] [CrossRef]
- Okiyoneda, T.; Veit, G.; Sakai, R.; Aki, M.; Fujihara, T.; Higashi, M.; Susuki-Miyata, S.; Miyata, M.; Fukuda, N.; Yoshida, A.; et al. Chaperone-independent peripheral quality control of CFTR by RFFL E3 Ligase. Dev. Cell 2018, 44, 694–708.e7. [Google Scholar] [CrossRef] [Green Version]
- Tzivoni, D.; Gavish, A.; Zin, D.; Gottlieb, S.; Moriel, M.; Keren, A.; Banai, S.; Stern, S. Prognostic significance of ischemic episodes in patients with previous myocardial infarction. Am. J. Cardiol. 1988, 62, 661–664. [Google Scholar] [CrossRef]
- Fath, S.; Mancias, J.D.; Bi, X.; Goldberg, J. Structure and organization of coat proteins in the COPII cage. Cell 2007, 129, 1325–1336. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Li, J.; Ahat, E.; Wang, Y. Golgi structure and function in health, stress, and diseases. Results Probl. Cell Differ. 2019, 67, 441–485. [Google Scholar] [CrossRef]
- McCaughey, J.; Stephens, D.J. COPII-dependent ER export in animal cells: Adaptation and control for diverse cargo. Histochem. Cell Biol. 2018, 150, 119–131. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Huotari, J.; Helenius, A. Endosome maturation. EMBO J. 2011, 30, 3481–3500. [Google Scholar] [CrossRef] [PubMed]
- Cocucci, E.; Meldolesi, J. Ectosomes and exosomes: Shedding the confusion between extracellular vesicles. Trends Cell Biol. 2015, 25, 364–372. [Google Scholar] [CrossRef] [PubMed]
- Pegtel, D.M.; Cosmopoulos, K.; Thorley-Lawson, D.A.; van Eijndhoven, M.A.J.; Hopmans, E.S.; Lindenberg, J.L.; de Gruijl, T.D.; Würdinger, T.; Middeldorp, J.M. Functional delivery of viral miRNAs via exosomes. Proc. Natl. Acad. Sci. USA 2010, 107, 6328–6333. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Valadi, H.; Ekström, K.; Bossios, A.; Sjöstrand, M.; Lee, J.J.; Lötvall, J.O. Exosome-mediated transfer of mRNAs and microRNAs is a novel mechanism of genetic exchange between cells. Nat. Cell Biol. 2007, 9, 654–659. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Takeuchi, T.; Suzuki, M.; Fujikake, N.; Popiel, H.A.; Kikuchi, H.; Futaki, S.; Wada, K.; Nagai, Y. Intercellular chaperone transmission via exosomes contributes to maintenance of protein homeostasis at the organismal level. Proc. Natl. Acad. Sci. USA 2015, 112, E2497–E2506. [Google Scholar] [CrossRef] [Green Version]
- Li, X.; Corbett, A.L.; Taatizadeh, E.; Tasnim, N.; Little, J.P.; Garnis, C.; Daugaard, M.; Guns, E.; Hoorfar, M.; Li, I.T.S. Challenges and opportunities in exosome research-Perspectives from biology, engineering, and cancer therapy. APL Bioeng. 2019, 3, 11503. [Google Scholar] [CrossRef] [Green Version]
- Ma, D.; Zerangue, N.; Lin, Y.-F.; Collins, A.; Yu, M.; Jan, Y.N.; Jan, L.Y. Role of ER export signals in controlling surface potassium channel numbers. Science 2001, 291, 316–319. [Google Scholar] [CrossRef] [PubMed]
- Petrecca, K.; Atanasiu, R.; Akhavan, A.; Shrier, A. N-linked glycosylation sites determine HERG channel surface membrane expression. J. Physiol. 1999, 515 Pt 1, 41–48. [Google Scholar] [CrossRef]
- Watanabe, I.; Wang, H.-G.; Sutachan, J.J.; Zhu, J.; Recio-Pinto, E.; Thornhill, W.B. Glycosylation affects rat Kv1.1 potassium channel gating by a combined surface potential and cooperative subunit interaction mechanism. J. Physiol. 2003, 550, 51–66. [Google Scholar] [CrossRef]
- Lopez-Rodriguez, A.; Holmgren, M. Restoration of proper trafficking to the cell surface for membrane proteins harboring cysteine mutations. PLoS ONE 2012, 7, e47693. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Misonou, H.; Mohapatra, D.P.; Park, E.W.; Leung, V.; Zhen, D.; Misonou, K.; Anderson, A.E.; Trimmer, J.S. Regulation of ion channel localization and phosphorylation by neuronal activity. Nat. Neurosci. 2004, 7, 711–718. [Google Scholar] [CrossRef] [PubMed]
- Carneiro, A.M.; Ingram, S.L.; Beaulieu, J.-M.; Sweeney, A.; Amara, S.G.; Thomas, S.M.; Caron, M.G.; Torres, G.E. The multiple LIM domain-containing adaptor protein Hic-5 synaptically colocalizes and interacts with the dopamine transporter. J. Neurosci. 2002, 22, 7045–7054. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Carneiro, A.M.D.; Blakely, R.D. Serotonin-, protein kinase C-, and Hic-5-associated redistribution of the platelet serotonin transporter. J. Biol. Chem. 2006, 281, 24769–24780. [Google Scholar] [CrossRef] [Green Version]
- Offringa, R.; Huang, F. Phosphorylation-dependent trafficking of plasma membrane proteins in animal and plant cells. J. Integr. Plant Biol. 2013, 55, 789–808. [Google Scholar] [CrossRef]
- Martínez-Mármol, R.; Comes, N.; Styrczewska, K.; Pérez-Verdaguer, M.; Vicente, R.; Pujadas, L.; Soriano, E.; Sorkin, A.; Felipe, A. Unconventional EGF-induced ERK1/2-mediated Kv1.3 endocytosis. Cell. Mol. Life Sci. 2016, 73, 1515–1528. [Google Scholar] [CrossRef] [Green Version]
- Wang, Y.; Yang, J.; Yi, J. Redox sensing by proteins: Oxidative modifications on cysteines and the consequent events. Antioxid. Redox Signal. 2012, 16, 649–657. [Google Scholar] [CrossRef]
- Bindoli, A.; Fukuto, J.M.; Forman, H.J. Thiol chemistry in peroxidase catalysis and redox signaling. Antioxid. Redox Signal. 2008, 10, 1549–1564. [Google Scholar] [CrossRef]
- Bogeski, I.; Niemeyer, B.A. Redox regulation of ion channels. Antioxid. Redox Signal. 2014, 21, 859–862. [Google Scholar] [CrossRef] [Green Version]
- Chen, B.; Sun, Y.; Niu, J.; Jarugumilli, G.K.; Wu, X. Protein lipidation in cell signaling and diseases: Function, regulation, and therapeutic opportunities. Cell Chem. Biol. 2018, 25, 817–831. [Google Scholar] [CrossRef] [Green Version]
- Jeffries, O.; Geiger, N.; Rowe, I.C.M.; Tian, L.; McClafferty, H.; Chen, L.; Bi, D.; Knaus, H.G.; Ruth, P.; Shipston, M.J. Palmitoylation of the S0-S1 linker regulates cell surface expression of voltage- and calcium-activated potassium (BK) channels. J. Biol. Chem. 2010, 285, 33307–33314. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Tian, L.; McClafferty, H.; Knaus, H.-G.; Ruth, P.; Shipston, M.J. Distinct acyl protein transferases and thioesterases control surface expression of calcium-activated potassium channels. J. Biol. Chem. 2012, 287, 14718–14725. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Alioua, A.; Li, M.; Wu, Y.; Stefani, E.; Toro, L. Unconventional myristoylation of large-conductance Ca2+-activated K+ channel (Slo1) via serine/threonine residues regulates channel surface expression. Proc. Natl. Acad. Sci. USA 2011, 108, 10744–10749. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Mizushima, N.; Komatsu, M. Autophagy: Renovation of cells and tissues. Cell 2011, 147, 728–741. [Google Scholar] [CrossRef] [Green Version]
- Johansen, T.; Lamark, T. Selective autophagy: ATG8 family proteins, LIR motifs and cargo receptors. J. Mol. Biol. 2020, 432, 80–103. [Google Scholar] [CrossRef]
- Popovic, D.; Vucic, D.; Dikic, I. Ubiquitination in disease pathogenesis and treatment. Nat. Med. 2014, 20, 1242–1253. [Google Scholar] [CrossRef]
- Herskowitz, I. Functional inactivation of genes by dominant negative mutations. Nature 1987, 329, 219–222. [Google Scholar] [CrossRef]
- Fornace, A.J., Jr.; Nebert, D.W.; Hollander, M.C.; Luethy, J.D.; Papathanasiou, M.; Fargnoli, J.; Holbrook, N.J. Mammalian genes coordinately regulated by growth arrest signals and DNA-damaging agents. Mol. Cell. Biol. 1989, 9, 4196–4203. [Google Scholar] [CrossRef] [Green Version]
- Schmitt-Ney, M.; Habener, J.F. CHOP/GADD153 gene expression response to cellular stresses inhibited by prior exposure to ultraviolet light wavelength band C (UVC). Inhibitory sequence mediating the UVC response localized to exon 1. J. Biol. Chem. 2000, 275, 40839–40845. [Google Scholar] [CrossRef] [Green Version]
