Peptidomimetics and Their Applications for Opioid Peptide Drug Discovery
Abstract
:1. Introduction
2. Opioid Receptors and Natural Opioid Peptides
3. Peptidomimetics for Opioid Receptors
3.1. Pharmacological Aspect
3.1.1. Improving Bioactivity, Specificity, and Selectivity for the Opioid Receptors
3.1.2. Transforming Bioactivity from Agonism to Antagonism
3.1.3. Optimizing Drug-like Characteristics including Metabolic Stability, BBB Permeability, and Oral Bioavailability
3.1.4. Reducing Opioid Side Effects
Multifunctional Ligands
Localization of the Site: Peripherally Mediated Analgesics
Biased Ligands, etc.
3.2. Structural Aspect
3.2.1. Conformational Studies and Design from Pharmacophore
3.2.2. Peptide Scaffolds as a Starting Point for Mimetics: EMs, DER, Morphiceptin, ENKs, DLTs, and DYN
MOR Peptidomimetics
DOR Peptidomimetics
KOR Peptidomimetics
Binding Affinity, IC50 (or Ki) [nM] | Inhibitory Potency, IC50 [nM] | Refs. | |||||
---|---|---|---|---|---|---|---|
MOR | DOR | KOR | MOR (GPI) | DOR (MVD) | KOR (GPI or RVD) | ||
DAMGO | 1.86 | 345 | 6090 | 4.50 | 32.8 | 105 | [197] |
EM-1 | 0.36 | 1506 | 5430 | 4.03 | 283 | - | [21,39] |
EM-2 | 0.69 | 9233 | 5240 | 6.88 | 344 | - | [21,39] |
[(R)-Nip2]-EM-2 | 0.04 | >1000 | - | 0.0002 b | >1000 b | - | [144,145] |
[Tmp3]-EM-2 | 0.44 | 1400 | - | 1.90 | >10,000 | - | [97] |
DER | 0.76 | 73.5 | >1000 | 1.07 | 23.2 | - | [149,198] |
ADAMB | 12.9 | >1000 | >1000 | - | - | - | [85] |
DALDA | 1.69 | 19,200 | 4230 | 254 | 781 | - | [33,154] |
Dmt-DALDA | 0.143 | 2100 | 22.3 | 1.41 | 23.1 | - | [33,154] |
Dmt-NMe-DAla-[(S)-Aba-Gly]-NH2 | 14.8 | 5.0 | >100,000 | 0.00174 c | 0.016 c | - | [155] |
JOM-6 | 0.29 | 24.8 | 2000 | 2.93 d | 338 d | - | [199] |
Morphiceptin | 79.4 | >1000 | - | 318 | 4800 | - | [159,200] |
PL017 | 2.9 | 4200 | - | 21 | 1250 | - | [200] |
PL032 | 5.5 | >10,000 | - | 29 | 1510 | - | [200] |
H-Tyr-Pro-D-1-Nal-Pro-NH2 | 1.9 | >1000 | - | 9.57 | 35.4 | - | [160 |
H-Dmt-DAla-(R)-β3-1-Nal-Pro-NH2 | 0.34 | 238 | 1750 | 7.94 | inactive | inactive | [108] |
H-Dmt-DAla-(R)-β2-1-Nal-Pro-NH2 | 0.05 | 1.04 | 11.2 | 3.55 | 89.1 | 224 | [108] |
Met-ENK | 9.5 | 0.91 | 4440 | 190 | 19 | - | [201,202] |
Leu-ENK | 9.43 | 2.53 | 8210 | 35.6 | 1.73 | 550 | [154,197] |
DADLE | 13.8 | 2.06 | 16,000 | 8.9 | 0.73 | 134 | [197] |
DPDPE | 713 | 2.72 | >15,000 | 3000 | 4.14 | >10,000 | [197] |
DPLPE | 659 | 2.80 | >15,000 | 2350 | 2.77 | >10,000 | [197] |
[Phe(p-F)4]-DPLPE | 1600 | 0.43 | - | 740 | 0.016 | - | [203] |
JOM-13 | 51.5 | 0.74 | - | 460 | 4.2 | [204] | |
DSLET | 31 | 3.8 | - | 360 | 0.58 | - | [205] |
DLT-1 | 2140 | 0.60 | - | 2890 | 0.36 | - | [173] |
DLT-2 | 1680 | 0.73 | - | 3180 | 0.67 | - | [173] |
[(2S,3R)-β-iPrPhe3]-DLT-I | 63,000 | 2.14 | - | 32,500 | 1.23 | - | [170] |
c[DCys2, Pen5]-DLT-1 | 3760 | 2.2 | - | 1100 | 0.25 | - | [173] |
c[DCys2, Cys5]-DLT-1 | 5.15 | 0.87 | - | 2.98 | 0.23 | - | [173] |
[DAla2,Ac6c4]-DLT | 2.45 | 0.045 | - | 558 | 0.52 | - | [172] |
β-END | 1.0 | 1.0 | 52 | 3.5 | 2.1 | - | [206,207] |