- Spear, E.; Ng, D.T. The unfolded protein response: No longer just a special teams player. Traffic 2001, 2, 515–523. [Google Scholar] [CrossRef]
- Vembar, S.S.; Brodsky, J.L. One step at a time: Endoplasmic reticulum-associated degradation. Nat. Rev. Mol. Cell Biol. 2008, 9, 944–957. [Google Scholar] [CrossRef] [PubMed]
- Marciniak, S.J.; Ron, D. Endoplasmic reticulum stress signaling in disease. Physiol. Rev. 2006, 86, 1133–1149. [Google Scholar] [CrossRef] [PubMed]
- Uehara, T.; Nakamura, T.; Yao, D.; Shi, Z.-Q.; Gu, Z.; Ma, Y.; Masliah, E.; Nomura, Y.; Lipton, S.A. S-Nitrosylated protein-disulphide isomerase links protein misfolding to neurodegeneration. Nature 2006, 441, 513. [Google Scholar] [CrossRef] [PubMed]
- Zhang, K.; Kaufman, R.J. The unfolded protein response. A stress signaling pathway critical for health and disease. Neurology 2006, 66, S102–S109. [Google Scholar] [CrossRef]
- Otsu, M.; Sitia, R. Diseases originating from altered protein quality control in the endoplasmic reticulum. Curr. Med. Chem. 2007, 14, 1639–1652. [Google Scholar] [CrossRef]
- Valastyan, J.S.; Lindquist, S. Mechanisms of protein-folding diseases at a glance. Dis. Model. Mech. 2014, 7, 9–14. [Google Scholar] [CrossRef] [Green Version]
- Foufelle, F.; Ferré, P. Unfolded protein response: Its role in physiology and physiopathology TT - La réponse UPR: Son rôle physiologique et physiopathologique. Med. Sci. 2007, 23, 291–296. [Google Scholar] [CrossRef]
- Menzies, F.M.; Moreau, K.; Rubinsztein, D.C. Protein misfolding disorders and macroautophagy. Curr. Opin. Cell Biol. 2011, 23, 190–197. [Google Scholar] [CrossRef] [Green Version]
- Wang, S.; Kaufman, R.J. The impact of the unfolded protein response on human disease. J. Cell Biol. 2012, 197, 857–867. [Google Scholar] [CrossRef] [Green Version]
- Anfinsen, C.B. Principles that govern the folding of protein chains. Science 1973, 181, 223–230. [Google Scholar] [CrossRef] [Green Version]
- Lee, C.; Ham, S. Characterizing amyloid-beta protein misfolding from molecular dynamics simulations with explicit water. J. Comput. Chem. 2011, 32, 349–355. [Google Scholar] [CrossRef]
- Huber, R.; Carrell, R.W. Implications of the three-dimensional structure of alpha 1-antitrypsin for structure and function of serpins. Biochemistry 1989, 28, 8951–8966. [Google Scholar] [CrossRef] [PubMed]
- Carr, C.M.; Chaudhry, C.; Kim, P.S. Influenza hemagglutinin is spring-loaded by a metastable native conformation. Proc. Natl. Acad. Sci. USA 1997, 94, 14306–14313. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Bullough, P.A.; Hughson, F.M.; Skehel, J.J.; Wiley, D.C. Structure of influenza haemagglutinin at the pH of membrane fusion. Nature 1994, 371, 37–43. [Google Scholar] [CrossRef]
- Orosz, A.; Wisniewski, J.; Wu, C. Regulation of Drosophila heat shock factor trimerization: Global sequence requirements and independence of nuclear localization. Mol. Cell. Biol. 1996, 16, 7018–7030. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Hipp, M.S.; Park, S.-H.; Hartl, F.U. Proteostasis impairment in protein-misfolding and -aggregation diseases. Trends Cell Biol. 2014, 24, 506–514. [Google Scholar] [CrossRef]
- Siddiqui, M.H.; Al-Khaishany, M.Y.; Al-Qutami, M.A.; Al-Whaibi, M.H.; Grover, A.; Ali, H.M.; Al-Wahibi, M.S. Morphological and physiological characterization of different genotypes of faba bean under heat stress. Saudi J. Biol. Sci. 2015, 22, 656–663. [Google Scholar] [CrossRef] [Green Version]
- Currais, A.; Fischer, W.; Maher, P.; Schubert, D. Intraneuronal protein aggregation as a trigger for inflammation and neurodegeneration in the aging brain. FASEB J. 2017, 31, 5–10. [Google Scholar] [CrossRef] [Green Version]
- Tuite, M.F.; Melki, R. Protein misfolding and aggregation in ageing and disease: Molecular processes and therapeutic perspectives. Prion 2007, 1, 116–120. [Google Scholar] [CrossRef] [Green Version]
- Dowhan, W. Molecular basis for membrane phospholipid diversity: Why are there so many lipids? Annu. Rev. Biochem. 1997, 66, 199–232. [Google Scholar] [CrossRef] [Green Version]
- Sanders, C.R.; Nagy, J.K. Misfolding of membrane proteins in health and disease: The lady or the tiger? Curr. Opin. Struct. Biol. 2000, 10, 438–442. [Google Scholar] [CrossRef]
- Sarnataro, D.; Campana, V.; Paladino, S.; Stornaiuolo, M.; Nitsch, L.; Zurzolo, C. PrP(C) association with lipid rafts in the early secretory pathway stabilizes its cellular conformation. Mol. Biol. Cell 2004, 15, 4031–4042. [Google Scholar] [CrossRef] [Green Version]
- Campana, V.; Sarnataro, D.; Fasano, C.; Casanova, P.; Paladino, S.; Zurzolo, C. Detergent-resistant membrane domains but not the proteasome are involved in the misfolding of a PrP mutant retained in the endoplasmic reticulum. J. Cell Sci. 2006, 119, 433–442. [Google Scholar] [CrossRef] [Green Version]
- Wieland, F.T.; Gleason, M.L.; Serafini, T.A.; Rothman, J.E. The rate of bulk flow from the endoplasmic reticulum to the cell surface. Cell 1987, 50, 289–300. [Google Scholar] [CrossRef]
- Mizuno, M.; Singer, S.J. A soluble secretory protein is first concentrated in the endoplasmic reticulum before transfer to the Golgi apparatus. Proc. Natl. Acad. Sci. USA 1993, 90, 5732–5736. [Google Scholar] [CrossRef] [Green Version]
- Nishimura, N.; Balch, W.E. A di-acidic signal required for selective export from the endoplasmic reticulum. Science 1997, 277, 556–558. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Martínez-Menárguez, J.A.; Geuze, H.J.; Slot, J.W.; Klumperman, J. Vesicular tubular clusters between the ER and Golgi mediate concentration of soluble secretory proteins by exclusion from COPI-coated vesicles. Cell 1999, 98, 81–90. [Google Scholar] [CrossRef] [Green Version]
- Bowie, J.U. Solving the membrane protein folding problem. Nature 2005, 438, 581–589. [Google Scholar] [CrossRef]
- Powl, A.M.; East, J.M.; Lee, A.G. Lipid−protein interactions studied by introduction of a tryptophan residue: the mechanosensitive channel MscL. Biochemistry 2003, 42, 14306–14317. [Google Scholar] [CrossRef]
- Hong, H. Role of lipids in folding, misfolding and function of integral membrane proteins. Adv. Exp. Med. Biol. 2015, 855, 1–31. [Google Scholar] [CrossRef]
- Soto, C.; Pritzkow, S. Protein misfolding, aggregation, and conformational strains in neurodegenerative diseases. Nat. Neurosci. 2018, 21, 1332–1340. [Google Scholar] [CrossRef] [PubMed]
- Marsh, J.A.; Hernández, H.; Hall, Z.; Ahnert, S.E.; Perica, T.; Robinson, C.V.; Teichmann, S.A. Protein complexes are under evolutionary selection to assemble via ordered pathways. Cell 2013, 153, 461–470. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Ng, D.P.; Poulsen, B.E.; Deber, C.M. Membrane protein misassembly in disease. Biochim. Biophys. Acta 2012, 1818, 1115–1122. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Braverman, N.E.; D’Agostino, M.D.; Maclean, G.E. Peroxisome biogenesis disorders: Biological, clinical and pathophysiological perspectives. Dev. Disabil. Res. Rev. 2013, 17, 187–196. [Google Scholar] [CrossRef]
- Farré, J.-C.; Mahalingam, S.S.; Proietto, M.; Subramani, S. Peroxisome biogenesis, membrane contact sites, and quality control. EMBO Rep. 2019, 20, e46864. [Google Scholar] [CrossRef]
- Chu, C.Y.; King, J.; Berrini, M.; Rumley, A.C.; Apaja, P.M.; Lukacs, G.L.; Alexander, R.T.; Cordat, E. Degradation mechanism of a Golgi-retained distal renal tubular acidosis mutant of the kidney anion exchanger 1 in renal cells. Am. J. Physiol. Cell Physiol. 2014, 307, C296–C307. [Google Scholar] [CrossRef] [Green Version]
- Cordat, E.; Kittanakom, S.; Yenchitsomanus, P.-T.; Li, J.; Du, K.; Lukacs, G.L.; Reithmeier, R.A.F. Dominant and recessive distal renal tubular acidosis mutations of kidney anion exchanger 1 induce distinct trafficking defects in MDCK cells. Traffic 2006, 7, 117–128. [Google Scholar] [CrossRef]
- Kopito, R.R.; Sitia, R. Aggresomes and Russell bodies. Symptoms of cellular indigestion? EMBO Rep. 2000, 1, 225–231. [Google Scholar] [CrossRef] [Green Version]
- Ruan, L.; Zhou, C.; Jin, E.; Kucharavy, A.; Zhang, Y.; Wen, Z.; Florens, L.; Li, R. Cytosolic proteostasis through importing of misfolded proteins into mitochondria. Nature 2017, 543, 443–446. [Google Scholar] [CrossRef]
- Leidenheimer, N.J. Cognate ligand chaperoning: A novel mechanism for the post-translational regulation of neurotransmitter receptor biogenesis. Front. Cell. Neurosci. 2017, 11, 245. [Google Scholar] [CrossRef] [Green Version]
- Sipe, J.D.; Benson, M.D.; Buxbaum, J.N.; Ikeda, S.-I.; Merlini, G.; Saraiva, M.J.M.; Westermark, P. Amyloid fibril proteins and amyloidosis: Chemical identification and clinical classification International Society of Amyloidosis 2016 Nomenclature Guidelines. Amyloid 2016, 23, 209–213. [Google Scholar] [CrossRef] [PubMed]
- de Coninck, D.; Schmidt, T.H.; Schloetel, J.-G.; Lang, T. Packing density of the amyloid precursor protein in the cell membrane. Biophys. J. 2018, 114, 1128–1141. [Google Scholar] [CrossRef] [PubMed]
- Fabiani, C.; Antollini, S.S. Alzheimer’s disease as a membrane disorder: Spatial cross-talk among beta-amyloid peptides, nicotinic acetylcholine receptors and lipid rafts. Front. Cell. Neurosci. 2019, 13, 309. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Kollmer, M.; Meinhardt, K.; Haupt, C.; Liberta, F.; Wulff, M.; Linder, J.; Handl, L.; Heinrich, L.; Loos, C.; Schmidt, M.; et al. Electron tomography reveals the fibril structure and lipid interactions in amyloid deposits. Proc. Natl. Acad. Sci. USA 2016, 113, 5604–5609. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Glover, J.R.; Lindquist, S. Hsp104, Hsp70, and Hsp40: A novel chaperone system that rescues previously aggregated proteins. Cell 1998, 94, 73–82. [Google Scholar] [CrossRef] [Green Version]
- Mas, G.; Hiller, S. Conformational plasticity of molecular chaperones involved in periplasmic and outer membrane protein folding. FEMS Microbiol. Lett. 2018, 365, fny121. [Google Scholar] [CrossRef]
- Hartl, F.U.; Bracher, A.; Hayer-Hartl, M. Molecular chaperones in protein folding and proteostasis. Nature 2011, 475, 324. [Google Scholar] [CrossRef]
- Hou, Z.-S.; Ulloa-Aguirre, A.; Tao, Y.-X. Pharmacoperone drugs: Targeting misfolded proteins causing lysosomal storage-, ion channels-, and G protein-coupled receptors-associated conformational disorders. Expert Rev. Clin. Pharmacol. 2018, 11, 611–624. [Google Scholar] [CrossRef]
- Laskey, R.A.; Honda, B.M.; Mills, A.D.; Finch, J.T. Nucleosomes are assembled by an acidic protein which binds histones and transfers them to DNA. Nature 1978, 275, 416. [Google Scholar] [CrossRef]
- Wayne, N.; Mishra, P.; Bolon, D.N. Hsp90 and client protein maturation. Methods Mol. Biol. 2011, 787, 33–44. [Google Scholar] [CrossRef] [Green Version]
- Frydman, J.; Nimmesgern, E.; Ohtsuka, K.; Hartl, F.U. Folding of nascent polypeptide chains in a high molecular mass assembly with molecular chaperones. Nature 1994, 370, 111–117. [Google Scholar] [CrossRef]
- Ellis, R.J.; Hemmingsen, S.M. Molecular chaperones: Proteins essential for the biogenesis of some macromolecular structures. Trends Biochem. Sci. 1989, 14, 339–342. [Google Scholar] [CrossRef]
- Jacob, P.; Hirt, H.; Bendahmane, A. The heat-shock protein/chaperone network and multiple stress resistance. Plant Biotechnol. J. 2017, 15, 405–414. [Google Scholar] [CrossRef] [PubMed]
- Cortez, L.; Sim, V. The therapeutic potential of chemical chaperones in protein folding diseases. Prion 2014, 8, 197–202. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Morello, J.P.; Salahpour, A.; Laperrière, A.; Bernier, V.; Arthus, M.F.; Lonergan, M.; Petäjä-Repo, U.; Angers, S.; Morin, D.; Bichet, D.G.; et al. Pharmacological chaperones rescue cell-surface expression and function of misfolded V2 vasopressin receptor mutants. J. Clin. Investig. 2000, 105, 887–895. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- He, L.; Hiller, S. Frustrated interfaces facilitate dynamic interactions between native client proteins and holdase chaperones. Chembiochem 2019, 20, 2803–2806. [Google Scholar] [CrossRef]
- Akerfelt, M.; Morimoto, R.; Sistonen, L. Heat shock factors: Integrators of cell stress, development and lifespan. Nat. Rev. Mol. Cell Biol. 2010, 11, 545–555. [Google Scholar] [CrossRef]
- Hoffmann, J.H.; Linke, K.; Graf, P.C.F.; Lilie, H.; Jakob, U. Identification of a redox-regulated chaperone network. EMBO J. 2004, 23, 160–168. [Google Scholar] [CrossRef] [Green Version]
- Mattoo, R.U.H.; Goloubinoff, P. Molecular chaperones are nanomachines that catalytically unfold misfolded and alternatively folded proteins. Cell. Mol. Life Sci. 2014, 71, 3311–3325. [Google Scholar] [CrossRef] [Green Version]
- Kaiser, C.M.; Chang, H.C.; Agashe, V.R.; Lakshmipathy, S.K.; Etchells, S.A.; Hayer-Hartl, M.; Hartl, F.U.; Barral, J.M. Real-time observation of trigger factor function on translating ribosomes. Nature 2006, 444, 455–460. [Google Scholar] [CrossRef] [PubMed]
- Dobson, C.M. Principles of protein folding, misfolding and aggregation. Semin. Cell Dev. Biol. 2004, 15, 3–16. [Google Scholar] [CrossRef] [PubMed]
- Taipale, M.; Krykbaeva, I.; Koeva, M.; Kayatekin, C.; Westover, K.D.; Karras, G.I.; Lindquist, S. Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition. Cell 2012, 150, 987–1001. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Vannimenus, J.; Toulouse, G. Theory of the frustration effect. II. Ising spins on a square lattice. J. Phys. C Solid State Phys. 1977, 10, L537–L542. [Google Scholar] [CrossRef]
- Ferreiro, D.U.; Komives, E.A.; Wolynes, P.G. Frustration, function and folding. Curr. Opin. Struct. Biol. 2018, 48, 68–73. [Google Scholar] [CrossRef] [PubMed]
- He, L.; Sharpe, T.; Mazur, A.; Hiller, S. A molecular mechanism of chaperone-client recognition. Sci. Adv. 2016, 2, e1601625. [Google Scholar] [CrossRef] [Green Version]
- Wälti, M.A.; Libich, D.S.; Clore, G.M. Extensive sampling of the cavity of the GroEL nanomachine by protein substrates probed by paramagnetic relaxation enhancement. J. Phys. Chem. Lett. 2018, 9, 3368–3371. [Google Scholar] [CrossRef]
- Gething, M.-J.; Sambrook, J. Protein folding in the cell. Nature 1992, 357, 57–59. [Google Scholar] [CrossRef]
- Mayer, M.P.; Bukau, B. Hsp70 chaperones: Cellular functions and molecular mechanism. Cell. Mol. Life Sci. 2005, 62, 670–684. [Google Scholar] [CrossRef] [Green Version]
- Radons, J. The human HSP70 family of chaperones: Where do we stand? Cell Stress Chaperones 2016, 21, 379–404. [Google Scholar] [CrossRef] [Green Version]
- Kampinga, H.H.; Craig, E.A. The HSP70 chaperone machinery: J proteins as drivers of functional specificity. Nat. Rev. Mol. Cell Biol. 2010, 11, 579–592. [Google Scholar] [CrossRef] [Green Version]
- Sanguinetti, M.C.; Tristani-Firouzi, M. hERG potassium channels and cardiac arrhythmia. Nature 2006, 440, 463–469. [Google Scholar] [CrossRef] [PubMed]
- Goldberg, A.L. Protein degradation and protection against misfolded or damaged proteins. Nature 2003, 426, 895–899. [Google Scholar] [CrossRef] [PubMed]