biphalin | 1.4 | 2.6 | - | 8.8 | 27 | - | [208] |
DYN A | 5.04 | 2.54 | 0.23 | 2.5 | 22.5 | 12.6 | [209] |
DYN A-(1-13)- NH2 | 1.29 | 4.07 | 0.15 | 1.7 | 78 | 63.1 | [209] |
DYN A-(1-11)-NH2 | 1.08 | 6.99 | 0.077 | 7.5 | 104 | 0.376 | [209,210] |
[DAla3]-DYN A-(1-11)-NH2 | 67 | 407 | 0.36 | - | - | 2.38 | [210] |
E-2078 | 4.51 | 27.2 | 1.91 | 0.3 | 7.4 | 2.6 | [185] |
CR665 | 4050 | 20,300 | 0.24 | - | - | 0.03 c | [190] |
CR845 | - | - | 0.32 | - | - | 0.16 c | [211] |
CTOP | 4.3 | 5600 | - | 426 e | - | - | [161] |
CTAP | 2.1 | 5310 | - | 75.8 e | - | - | [161] |
TIPP | 1720 | 1.22 | - | inactive | 4.80 e | - | [100] |
TIPP-NH2 | 78.8 | 3.00 | - | 1700 | 18.0 e | - | [100] |
DIPP-NH2 | 1.19 | 0.118 | - | 18.2 | 0.209 e | - | [100] |
DIPP-NH2[ψ] | 0.943 | 0.447 | - | 7.71 | 0.537 e | - | [100] |
Dmt-Tic | 1360 | 1.84 | - | inactive | 6.55 e | - | [100] |
Dmt-Tic-NH-(CH2)3-Ph | 0.386 | 0.0871 | - | 102 | 1.69 e | - | [100] |
[Pro3]-DYN A-(1-11)- NH2 | 5700 | 8800 | 2.7 | - | - | 244 e | [210] |
N,N-diallyl-[DPro10]-DYN A-(1-11) | 31.7 | 149 | 3.60 | 228 e | - | 97 e | [42] |
dynantin | 135 | 354 | 20.7 | 925 e | 3220 e | 0.632 e | [196] |
Arodyn | 1740 | 5830 | 10.0 | - | - | - | [212] |
Zyklophin | 5880 | >10,000 | 30.3 | - | - | 84 (KB) c | [213] |
3.2.3. Tools for Mimetics
Peptide Backbone Modifications
Cyclization
N- and/or C-Terminal Modifications: Amide (-NHMe, -NHMe, -NMe2), Ester (-OMe, -OEt, -OBu), Hydroxy (-OH), or Hydrazide (-NH-NH2)
Peptide Linking
Local Backbone Modifications
Non-Natural Amino Acid Replacements without the Alteration of a Peptide Bond
4. Summary and Prospective Aspects
Funding
Institutional Review Board Statement
Informed Consent Statement
Conflicts of Interest
References
- Farmer, P.; Ariens, E. Speculations on the design of nonpeptidic peptidomimetics. Trends Pharmacol. Sci. 1982, 3, 362–365. [Google Scholar] [CrossRef]
- Wang, L.; Wang, N.; Zhang, W.; Cheng, X.; Yan, Z.; Shao, G.; Wang, X.; Wang, R.; Fu, C. Therapeutic peptides: Current applications and future directions. Sign. Trans. Targeted Therap. 2022, 7, 1–27. [Google Scholar]
- Eguchi, M. Recent advances in selective opioid receptor agonists and antagonists. Med. Res. Rev. 2004, 24, 182–212. [Google Scholar]
- Onogi, T.; Minami, M.; Katao, Y.; Nakagawa, T.; Aoki, Y.; Toya, T.; Katsumata, S.; Satoh, M. DAMGO, a μ-opioid receptor selective agonist, distinguishes between μ-and δ-opioid receptors around their first extracellular loops. FEBS Lett. 1995, 357, 93–97. [Google Scholar] [CrossRef]
- Johnson, K.V.-A.; Dunbar, R.I. Pain tolerance predicts human social network size. Sci. Rep. 2016, 6, 1–5. [Google Scholar]
- Lemaire, S.; Berube, A.; Derome, G.; Lemaire, I.; Magnan, J.; Regoli, D.; St. Pierre, S. Synthesis and biological activity of. beta.-endorphin and analogs. Additional evidence for multiple opiate receptors. J. Med. Chem. 1978, 21, 1232–1235. [Google Scholar] [CrossRef]
- Dickenson, A.H. Plasticity: Implications for opioid and other pharmacological interventions in specific pain states. Behav. Brain. Sci. 1997, 20, 392–403. [Google Scholar] [CrossRef]