- Hirota, Y.; Kurata, Y.; Kato, M.; Notsu, T.; Koshida, S.; Inoue, T.; Kawata, Y.; Miake, J.; Bahrudin, U.; Li, P.; et al. Functional stabilization of Kv1.5 protein by Hsp70 in mammalian cell lines. Biochem. Biophys. Res. Commun. 2008, 372, 469–474. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Choo-Kang, L.R.; Zeitlin, P.L. Induction of HSP70 promotes DeltaF508 CFTR trafficking. Am. J. Physiol. Lung Cell. Mol. Physiol. 2001, 281, L58–L68. [Google Scholar] [CrossRef]
- Farinha, C.M.; Nogueira, P.; Mendes, F.; Penque, D.; Amaral, M.D. The human DnaJ homologue (Hdj)-1/heat-shock protein (Hsp) 40 co-chaperone is required for the in vivo stabilization of the cystic fibrosis transmembrane conductance regulator by Hsp70. Biochem. J. 2002, 366, 797–806. [Google Scholar] [CrossRef] [Green Version]
- Meacham, G.C.; Lu, Z.; King, S.; Sorscher, E.; Tousson, A.; Cyr, D.M. The Hdj-2/Hsc70 chaperone pair facilitates early steps in CFTR biogenesis. EMBO J. 1999, 18, 1492–1505. [Google Scholar] [CrossRef]
- Vila-Carriles, W.H.; Zhou, Z.-H.; Bubien, J.K.; Fuller, C.M.; Benos, D.J. Participation of the chaperone Hsc70 in the trafficking and functional expression of ASIC2 in glioma cells. J. Biol. Chem. 2007, 282, 34381–34391. [Google Scholar] [CrossRef] [Green Version]
- Kapoor, N.; Lee, W.; Clark, E.; Bartoszewski, R.; McNicholas, C.M.; Latham, C.B.; Bebok, Z.; Parpura, V.; Fuller, C.M.; Palmer, C.A.; et al. Interaction of ASIC1 and ENaC subunits in human glioma cells and rat astrocytes. Am. J. Physiol. Cell Physiol. 2011, 300, C1246–C1259. [Google Scholar] [CrossRef] [Green Version]
- Goldfarb, S.B.; Kashlan, O.B.; Watkins, J.N.; Suaud, L.; Yan, W.; Kleyman, T.R.; Rubenstein, R.C. Differential effects of Hsc70 and Hsp70 on the intracellular trafficking and functional expression of epithelial sodium channels. Proc. Natl. Acad. Sci. USA 2006, 103, 5817–5822. [Google Scholar] [CrossRef] [Green Version]
- Evans, C.G.; Wisén, S.; Gestwicki, J.E. Heat shock proteins 70 and 90 inhibit early stages of amyloid β-(1–42) aggregation in vitro. J. Biol. Chem. 2006, 281, 33182–33191. [Google Scholar] [CrossRef] [Green Version]
- Moloney, T.C.; Hyland, R.; O’Toole, D.; Paucard, A.; Kirik, D.; O’Doherty, A.; Gorman, A.M.; Dowd, E. Heat shock protein 70 reduces α-synuclein-induced predegenerative neuronal dystrophy in the α-synuclein viral gene transfer rat model of Parkinson’s disease. CNS Neurosci. Ther. 2013, 20, 50–58. [Google Scholar] [CrossRef] [PubMed]
- Dedmon, M.M.; Christodoulou, J.; Wilson, M.R.; Dobson, C.M. Heat shock protein 70 inhibits α-synuclein fibril formation via preferential binding to prefibrillar species. J. Biol. Chem. 2005, 280, 14733–14740. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Flower, T.R.; Chesnokova, L.S.; Froelich, C.A.; Dixon, C.; Witt, S.N. Heat shock prevents alpha-synuclein-induced apoptosis in a yeast model of parkinson’s disease. J. Mol. Biol. 2005, 351, 1081–1100. [Google Scholar] [CrossRef] [PubMed]
- Prodromou, C. The “active life” of Hsp90 complexes. Biochim. Biophys. Acta Mol. Cell Res. 2012, 1823, 614–623. [Google Scholar] [CrossRef] [Green Version]
- Karagöz, G.E.; Rüdiger, S.G.D. Hsp90 interaction with clients. Trends Biochem. Sci. 2015, 40, 117–125. [Google Scholar] [CrossRef]
- Taipale, M.; Jarosz, D.F.; Lindquist, S. Hsp90 at the hub of protein homeostasis: Emerging mechanistic insights. Nat. Rev. Mol. Cell Biol. 2010, 11, 515–528. [Google Scholar] [CrossRef]
- Boulon, S.; Bertrand, E.; Pradet-Balade, B. Hsp90 and the R2TP co-chaperone complex: Building multi-protein machineries essential for cell growth and gene expression. RNA Biol. 2012, 9, 148–155. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Kadota, Y.; Shirasu, K.; Guerois, R. NLR sensors meet at the SGT1-HSP90 crossroad. Trends Biochem. Sci. 2010, 35, 199–207. [Google Scholar] [CrossRef]
- Pearl, L.H.; Prodromou, C.; Workman, P. The Hsp90 molecular chaperone: An open and shut case for treatment. Biochem. J. 2008, 410, 439–453. [Google Scholar] [CrossRef] [Green Version]
- Wegele, H.; Müller, L.; Buchner, J. Hsp70 and Hsp90—A Relay Team for Protein Folding BT- Reviews of Physiology, Biochemistry and Pharmacology; Springer: Berlin/Heidelberg, Germany, 2004; pp. 1–44. ISBN 978-3-540-44423-7. [Google Scholar]
- Jakob, U.; Lilie, H.; Meyer, I.; Buchner, J. Transient interaction of Hsp90 with early unfolding intermediates of citrate synthase: Implications for heat shock in vivo. J. Biol. Chem. 1995, 270, 7288–7294. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- McLaughlin, S.H.; Smith, H.W.; Jackson, S.E. Stimulation of the weak ATPase activity of human Hsp90 by a client protein. J. Mol. Biol. 2002, 315, 787–798. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Krukenberg, K.A.; Street, T.O.; Lavery, L.A.; Agard, D.A. Conformational dynamics of the molecular chaperone Hsp90. Q. Rev. Biophys. 2011, 44, 229–255. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- González-del Pozo, M.; Borrego, S.; Barragán, I.; Pieras, J.I.; Santoyo, J.; Matamala, N.; Naranjo, B.; Dopazo, J.; Antiñolo, G. Mutation screening of multiple genes in Spanish patients with autosomal recessive retinitis pigmentosa by targeted resequencing. PLoS ONE 2011, 6. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Young, J.C.; Agashe, V.R.; Siegers, K.; Hartl, F.U. Pathways of chaperone-mediated protein folding in the cytosol. Nat. Rev. Mol. Cell Biol. 2004, 5, 781–791. [Google Scholar] [CrossRef]
- Takayama, S.; Reed, J.C.; Homma, S. Heat-shock proteins as regulators of apoptosis. Oncogene 2003, 22, 9041–9047. [Google Scholar] [CrossRef] [Green Version]
- Wiech, H.; Buchner, J.; Zimmermann, R.; Jakob, U. Hsp90 chaperones protein folding in vitro. Nature 1992, 358, 169–170. [Google Scholar] [CrossRef]
- Ficker, E.; Dennis, A.T.; Wang, L.; Brown, A.M. Role of the cytosolic chaperones Hsp70 and Hsp90 in maturation of the cardiac potassium channel HERG. Circ. Res. 2003, 92, e87–e100. [Google Scholar] [CrossRef] [Green Version]
- Gao, Y.; Yechikov, S.; Vazquez, A.E.; Chen, D.; Nie, L. Distinct roles of molecular chaperones HSP90α and HSP90β in the biogenesis of KCNQ4 channels. PLoS ONE 2013, 8, e57282. [Google Scholar] [CrossRef] [Green Version]
- Chen, X.; Liu, P.; Wang, Q.; Li, Y.; Fu, L.; Fu, H.; Zhu, J.; Chen, Z.; Zhu, W.; Xie, C.; et al. DCZ3112, a novel Hsp90 inhibitor, exerts potent antitumor activity against HER2-positive breast cancer through disruption of Hsp90-Cdc37 interaction. Cancer Lett. 2018, 434, 70–80. [Google Scholar] [CrossRef]
- Shelton, L.B.; Koren 3rd, J.; Blair, L.J. Imbalances in the Hsp90 Chaperone Machinery: Implications for Tauopathies. Front. Neurosci. 2017, 11, 724. [Google Scholar] [CrossRef] [PubMed]
- Kopito, R.R. Aggresomes, inclusion bodies and protein aggregation. Trends Cell Biol. 2000, 10, 524–530. [Google Scholar] [CrossRef]
- Garcia-Mata, R.; Gao, Y.-S.; Sztul, E. Hassles with taking out the garbage: Aggravating aggresomes. Traffic 2002, 3, 388–396. [Google Scholar] [CrossRef] [PubMed]
- Wilkinson, B.; Gilbert, H.F. Protein disulfide isomerase. Biochim. Biophys. Acta 2004, 1699, 35–44. [Google Scholar] [CrossRef]
- Brehme, M.; Voisine, C.; Rolland, T.; Wachi, S.; Soper, J.H.; Zhu, Y.; Orton, K.; Villella, A.; Garza, D.; Vidal, M.; et al. A chaperome subnetwork safeguards proteostasis in aging and neurodegenerative disease. Cell Rep. 2014, 9, 1135–1150. [Google Scholar] [CrossRef] [Green Version]
- Gruber, C.W.; Cemazar, M.; Heras, B.; Martin, J.L.; Craik, D.J. Protein disulfide isomerase: The structure of oxidative folding. Trends Biochem. Sci. 2006, 31, 455–464. [Google Scholar] [CrossRef]