- Cowan, A.; Zhu, X.; Mosberg, H.; Omnaas, J.; Porreca, F. Direct dependence studies in rats with agents selective for different types of opioid receptor. J. Pharmacol. Exp. Therap. 1988, 246, 950–955. [Google Scholar]
- Cheng, P.Y.; Wu, D.; Decena, J.; Soong, Y.; McCabe, S.; Szeto, H.H. Opioid-induced stimulation of fetal respiratory activity by [D-Ala2] deltorphin I. Eur. J. Pharmacol. 1993, 230, 85–88. [Google Scholar] [CrossRef]
- Akiyama, K.; Gee, K.W.; Mosberg, H.I.; Hruby, V.J.; Yamamura, H.I. Characterization of [3H][2-D-penicillamine, 5-D-penicillamine]-enkephalin binding to delta opiate receptors in the rat brain and neuroblastoma--glioma hybrid cell line (NG 108-15). Proc. Natl. Acad. Sci. USA 1985, 82, 2543–2547. [Google Scholar] [CrossRef]
- Rigter, H.; Hanna, T.J.; Messing, R.B.; Martinez, J.L., Jr.; Vasquez, B.J.; Jensen, R.A.; Veliquette, J.; McGaugh, J.L. Enkephalins interfere with acquisition of an active avoidance response. Life Sci. 1980, 26, 337–345. [Google Scholar] [CrossRef]
- David, M.; Moisand, C.; Meunier, J.-C.; Morgat, J.-L.; Gacel, G.; Roques, B.P. [3H] Tyr-d-Ser-Gly-Phe-Leu-Thr: A specific probe for the δ-opiate receptor subtype in brain membranes. Eur. J. Pharmacol. 1982, 78, 385–387. [Google Scholar] [CrossRef]
- Handa, B.K.; Land, A.C.; Lord, J.A.; Morgan, B.A.; Rance, M.J.; Smith, C.F. Analogues of beta-LPH61-64 possessing selective agonist activity at mu-opiate receptors. Eur. J. Pharmacol. 1981, 70, 531–540. [Google Scholar] [CrossRef]
- Wee, S.; Koob, G.F. The role of the dynorphin–κ opioid system in the reinforcing effects of drugs of abuse. Psychopharmacology 2010, 210, 121–135. [Google Scholar] [CrossRef] [Green Version]
- Bruchas, M.R.; Land, B.B.; Chavkin, C. The dynorphin/kappa opioid system as a modulator of stress-induced and pro-addictive behaviors. Brain. Res. 2010, 1314, 44–55. [Google Scholar] [CrossRef]
- Van’t Veer, A.; Carlezon, W.A. Role of kappa-opioid receptors in stress and anxiety-related behavior. Psychopharmacology 2013, 229, 435–452. [Google Scholar] [CrossRef]
- Schwarzer, C. 30 years of dynorphins--new insights on their functions in neuropsychiatric diseases. Pharmacol. Ther. 2009, 123, 353–370. [Google Scholar] [CrossRef]
- Aldrich, J.V.; Patkar, K.A.; McLaughlin, J.P. Zyklophin, a systemically active selective kappa opioid receptor peptide antagonist with short duration of action. Proc. Natl. Acad. Sci. USA 2009, 106, 18396–18401. [Google Scholar] [CrossRef]
- Ronsisvalle, G.; Pasquinucci, L.; Pittalà, V.; Marrazzo, A.; Prezzavento, O.; Di Toro, R.; Falcucci, B.; Spampinato, S. Nonpeptide Analogues of Dynorphin A (1−8): Design, Synthesis, and Pharmacological Evaluation of κ-Selective Agonists. J. Med. Chem. 2000, 43, 2992–3004. [Google Scholar] [CrossRef]
- Hruby, V.J.; Agnes, R.S. Conformation-activity relationships of opioid peptides with selective activities at opioid receptors. Biopolymers 1999, 51, 391–410. [Google Scholar] [CrossRef]