- Galligan, J.J.; Petersen, D.R. The human protein disulfide isomerase gene family. Hum. Genomics 2012, 6, 6. [Google Scholar] [CrossRef] [Green Version]
- Guna, A.; Hegde, R.S. Transmembrane domain recognition during membrane protein biogenesis and quality control. Curr. Biol. 2018, 28, R498–R511. [Google Scholar] [CrossRef] [Green Version]
- Heyden, M.; Freites, J.A.; Ulmschneider, M.B.; White, S.H.; Tobias, D.J. Assembly and stability of α-helical membrane proteins. Soft Matter 2012, 8, 7742–7752. [Google Scholar] [CrossRef] [Green Version]
- Cymer, F.; von Heijne, G.; White, S.H. Mechanisms of integral membrane protein insertion and folding. J. Mol. Biol. 2015, 427, 999–1022. [Google Scholar] [CrossRef] [Green Version]
- Béguin, P.; Hasler, U.; Beggah, A.; Horisberger, J.D.; Geering, K. Membrane integration of Na,K-ATPase alpha-subunits and beta-subunit assembly. J. Biol. Chem. 1998, 273, 24921–24931. [Google Scholar] [CrossRef] [Green Version]
- Béguin, P.; Hasler, U.; Staub, O.; Geering, K. Endoplasmic reticulum quality control of oligomeric membrane proteins: Topogenic determinants involved in the degradation of the unassembled Na,K-ATPase alpha subunit and in its stabilization by beta subunit assembly. Mol. Biol. Cell 2000, 11, 1657–1672. [Google Scholar] [CrossRef] [PubMed]
- Feige, M.J.; Hendershot, L.M. Quality control of integral membrane proteins by assembly-dependent membrane integration. Mol. Cell 2013, 51, 297–309. [Google Scholar] [CrossRef] [Green Version]
- Lamb, J.R.; Tugendreich, S.; Hieter, P. Tetratrico peptide repeat interactions: To TPR or not to TPR? Trends Biochem. Sci. 1995, 20, 257–259. [Google Scholar] [CrossRef]
- McDonough, H.; Patterson, C. CHIP: A link between the chaperone and proteasome systems. Cell Stress Chaperones 2003, 8, 303–308. [Google Scholar] [CrossRef] [Green Version]
- Apaja, P.M.; Xu, H.; Lukacs, G.L. Quality control for unfolded proteins at the plasma membrane. J. Cell Biol. 2010, 191, 553–570. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Li, P.; Kurata, Y.; Maharani, N.; Mahati, E.; Higaki, K.; Hasegawa, A.; Shirayoshi, Y.; Yoshida, A.; Kondo, T.; Kurozawa, Y.; et al. E3 ligase CHIP and Hsc70 regulate Kv1.5 protein expression and function in mammalian cells. J. Mol. Cell. Cardiol. 2015, 86, 138–146. [Google Scholar] [CrossRef] [PubMed]
- Denning, G.M.; Anderson, M.P.; Amara, J.F.; Marshall, J.; Smith, A.E.; Welsh, M.J. Processing of mutant cystic fibrosis transmembrane conductance regulator is temperature-sensitive. Nature 1992, 358, 761. [Google Scholar] [CrossRef] [PubMed]
- Lampel, A.; Bram, Y.; Levy-Sakin, M.; Bacharach, E.; Gazit, E. The Effect of chemical chaperones on the assembly and stability of HIV-1 capsid protein. PLoS ONE 2013, 8, 25–29. [Google Scholar] [CrossRef] [Green Version]
- Dandage, R.; Bandyopadhyay, A.; Jayaraj, G.G.; Saxena, K.; Dalal, V.; Das, A.; Chakraborty, K. Classification of chemical chaperones based on their effect on protein folding landscapes. ACS Chem. Biol. 2015, 10, 813–820. [Google Scholar] [CrossRef]
- Perlmutter, D.H. Chemical chaperones: A pharmacological strategy for disorders of protein folding and trafficking. Pediatr. Res. 2002, 52, 832–836. [Google Scholar] [CrossRef]
- Yancey, P.; Clark, M.; Hand, S.; Bowlus, R.; Somero, G. Living with water stress: Evolution of osmolyte systems. Science 1982, 217, 1214–1222. [Google Scholar] [CrossRef] [PubMed]
- Wlodarczyk, S.R.; Custódio, D.; Pessoa Jr, A.; Monteiro, G. Influence and effect of osmolytes in biopharmaceutical formulations. Eur. J. Pharm. Biopharm. 2018, 131, 92–98. [Google Scholar] [CrossRef] [PubMed]
- Lin, T.Y.; Timasheff, S.N. Why do some organisms use a urea-methylamine mixture as osmolyte? Thermodynamic compensation of urea and trimethylamine N-oxide interactions with protein. Biochemistry 1994, 33, 12695–12701. [Google Scholar] [CrossRef] [PubMed]
- Baskakov, I.; Bolen, D.W. Forcing thermodynamically unfolded proteins to fold. J. Biol. Chem. 1998, 273, 4831–4834. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Street, T.O.; Bolen, D.W.; Rose, G.D. A molecular mechanism for osmolyte-induced protein stability. Proc. Natl. Acad. Sci. USA 2006, 103, 13997–14002. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Fischer, H.; Fukuda, N.; Barbry, P.; Illek, B.; Sartori, C.; Matthay, M.A. Partial restoration of defective chloride conductance in DeltaF508 CF mice by trimethylamine oxide. Am. J. Physiol. Lung Cell. Mol. Physiol. 2001, 281, L52–L57. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Deen, P.M.; Marr, N.; Kamsteeg, E.J.; van Balkom, B.W. Nephrogenic diabetes insipidus. Curr. Opin. Nephrol. Hypertens. 2000, 9, 591–595. [Google Scholar] [CrossRef]
- Langley, J.M.; Balfe, J.W.; Selander, T.; Ray, P.N.; Clarke, J.T. Autosomal recessive inheritance of vasopressin-resistant diabetes insipidus. Am. J. Med. Genet. 1991, 38, 90–94. [Google Scholar] [CrossRef]
- Tamarappoo, B.K.; Yang, B.; Verkman, A.S. Misfolding of mutant aquaporin-2 water channels in nephrogenic siabetes insipidus. J. Biol. Chem. 1999, 274, 34825–34831. [Google Scholar] [CrossRef] [Green Version]
- Tamarappoo, B.K.; Verkman, A.S. Defective aquaporin-2 trafficking in nephrogenic diabetes insipidus and correction by chemical chaperones. J. Clin. Investig. 1998, 101, 2257–2267. [Google Scholar] [CrossRef] [Green Version]
- Hayashi, H.; Sugiyama, Y. 4-phenylbutyrate enhances the cell surface expression and the transport capacity of wild-type and mutated bile salt export pumps. Hepatology 2007, 45, 1506–1516. [Google Scholar] [CrossRef] [PubMed]
- Malatack, J.J.; Doyle, D. A Drug regimen for progressive familial cholestasis Type 2. Pediatrics 2018, 141, e20163877. [Google Scholar] [CrossRef] [Green Version]
- Rubenstein, R.C.; Egan, M.E.; Zeitlin, P.L. In vitro pharmacologic restoration of CFTR-mediated chloride transport with sodium 4-phenylbutyrate in cystic fibrosis epithelial cells containing delta F508-CFTR. J. Clin. Investig. 1997, 100, 2457–2465. [Google Scholar] [CrossRef] [Green Version]
- Rubenstein, R.C.; Zeitlin, P.L. A pilot clinical trial of oral sodium 4-phenylbutyrate (Buphenyl) in deltaF508-homozygous cystic fibrosis patients: Partial restoration of nasal epithelial CFTR function. Am. J. Respir. Crit. Care Med. 1998, 157, 484–490. [Google Scholar] [CrossRef]
- Duricka, D.L.; Brown, R.L.; Varnum, M.D. Defective trafficking of cone photoreceptor CNG channels induces the unfolded protein response and ER-stress-associated cell death. Biochem. J. 2012, 441, 685–696. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Ulloa-Aguirre, A.; Zarinan, T.; Conn, P.M. Pharmacoperones: Targeting therapeutics toward diseases caused by protein misfolding. Rev. Investig. Clin. 2015, 67, 15–19. [Google Scholar] [PubMed]
- Bernier, V.; Lagacé, M.; Bichet, D.G.; Bouvier, M. Pharmacological chaperones: Potential treatment for conformational diseases. Trends Endocrinol. Metab. 2004, 15, 222–228. [Google Scholar] [CrossRef] [PubMed]
- Janovick, J.A.; Goulet, M.; Bush, E.; Greer, J.; Wettlaufer, D.G.; Conn, P.M. Structure-activity relations of successful pharmacologic chaperones for rescue of naturally occurring and manufactured mutants of the gonadotropin-releasing hormone receptor. J. Pharmacol. Exp. Ther. 2003, 305, 608–614. [Google Scholar] [CrossRef] [Green Version]
- Hawtin, S.R. Pharmacological chaperone activity of SR49059 to functionally recover misfolded mutations of the vasopressin V1a receptor. J. Biol. Chem. 2006, 281, 14604–14614. [Google Scholar] [CrossRef] [Green Version]