- Zadina, J.E.; Hackler, L.; Ge, L.J.; Kastin, A.J. A potent and selective endogenous agonist for the mu-opiate receptor. Nature 1997, 386, 499–502. [Google Scholar] [CrossRef]
- Zadina, J.E.; MARTIN-SCHILD, S.; Gerall, A.A.; Kastin, A.J.; Hackler, L.; GE, L.J.; Zhang, X. Endomorphins: Novel endogenous μ-opiate receptor agonists in regions of high μ-opiate receptor density. Ann. N. Y. Acad. Sci. 1999, 897, 136–144. [Google Scholar] [CrossRef]
- Liu, W.X.; Wang, R. Endomorphins: Potential roles and therapeutic indications in the development of opioid peptide analgesic drugs. Med. Res. Rev. 2012, 32, 536–580. [Google Scholar] [CrossRef]
- Wilson, A.M.; Soignier, R.D.; Zadina, J.E.; Kastin, A.J.; Nores, W.L.; Olson, R.D.; Olson, G.A. Dissociation of analgesic and rewarding effects of endomorphin-1 in rats. Peptides 2000, 21, 1871–1874. [Google Scholar] [CrossRef]
- Czapla, M.A.; Gozal, D.; Alea, O.A.; Beckerman, R.C.; Zadina, J.E. Differential cardiorespiratory effects of endomorphin 1, endomorphin 2, DAMGO, and morphine. Am. J. Respir. Crit. Care Med. 2000, 162, 994–999. [Google Scholar] [CrossRef]
- Janecka, A.; Staniszewska, R.; Gach, K.; Fichna, J. Enzymatic degradation of endomorphins. Peptides 2008, 29, 2066–2073. [Google Scholar] [CrossRef]
- De Marco, R.; Janecka, A. Strategies to improve bioavailability and in vivo efficacy of the endogenous opioid peptides endomorphin-1 and endomorphin-2. Curr. Top. Med. Chem. 2016, 16, 141–155. [Google Scholar] [CrossRef]
- Feehan, A.K.; Morgenweck, J.; Zhang, X.; Amgott-Kwan, A.T.; Zadina, J.E. Novel Endomorphin Analogs Are More Potent and Longer-Lasting Analgesics in Neuropathic, Inflammatory, Postoperative, and Visceral Pain Relative to Morphine. J. Pain 2017, 18, 1526–1541. [Google Scholar] [CrossRef]
- Zhang, Y.-Z.; Wang, M.-M.; Wang, S.-Y.; Wang, X.-F.; Yang, W.-J.; Zhao, Y.-N.; Han, F.-T.; Zhang, Y.; Gu, N.; Wang, C.-L. Novel Cyclic Endomorphin Analogues with Multiple Modifications and Oligoarginine Vector Exhibit Potent Antinociception with Reduced Opioid-like Side Effects. J. Med. Chem. 2021, 64, 16801–16819. [Google Scholar] [CrossRef]
- Nilges, M.R.; Laurent, M.; Cable, C.; Arens, L.; Vafiades, J.; Zadina, J.E. Discriminative Stimulus and Low Abuse Liability Effects of Novel Endomorphin Analogs Suggest a Potential Treatment Indication for Opioid Use Disorder. J. Pharmacol. Exp. Ther. 2019, 370, 369–379. [Google Scholar] [CrossRef]
- Lazarus, L.H.; Bryant, S.D.; Cooper, P.S.; Salvadori, S. What peptides these deltorphins be. Prog. Neurobiol. 1999, 57, 377–420. [Google Scholar] [CrossRef]
- Lazarus, L.; Wilson, W.; Guglietta, A.; De Castiglione, R. Dermorphin interaction with rat brain opioid receptors: Involvement of hydrophobic sites in the binding domain. Mol. Pharmacol. 1990, 37, 886–892. [Google Scholar]
- Schiller, P.W.; Nguyen, T.M.; Chung, N.N.; Lemieux, C. Dermorphin analogues carrying an increased positive net charge in their “message” domain display extremely high mu opioid receptor selectivity. J. Med. Chem. 1989, 32, 698–703. [Google Scholar] [CrossRef]
- Fiori, A.; Cardelli, P.; Negri, L.; Savi, M.R.; Strom, R.; Erspamer, V. Deltorphin transport across the blood-brain barrier. Proc. Natl. Acad. Sci. USA 1997, 94, 9469–9474. [Google Scholar] [CrossRef]
- Koehl, A.; Hu, H.; Maeda, S.; Zhang, Y.; Qu, Q.; Paggi, J.M.; Latorraca, N.R.; Hilger, D.; Dawson, R.; Matile, H.; et al. Structure of the µ-opioid receptor–Gi protein complex. Nature 2018, 558, 547–552. [Google Scholar] [CrossRef]
- Mosberg, H.I.; Hurst, R.; Hruby, V.J.; Gee, K.; Yamamura, H.I.; Galligan, J.J.; Burks, T.F. Bis-penicillamine enkephalins possess highly improved specificity toward delta opioid receptors. Proc. Natl. Acad. Sci. USA 1983, 80, 5871–5874. [Google Scholar] [CrossRef]
- Wang, Y.; Kuczera, K. Molecular dynamics simulations of cyclic and linear DPDPE: Influence of the disulfide bond on peptide flexibility. J. Phys. Chem. 1996, 100, 2555–2563. [Google Scholar] [CrossRef]
- Lung, F.D.; Meyer, J.P.; Lou, B.S.; Xiang, L.; Li, G.; Davis, P.; DeLeon, I.A.; Yamamura, H.I.; Porreca, F.; Hruby, V.J. Effects of modifications of residues in position 3 of dynorphin A(1-11)-NH2 on kappa receptor selectivity and potency. J. Med. Chem. 1996, 39, 2456–2460. [Google Scholar] [CrossRef]
- Li, T.; Jinsmaa, Y.; Nedachi, M.; Miyazaki, A.; Tsuda, Y.; Ambo, A.; Sasaki, Y.; Bryant, S.D.; Marczak, E.; Li, Q.; et al. Transformation of mu-opioid receptor agonists into biologically potent mu-opioid receptor antagonists. Bioorg. Med. Chem. 2007, 15, 1237–1251. [Google Scholar] [CrossRef]
- Fichna, J.; do-Rego, J.-C.; Kosson, P.; Costentin, J.; Janecka, A. Characterization of antinociceptive activity of novel endomorphin-2 and morphiceptin analogs modified in the third position. Biochem. Pharmacol. 2005, 69, 179–185. [Google Scholar] [CrossRef]
- Schiller, P.W.; Berezowska, I.; Nguyen, T.M.-D.; Schmidt, R.; Lemieux, C.; Chung, N.N.; Falcone-Hindley, M.L.; Yao, W.; Liu, J.; Iwama, S. Novel ligands lacking a positive charge for the δ-and μ-opioid receptors. J. Med. Chem. 2000, 43, 551–559. [Google Scholar] [CrossRef] [PubMed]
- Gairin, J.E.; Mazarguil, H.; Alvinerie, P.; Botanch, C.; Cros, J.; Meunier, J.C. N,N-diallyl-tyrosyl substitution confers antagonist properties on the kappa-selective opioid peptide [D-Pro10]dynorphin A(1-11). Br. J. Pharmacol. 1988, 95, 1023–1030. [Google Scholar] [CrossRef] [PubMed]
- Schiller, P.W.; Weltrowska, G.; Nguyen, T.M.-D.; Lemieux, C.; Chung, N.N.; Lu, Y. Conversion of δ-, κ-and μ-Receptor Selective Opioid Peptide Agonists into δ-, κ-and μ-Selective Antagonists. Life Sci. 2003, 73, 691–698. [Google Scholar] [CrossRef]
- Tancredi, T.; Salvadori, S.; Amodeo, P.; Picone, D.; Lazarus, L.H.; Bryant, S.D.; Guerrini, R.; Marzola, G.; Temussi, P.A. Conversion of enkephalin and dermorphin into delta-selective opioid antagonists by single-residue substitution. Eur. J. Biochem. 1994, 224, 241–247. [Google Scholar] [CrossRef]
- Witt, K.A.; Davis, T.P. CNS drug delivery: Opioid peptides and the blood-brain barrier. AAPS J. 2006, 8, E76–E88. [Google Scholar] [CrossRef] [PubMed]