- Fan, J.-Q. A contradictory treatment for lysosomal storage disorders: Inhibitors enhance mutant enzyme activity. Trends Pharmacol. Sci. 2003, 24, 355–360. [Google Scholar] [CrossRef]
- Ishii, S. Pharmacological chaperone therapy for Fabry disease. Proc. Jpn. Acad. Ser. B. Phys. Biol. Sci. 2012, 88, 18–30. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Yan, F.; Lin, C.-W.; Weisiger, E.; Cartier, E.A.; Taschenberger, G.; Shyng, S.-L. Sulfonylureas correct trafficking defects of ATP-sensitive potassium channels caused by mutations in the sulfonylurea receptor. J. Biol. Chem. 2004, 279, 11096–11105. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Bernier, V.; Lagacé, M.; Lonergan, M.; Arthus, M.-F.; Bichet, D.G.; Bouvier, M. Functional rescue of the constitutively internalized V2 vasopressin receptor mutant R137H by the pharmacological chaperone action of SR49059. Mol. Endocrinol. 2004, 18, 2074–2084. [Google Scholar] [CrossRef] [PubMed]
- Bernier, V.; Morello, J.-P.; Zarruk, A.; Debrand, N.; Salahpour, A.; Lonergan, M.; Arthus, M.-F.; Laperrière, A.; Brouard, R.; Bouvier, M.; et al. Pharmacologic chaperones as a potential treatment for X-linked nephrogenic diabetes insipidus. J. Am. Soc. Nephrol. 2006, 17, 232–243. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Wang, X.-H.; Wang, H.-M.; Zhao, B.-L.; Yu, P.; Fan, Z.-C. Rescue of defective MC4R cell-surface expression and signaling by a novel pharmacoperone Ipsen 17. J. Mol. Endocrinol. 2014, 53, 17–29. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Smith, J.L.; Reloj, A.R.; Nataraj, P.S.; Bartos, D.C.; Schroder, E.A.; Moss, A.J.; Ohno, S.; Horie, M.; Anderson, C.L.; January, C.T.; et al. Pharmacological correction of long QT-linked mutations in KCNH2 (hERG) increases the trafficking of Kv11.1 channels stored in the transitional endoplasmic reticulum. Am. J. Physiol. Cell Physiol. 2013, 305, C919–C930. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Delisle, B.P.; Anderson, C.L.; Balijepalli, R.C.; Anson, B.D.; Kamp, T.J.; January, C.T. Thapsigargin selectively rescues the trafficking defective LQT2 channels G601S and F805C. J. Biol. Chem. 2003, 278, 35749–35754. [Google Scholar] [CrossRef] [Green Version]
- Ficker, E.; Obejero-Paz, C.A.; Zhao, S.; Brown, A.M. The binding site for channel blockers that rescue misprocessed human long QT syndrome type 2 ether-a-gogo-related gene (HERG) mutations. J. Biol. Chem. 2002, 277, 4989–4998. [Google Scholar] [CrossRef] [Green Version]
- Los, E.L.; Deen, P.M.T.; Robben, J.H. Potential of nonpeptide (ant)agonists to rescue vasopressin V2 receptor mutants for the treatment of X-linked nephrogenic diabetes insipidus. J. Neuroendocrinol. 2010, 22, 393–399. [Google Scholar] [CrossRef]
- Robben, J.H.; Kortenoeven, M.L.A.; Sze, M.; Yae, C.; Milligan, G.; Oorschot, V.M.; Klumperman, J.; Knoers, N.V.A.M.; Deen, P.M.T. Intracellular activation of vasopressin V2 receptor mutants in nephrogenic diabetes insipidus by nonpeptide agonists. Proc. Natl. Acad. Sci. USA 2009, 106, 12195–12200. [Google Scholar] [CrossRef] [Green Version]
- Jean-Alphonse, F.; Perkovska, S.; Frantz, M.-C.; Durroux, T.; Méjean, C.; Morin, D.; Loison, S.; Bonnet, D.; Hibert, M.; Mouillac, B.; et al. Biased agonist pharmacochaperones of the AVP V2 receptor may treat congenital nephrogenic diabetes insipidus. J. Am. Soc. Nephrol. 2009, 20, 2190–2203. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- White, E.; McKenna, J.; Cavanaugh, A.; Breitwieser, G.E. Pharmacochaperone-mediated rescue of calcium-sensing receptor loss-of-function mutants. Mol. Endocrinol. 2009, 23, 1115–1123. [Google Scholar] [CrossRef] [Green Version]
- Caldwell, R.A.; Grove, D.E.; Houck, S.A.; Cyr, D.M. Increased folding and channel activity of a rare cystic fibrosis mutant with CFTR modulators. Am. J. Physiol. Lung Cell. Mol. Physiol. 2011, 301, L346–L352. [Google Scholar] [CrossRef] [PubMed]
- Deeks, E.D. Lumacaftor/Ivacaftor: A review in cystic fibrosis. Drugs 2016, 76, 1191–1201. [Google Scholar] [CrossRef] [PubMed]
- Liu, Q.; Sabirzhanova, I.; Bergbower, E.A.S.; Yanda, M.; Guggino, W.G.; Cebotaru, L. The CFTR Corrector, VX-809 (Lumacaftor), Rescues ABCA4 trafficking mutants: A potential treatment for Stargardt disease. Cell. Physiol. Biochem. 2019, 53, 400–412. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Steele, M.; Seiple, W.H.; Carr, R.E.; Klug, R. The clinical utility of visual-evoked potential acuity testing. Am. J. Ophthalmol. 1989, 108, 572–577. [Google Scholar] [CrossRef]
- Ruffin, M.; Roussel, L.; Maillé, É.; Rousseau, S.; Brochiero, E. Vx-809/Vx-770 treatment reduces inflammatory response to Pseudomonas aeruginosa in primary differentiated cystic fibrosis bronchial epithelial cells. Am. J. Physiol. Lung Cell. Mol. Physiol. 2018, 314, L635–L641. [Google Scholar] [CrossRef] [Green Version]
- Chaudary, N. Triplet CFTR modulators: Future prospects for treatment of cystic fibrosis. Ther. Clin. Risk Manag. 2018, 14, 2375–2383. [Google Scholar] [CrossRef] [Green Version]
- Albright, J.D.; Reich, M.F.; Delos Santos, E.G.; Dusza, J.P.; Sum, F.-W.; Venkatesan, A.M.; Coupet, J.; Chan, P.S.; Ru, X.; Mazandarani, H.; et al. 5-Fluoro-2-methyl-N-[4-(5H-pyrrolo[2,1-c]- [1,4]benzodiazepin-10(11H)-ylcarbonyl)-3- chlorophenyl]benzamide (VPA-985): An orally active arginine vasopressin antagonist with selectivity for V2 receptors. J. Med. Chem. 1998, 41, 2442–2444. [Google Scholar] [CrossRef]
- Robben, J.H.; Sze, M.; Knoers, N.V.A.M.; Deen, P.M.T. Functional rescue of vasopressin V2 receptor mutants in MDCK cells by pharmacochaperones: Relevance to therapy of nephrogenic diabetes insipidus. Am. J. Physiol. Physiol. 2007, 292, F253–F260. [Google Scholar] [CrossRef] [Green Version]
- Moeller, H.B.; Rittig, S.; Fenton, R.A. Nephrogenic diabetes insipidus: Essential insights into the molecular background and potential therapies for treatment. Endocr. Rev. 2013, 34, 278–301. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Sorrenson, B.; Suetani, R.J.; Williams, M.J.A.; Bickley, V.M.; George, P.M.; Jones, G.T.; McCormick, S.P.A. Functional rescue of mutant ABCA1 proteins by sodium 4-phenylbutyrate. J. Lipid Res. 2013, 54, 55–62. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Sabirzhanova, I.; Lopes Pacheco, M.; Rapino, D.; Grover, R.; Handa, J.T.; Guggino, W.B.; Cebotaru, L. Rescuing trafficking mutants of the ATP-binding cassette protein, ABCA4, with small molecule correctors as a treatment for Stargardt eye disease. J. Biol. Chem. 2015, 290, 19743–19755. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Cavanaugh, A.; McKenna, J.; Stepanchick, A.; Breitwieser, G.E. Calcium-sensing receptor biosynthesis includes a cotranslational conformational checkpoint and endoplasmic reticulum retention. J. Biol. Chem. 2010, 285, 19854–19864. [Google Scholar] [CrossRef] [Green Version]
- Dorwart, M.R.; Shcheynikov, N.; Baker, J.M.R.; Forman-Kay, J.D.; Muallem, S.; Thomas, P.J. Congenital chloride-losing diarrhea causing mutations in the STAS domain result in misfolding and mistrafficking of SLC26A3. J. Biol. Chem. 2008, 283, 8711–8722. [Google Scholar] [CrossRef] [Green Version]
- Keller, D.I.; Rougier, J.-S.; Kucera, J.P.; Benammar, N.; Fressart, V.; Guicheney, P.; Madle, A.; Fromer, M.; Schläpfer, J.; Abriel, H. Brugada syndrome and fever: Genetic and molecular characterization of patients carrying SCN5A mutations. Cardiovasc. Res. 2005, 67, 510–519. [Google Scholar] [CrossRef] [Green Version]