- Lau, J.L.; Dunn, M.K. Therapeutic peptides: Historical perspectives, current development trends, and future directions. Bioorg. Med. Chem. 2018, 26, 2700–2707. [Google Scholar] [CrossRef] [PubMed]
- Gentilucci, L.; De Marco, R.; Cerisoli, L. Chemical modifications designed to improve peptide stability: Incorporation of non-natural amino acids, pseudo-peptide bonds, and cyclization. Curr. Pharm. Des. 2010, 16, 3185–3203. [Google Scholar] [CrossRef] [PubMed]
- Pert, C.B.; Pert, A.; Chang, J.K.; Fong, B.T. (D-Ala2)-Met-enkephalinamide: A potent, long-lasting synthetic pentapeptide analgesic. Science 1976, 194, 330–332. [Google Scholar] [CrossRef]
- Avan, I.; Hall, C.D.; Katritzky, A.R. Peptidomimetics via modifications of amino acids and peptide bonds. Chem. Soc. Rev. 2014, 43, 3575–3594. [Google Scholar] [CrossRef]
- Roberts, L.R.; Brady, K.; Brown, A.; Davey, D.; Feng, L.; Huang, H.; Liu, D.; Malet, L.; McMurray, G.; Phelan, A.; et al. Kappa agonist CovX-Bodies. Bioorg. Med. Chem. Lett. 2012, 22, 4173–4178. [Google Scholar] [CrossRef]
- Kropotova, E.S.; Ivleva, I.S.; Karpenko, M.N.; Mosevitsky, M.I. Design of enkephalin modifications protected from brain extracellular peptidases providing long-term analgesia. Bioorg. Med. Chem. 2020, 28, 115184. [Google Scholar] [CrossRef]
- Beaudeau, J.L.; Blais, V.; Holleran, B.J.; Bergeron, A.; Pineyro, G.; Guerin, B.; Gendron, L.; Dory, Y.L. N-Guanidyl and C-Tetrazole Leu-Enkephalin Derivatives: Efficient Mu and Delta Opioid Receptor Agonists with Improved Pharmacological Properties. ACS Chem. Neurosci. 2019, 10, 1615–1626. [Google Scholar] [CrossRef]
- Weber, S.J.; Abbruscato, T.J.; Brownson, E.A.; Lipkowski, A.W.; Polt, R.; Misicka, A.; Haaseth, R.C.; Bartosz, H.; Hruby, V.J.; Davis, T.P. Assessment of an in vitro blood-brain barrier model using several [Met5]enkephalin opioid analogs. J. Pharmacol. Exp. Ther. 1993, 266, 1649–1655. [Google Scholar]
- Banks, W.A.; Kastin, A.J. Peptides and the blood-brain barrier: Lipophilicity as a predictor of permeability. Brain Res. Bullet. 1985, 15, 287–292. [Google Scholar] [CrossRef]
- Hansen, D.W., Jr.; Stapelfeld, A.; Savage, M.A.; Reichman, M.; Hammond, D.L.; Haaseth, R.C.; Mosberg, H.I. Systemic analgesic activity and delta-opioid selectivity in [2,6-dimethyl-Tyr1,D-Pen2,D-Pen5]enkephalin. J. Med. Chem. 1992, 35, 684–687. [Google Scholar] [CrossRef]
- Weber, S.J.; Greene, D.L.; Sharma, S.D.; Yamamura, H.I.; Kramer, T.H.; Burks, T.F.; Hruby, V.J.; Hersh, L.B.; Davis, T.P. Distribution and analgesia of [3H][D-Pen2, D-Pen5]enkephalin and two halogenated analogs after intravenous administration. J. Pharmacol. Exp. Ther. 1991, 259, 1109–1117. [Google Scholar]
- Chandrakumar, N.S.; Stapelfeld, A.; Beardsley, P.M.; Lopez, O.T.; Drury, B.; Anthony, E.; Savage, M.A.; Williamson, L.N.; Reichman, M. Analogs of the. delta. opioid receptor selective cyclic peptide [cyclic][2-D-penicillamine, 5-D-penicillamine]-enkephalin: 2’, 6’-dimethyltyrosine and Gly3-Phe4 amide bond isostere substitutions. J. Med. Chem. 1992, 35, 2928–2938. [Google Scholar] [CrossRef]