- Musil, L.S.; Le, A.-C.N.; VanSlyke, J.K.; Roberts, L.M. Regulation of connexin degradation as a mechanism to increase gap junction assembly and function. J. Biol. Chem. 2000, 275, 25207–25215. [Google Scholar] [CrossRef] [Green Version]
- Vonk, W.I.M.; de Bie, P.; Wichers, C.G.K.; van den Berghe, P.V.E.; van der Plaats, R.; Berger, R.; Wijmenga, C.; Klomp, L.W.J.; van de Sluis, B. The copper-transporting capacity of ATP7A mutants associated with Menkes disease is ameliorated by COMMD1 as a result of improved protein expression. Cell. Mol. Life Sci. 2012, 69, 149–163. [Google Scholar] [CrossRef] [Green Version]
- Nascimento-Ferreira, I.; Santos-Ferreira, T.; Sousa-Ferreira, L.; Auregan, G.; Onofre, I.; Alves, S.; Dufour, N.; Colomer Gould, V.F.; Koeppen, A.; Déglon, N.; et al. Overexpression of the autophagic beclin-1 protein clears mutant ataxin-3 and alleviates Machado-Joseph disease. Brain 2011, 134, 1400–1415. [Google Scholar] [CrossRef]
- Grove, D.E.; Fan, C.-Y.; Ren, H.Y.; Cyr, D.M. The endoplasmic reticulum-associated Hsp40 DNAJB12 and Hsc70 cooperate to facilitate RMA1 E3-dependent degradation of nascent CFTRDeltaF508. Mol. Biol. Cell 2011, 22, 301–314. [Google Scholar] [CrossRef]
- Rowe, S.M.; McColley, S.A.; Rietschel, E.; Li, X.; Bell, S.C.; Konstan, M.W.; Marigowda, G.; Waltz, D.; Boyle, M.P.; Group, V.-. 809-102 S. Lumacaftor/Ivacaftor treatment of patients with cystic fibrosis heterozygous for F508del-CFTR. Ann. Am. Thorac. Soc. 2017, 14, 213–219. [Google Scholar] [CrossRef] [PubMed]
- Gentzsch, M.; Ren, H.Y.; Houck, S.A.; Quinney, N.L.; Cholon, D.M.; Sopha, P.; Chaudhry, I.G.; Das, J.; Dokholyan, N.V.; Randell, S.H.; et al. Restoration of R117H CFTR folding and function in human airway cells through combination treatment with VX-809 and VX-770. Am. J. Physiol. Cell. Mol. Physiol. 2016, 311, L550–L559. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Bagdany, M.; Veit, G.; Fukuda, R.; Avramescu, R.G.; Okiyoneda, T.; Baaklini, I.; Singh, J.; Sovak, G.; Xu, H.; Apaja, P.M.; et al. Chaperones rescue the energetic landscape of mutant CFTR at single molecule and in cell. Nat. Commun. 2017, 8, 398. [Google Scholar] [CrossRef] [PubMed]
- Wang, Y.; Bartlett, M.C.; Loo, T.W.; Clarke, D.M. Specific rescue of cystic fibrosis transmembrane conductance regulator processing mutants using pharmacological chaperones. Mol. Pharmacol. 2006, 70, 297–302. [Google Scholar] [CrossRef] [PubMed]
- Wellhauser, L.; Chiaw, P.K.; Pasyk, S.; Li, C.; Ramjeesingh, M.; Bear, C.E. A Small-molecule modulator interacts directly with ΔPhe508-CFTR to modify its ATPase activity and conformational stability. Mol. Pharmacol. 2009, 75, 1430–1438. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Taylor-Cousar, J.L.; Munck, A.; McKone, E.F.; van der Ent, C.K.; Moeller, A.; Simard, C.; Wang, L.T.; Ingenito, E.P.; McKee, C.; Lu, Y.; et al. Tezacaftor–Ivacaftor in patients with cystic fibrosis homozygous for Phe508del. N. Engl. J. Med. 2017, 377, 2013–2023. [Google Scholar] [CrossRef]
- Jacobs, M.T.; Zhang, Y.-W.; Campbell, S.D.; Rudnick, G. Ibogaine, a noncompetitive inhibitor of serotonin transport, acts by stabilizing the cytoplasm-facing State of the transporter. J. Biol. Chem. 2007, 282, 29441–29447. [Google Scholar] [CrossRef] [Green Version]
- Bulling, S.; Schicker, K.; Zhang, Y.-W.; Steinkellner, T.; Stockner, T.; Gruber, C.W.; Boehm, S.; Freissmuth, M.; Rudnick, G.; Sitte, H.H.; et al. The Mechanistic basis for noncompetitive ibogaine inhibition of serotonin and dopamine transporters. J. Biol. Chem. 2012, 287, 18524–18534. [Google Scholar] [CrossRef] [Green Version]
- Sucic, S.; Kasture, A.; Mazhar Asjad, H.M.; Kern, C.; El-Kasaby, A.; Freissmuth, M. When transporters fail to be transported: How to rescue folding-deficient SLC6 transporters. J. Neurol. Neuromed. 2016, 1, 34–40. [Google Scholar] [CrossRef] [Green Version]
- Houck, S.A.; Ren, H.Y.; Madden, V.J.; Bonner, J.N.; Conlin, M.P.; Janovick, J.A.; Conn, P.M.; Cyr, D.M. Quality control autophagy degrades soluble ERAD-resistant conformers of the misfolded membrane protein GnRHR. Mol. Cell 2014, 54, 166–179. [Google Scholar] [CrossRef] [Green Version]
- Leaños-Miranda, A.; Ulloa-Aguirre, A.; Janovick, J.A.; Conn, P.M. In vitro coexpression and pharmacological rescue of mutant gonadotropin-releasing hormone receptors causing hypogonadotropic hypogonadism in humans expressing compound heterozygous alleles. J. Clin. Endocrinol. Metab. 2005, 90, 3001–3008. [Google Scholar] [CrossRef] [PubMed]
- Walker, V.E.; Wong, M.J.H.; Atanasiu, R.; Hantouche, C.; Young, J.C.; Shrier, A. Hsp40 chaperones promote degradation of the HERG potassium channel. J. Biol. Chem. 2010, 285, 3319–3329. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Zhou, Z.; Gong, Q.; January, C.T. Correction of defective protein trafficking of a mutant HERG potassium channel in human long QT syndrome: Pharmacological and temperature effects. J. Biol. Chem. 1999, 274, 31123–31126. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Bass, J.; Chiu, G.; Argon, Y.; Steiner, D.F. Folding of insulin receptor monomers is facilitated by the molecular chaperones calnexin and calreticulin and impaired by rapid dimerization. J. Cell Biol. 1998, 141, 637–646. [Google Scholar] [CrossRef] [Green Version]
- Huang, H.; Wang, W.; Tao, Y.-X. Pharmacological chaperones for the misfolded melanocortin-4 receptor associated with human obesity. Biochim. Biophys. Acta Mol. Basis Dis. 2017, 1863, 2496–2507. [Google Scholar] [CrossRef] [PubMed]
- Tao, Y.-X. The melanocortin-4 receptor: Physiology, pharmacology, and pathophysiology. Endocr. Rev. 2010, 31, 506–543. [Google Scholar] [CrossRef] [Green Version]
- Fan, Z.-C.; Tao, Y.-X. Functional characterization and pharmacological rescue of melanocortin-4 receptor mutations identified from obese patients. J. Cell. Mol. Med. 2009, 13, 3268–3282. [Google Scholar] [CrossRef] [Green Version]
- Ulbrich, L.; Favaloro, F.L.; Trobiani, L.; Marchetti, V.; Patel, V.; Pascucci, T.; Comoletti, D.; Marciniak, S.J.; De Jaco, A. Autism-associated R451C mutation in neuroligin3 leads to activation of the unfolded protein response in a PC12 Tet-On inducible system. Biochem. J. 2016, 473, 423–434. [Google Scholar] [CrossRef] [Green Version]
- Shepshelovich, J.; Goldstein-Magal, L.; Globerson, A.; Yen, P.M.; Rotman-Pikielny, P.; Hirschberg, K. Protein synthesis inhibitors and the chemical chaperone TMAO reverse endoplasmic reticulum perturbation induced by overexpression of the iodide transporter pendrin. J. Cell Sci. 2005, 118, 1577–1586. [Google Scholar] [CrossRef] [Green Version]
- Jin, Z.-B.; Mandai, M.; Yokota, T.; Higuchi, K.; Ohmori, K.; Ohtsuki, F.; Takakura, S.; Itabashi, T.; Wada, Y.; Akimoto, M.; et al. Identifying pathogenic genetic background of simplex or multiplex retinitis pigmentosa patients: A large scale mutation screening study. J. Med. Genet. 2008, 45, 465–472. [Google Scholar] [CrossRef]
- Jin, T.; Gu, Y.; Zanusso, G.; Sy, M.; Kumar, A.; Cohen, M.; Gambetti, P.; Singh, N. The Chaperone Protein bip binds to a mutant prion protein and mediates its degradation by the proteasome. J. Biol. Chem. 2000, 275, 38699–38704. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Li, T.; Sandberg, M.A.; Pawlyk, B.S.; Rosner, B.; Hayes, K.C.; Dryja, T.P.; Berson, E.L. Effect of vitamin A supplementation on rhodopsin mutants threonine-17 --> methionine and proline-347 --> serine in transgenic mice and in cell cultures. Proc. Natl. Acad. Sci. USA 1998, 95, 11933–11938. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Mattle, D.; Kuhn, B.; Aebi, J.; Bedoucha, M.; Kekilli, D.; Grozinger, N.; Alker, A.; Rudolph, M.G.; Schmid, G.; Schertler, G.F.X.; et al. Ligand channel in pharmacologically stabilized rhodopsin. Proc. Natl. Acad. Sci. USA 2018, 115, 3640–3645. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Vasireddy, V.; Chavali, V.R.M.; Joseph, V.T.; Kadam, R.; Lin, J.H.; Jamison, J.A.; Kompella, U.B.; Reddy, G.B.; Ayyagari, R. Rescue of photoreceptor degeneration by curcumin in transgenic rats with P23H rhodopsin mutation. PLoS ONE 2011, 6, e21193. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Chen, Y.; Chen, Y.; Jastrzebska, B.; Golczak, M.; Gulati, S.; Tang, H.; Seibel, W.; Li, X.; Jin, H.; Han, Y.; et al. A novel small molecule chaperone of rod opsin and its potential therapy for retinal degeneration. Nat. Commun. 2018, 9, 1976. [Google Scholar] [CrossRef]
- Chiu, A.M.; Mandziuk, J.J.; Loganathan, S.K.; Alka, K.; Casey, J.R. High throughput assay identifies glafenine as a corrector for the folding defect in corneal dystrophy–causing mutants of SLC4A11. Investig. Ophthalmol. Vis. Sci. 2015, 56, 7739–7753. [Google Scholar] [CrossRef] [Green Version]
- Robben, J.H.; Sze, M.; Knoers, N.V.A.M.; Deen, P.M.T. Rescue of vasopressin V2 receptor mutants by chemical chaperones: Specificity and mechanism. Mol. Biol. Cell 2006, 17, 379–386. [Google Scholar] [CrossRef] [Green Version]
Sequence | Protein | Location | Organism | Reference |
---|---|---|---|---|
VVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIRE. | mTOR. | Endoplasmic reticulum. | Homo sapiens; Mus musculus; Rattus norvegicus. | [39] |
HALSYWKPFLVNMCVATVLTAGAYLCYRFLFNSNT. | PTP-1B. | Endoplasmic reticulum. | Homo sapiens. | [40] |
MEAMWLLCVALAVLAWG. | GlcNAc-PI. | Endoplasmic reticulum. | Homo sapiens. | [41] |
IPHDLCHNGEKSKKPSKIKSLFKKKSK. | STIM2. | Endoplasmic reticulum. | Homo sapiens; Mus musculus. | [42] |
GVMLGSIFCALITMLGHI. | Cosmc. | Endoplasmic reticulum. | Bos taurus; Homo sapiens; Mus musculus; Rattus norvegicus. | [43] |
MRLLLALLGVLLSVPGPPVLS. | FGFR4. | Plasma membrane. | Homo sapiens. | [44] |
MDCRKMARFSYSVIWIMAISKVFELGLVAG. | TDGF. | Plasma membrane. | Homo sapiens. | [45] |
MPAWGALFLLWATAEA. | (GP)IX. | Plasma membrane. | Homo sapiens. | [46] |
LRCLACSCFRTPVWPR. | prRDH. | Plasma membrane. | Bos taurus. | [47] |
MGCGCSSHPE. | Lck. | Plasma membrane. | Homo sapiens; Aotus nancymaae. | [48,49] |
VTNGSTYILVPLSH. | FSHR. | Plasma membrane. | Homo sapiens. | [50] |
AETENFV. | M3 mAChR. | Plasma membrane. | Homo sapiens; Gorilla gorilla gorilla; Pan troglodytes; Pongo pygmaeus. | [51,52] |
Misfolded Membrane Protein | Disease | Gene | Rescuing Strategy | ||
---|---|---|---|---|---|
Molecular Chaperones | Chemical Chaperones | Pharmacological Chaperones | |||
α-synuclein | Parkinson’s disease | SNCA | Hsp70 [223,224,225] | ||
Aquaporin-2 | Autosomal Nephrogenic Diabetes Insipidus | AQP2 | Glycerol, Trimethylamine-N-oxide (TMAO) and Dimethyl sulfoxide (DMSO) [2,272,273]. | ||
Arginine-Vasopressin (AVP) Receptor 2 (AVPR2) | Nephrogenic Syndrome of Inappropriate Antidiuresis and Diabetes Insipidus (nephrogenic, X-Linked) | AVPR2 | OPC51803, VA999088, and VA999089 [293]. L44P, A294P, and R337X [294]. SR49059, VPA-985, OPC31260, OPC41061 (Tolvaptan) and SR121463B [293,302,303]. MCF14, MCF18, and MCF57 [294,304]. | ||
ATP-binding Cassette Transporter | Tangier disease | ABCA1 | Sodium 4-Phenylbutyrate (4-PBA) [305]. | ||
Stargardt Eye disease | ABCA4 | VX-809 (Lumacaftor) [306]. | |||
Bile Salt Export Pump (BSEP) | Progressive Familial Intrahepatic Cholestasis type 2 | ABCB11 | 4-PBA mixed with Anticonvulsant-Oxcarbazepine, and Maralixibat [274,275]. | ||
Calcium-Sensing Receptor (CaSR) | Familial Hypocalciuric Hypercalcemia | CaSR | MG132, NPS R-568 [295,307]. | ||
Cardiac Sodium (Na+) Channel NaV1.5 | Brugada Syndrome Nocturnal Death syndrome | SCN5A | Curcumin [308]. | Mexiletine [309]. | |
Connexin Cx31, Cx43, Cx50 | Charcot-Marie-Tooth syndrome | GJA1 | Cycloheximide [310]. | ||
Copper-transporting P-type ATPase | Menkes disease | ATP7A | Excess of copper [311]. | Copper Toxicosis Protein COMMD1 [311]. | |
Cyclic Nucleotide Gated (CNG) Channel | Retinitis Pigmentosa, Achromatopsia | CNGA3 | TUDCA (Tauroursodeoxycholate Sodium salt), 4-PBA [278]. Glycerol [312]. MTSHB (Hydroxybenzyl-Methanethiosulfonate), MTSEA (Aminoethyl-Methanethiosulfonate) [123]. | CPT-cGMP [8-(chlorophenylthio)-cGMP] [278]. | |
Cystic Fibrosis Transmembrane Conductance Regulator (CFTR) | Cystic Fibrosis | CFTR | Hsc70, Hsp90 [313]. Hsc70/Hdj-2 [218]. | Glycerol [98]. TMAO [269]. 4-PBA [276,277]. | VX-809 (Lumacaftor) [269]. Lumacaftor/Ivacaftor [314,315]. Cycloheximide [316]. Corr-4a and VRT-532 [317,318]. VX-661(Tezacaftor)/Ivacaftor [319]. |
Dopamine Transporter (DAT) | Infantile parkinsonism-dystonia | SLC6A3 | Ibogaine, Noribogaine [320,321,322]. | ||
Gonadotropin Releasing Hormone Receptor (GnRHR) | Hypogonadotropic hypogonadism | GNRHR | JB12, Hsp70 [323]. | IN3 [324]. | |
HERG potassium channel | Hereditary long QT syndrome | KCNH2 | sp40/DnaJ [325]. | E-4031 [289,326]. Cisapride [291]. Thapsigargin [290]. | |
Insulin receptor | Diabetes Mellitus, Insulin-resistant syndrome | INSR | Calnexin and Calreticulin [327]. | ||
Melanocortin-4 receptor (MC4R) | Severe early-onset morbid obesity | MC4R | Ipsen 17 [288,328]. ML00253764, Ipsen 5i [328,329,330]. | ||
Voltage-gated potassium channel (VGKC) | Autosomal Dominant Deafness type 2A | KCNQ4 | Hsp90β [241]. | ||
Neuroligin-3 | X-linked autism, Asperger syndrome | NLGN3 | Calnexin [331]. | ||
Pendrin | Pendred syndrome and Non-syndromic Hearing loss | SLC26A4 (PDS) | TMAO [332]. | Cycloheximide (CHX), Puromycin [332]. | |
Prion Protein (PrP) | Genetic Creutzfeldt-Jakob disease, Gerstmann Straussler Scheinker syndome and Fatal Familial Insomnia | PRNP | BiP [333], [334]. | ||
Rhodopsin | Retinitis Pigmentosa | RHO | 1-cis retinal [335]. | DMSO [336]. Curcumin [337]. | YC-001 [338]. S-RS1 [336]. |
Sodium-borate cotransporter | Corneal dystrophy | SLC4A11 | Anti-inflammatory drugs (NSAIDs), Glafenine, Ibuprofen, and Acetylsalicylic acid dissolved in DMSO [339]. | ||
Vasopressin Type 2 Receptor (V2R) | Nephrogenic Diabetes Insipidus | V2R | Glycerol, DMSO and TMAO [272,273]. | SR49059 [197,286,287]. Thapsigargin/Curcumin and Ionomycin [340]. | |
Voltage sensitive potassium channel (Kv1.5) | Atrial Fibrillation | KCNA5 | Hsp70 [215]. |
© 2020 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (http://creativecommons.org/licenses/by/4.0/).
Share and Cite
Juarez-Navarro, K.; Ayala-Garcia, V.M.; Ruiz-Baca, E.; Meneses-Morales, I.; Rios-Banuelos, J.L.; Lopez-Rodriguez, A. Assistance for Folding of Disease-Causing Plasma Membrane Proteins. Biomolecules 2020, 10, 728. https://doi.org/10.3390/biom10050728
Juarez-Navarro K, Ayala-Garcia VM, Ruiz-Baca E, Meneses-Morales I, Rios-Banuelos JL, Lopez-Rodriguez A. Assistance for Folding of Disease-Causing Plasma Membrane Proteins. Biomolecules. 2020; 10(5):728. https://doi.org/10.3390/biom10050728
Chicago/Turabian StyleJuarez-Navarro, Karina, Victor M. Ayala-Garcia, Estela Ruiz-Baca, Ivan Meneses-Morales, Jose Luis Rios-Banuelos, and Angelica Lopez-Rodriguez. 2020. "Assistance for Folding of Disease-Causing Plasma Membrane Proteins" Biomolecules 10, no. 5: 728. https://doi.org/10.3390/biom10050728
APA StyleJuarez-Navarro, K., Ayala-Garcia, V. M., Ruiz-Baca, E., Meneses-Morales, I., Rios-Banuelos, J. L., & Lopez-Rodriguez, A. (2020). Assistance for Folding of Disease-Causing Plasma Membrane Proteins. Biomolecules, 10(5), 728. https://doi.org/10.3390/biom10050728