- Jinsmaa, Y.; Miyazaki, A.; Fujita, Y.; Li, T.; Fujisawa, Y.; Shiotani, K.; Tsuda, Y.; Yokoi, T.; Ambo, A.; Sasaki, Y.; et al. Oral bioavailability of a new class of micro-opioid receptor agonists containing 3,6-bis[Dmt-NH(CH(2))(n)]-2(1H)-pyrazinone with central-mediated analgesia. J. Med. Chem. 2004, 47, 2599–2610. [Google Scholar] [CrossRef]
- Okada, Y.; Tsuda, Y.; Fujita, Y.; Yokoi, T.; Sasaki, Y.; Ambo, A.; Konishi, R.; Nagata, M.; Salvadori, S.; Jinsmaa, Y. Unique high-affinity synthetic μ-opioid receptor agonists with central-and systemic-mediated analgesia. J. Med. Chem. 2003, 46, 3201–3209. [Google Scholar] [CrossRef]
- Wang, C.L.; Qiu, T.T.; Yang, D.J.; Yuan, B.Y.; Han, F.T.; Li, L.; Gu, N. Endomorphin-2 analogs with C-terminal esterification produce potent systemic antinociception with reduced tolerance and gastrointestinal side effects. Neuropharmacology 2017, 116, 98–109. [Google Scholar] [CrossRef]
- Zhao, K.; Luo, G.; Zhao, G.M.; Schiller, P.W.; Szeto, H.H. Transcellular transport of a highly polar 3+ net charge opioid tetrapeptide. J. Pharmacol. Exp. Ther. 2003, 304, 425–432. [Google Scholar] [CrossRef]
- Terasaki, T.; Hirai, K.; Sato, H.; Kang, Y.; Tsuji, A. Absorptive-mediated endocytosis of a dynorphin-like analgesic peptide, E-2078 into the blood-brain barrier. J. Pharmacol. Exp. Therap. 1989, 251, 351–357. [Google Scholar]
- Deguchi, Y.; Miyakawa, Y.; Sakurada, S.; Naito, Y.; Morimoto, K.; Ohtsuki, S.; Hosoya, K.I.; Terasaki, T. Blood–brain barrier transport of a novel µ1-specific opioid peptide, H-Tyr-d-Arg-Phe-β-Ala-OH (TAPA). J. Neurochem. 2003, 84, 1154–1161. [Google Scholar] [CrossRef]
- Deguchi, Y.; Naito, Y.; Ohtsuki, S.; Miyakawa, Y.; Morimoto, K.; Hosoya, K.-I.; Sakurada, S.; Terasaki, T. Blood-brain barrier permeability of novel [D-arg2] dermorphin (1–4) analogs: Transport property is related to the slow onset of antinociceptive activity in the central nervous system. J. Pharmacol. Exp. Therap. 2004, 310, 177–184. [Google Scholar] [CrossRef]
- Polt, R.; Dhanasekaran, M.; Keyari, C.M. Glycosylated neuropeptides: A new vista for neuropsychopharmacology? Med. Res. Rev. 2005, 25, 557–585. [Google Scholar] [CrossRef]
- Egleton, R.D.; Mitchell, S.A.; Huber, J.D.; Janders, J.; Stropova, D.; Polt, R.; Yamamura, H.I.; Hruby, V.J.; Davis, T.P. Improved bioavailability to the brain of glycosylated Met-enkephalin analogs. Brain Res. 2000, 881, 37–46. [Google Scholar] [CrossRef]
- Egleton, R.D.; Mitchell, S.A.; Huber, J.D.; Palian, M.M.; Polt, R.; Davis, T.P. Improved blood-brain barrier penetration and enhanced analgesia of an opioid peptide by glycosylation. J. Pharmacol. Exp. Ther. 2001, 299, 967–972. [Google Scholar]
- Li, Y.; Lefever, M.R.; Muthu, D.; Bidlack, J.M.; Bilsky, E.J.; Polt, R. Opioid glycopeptide analgesics derived from endogenous enkephalins and endorphins. Fut. Med. Chem. 2012, 4, 205–226. [Google Scholar] [CrossRef]
- Fichna, J.; Mazur, M.; Grzywacz, D.; Kamysz, W.; Perlikowska, R.; Piekielna, J.; Sobczak, M.; Salaga, M.; Toth, G.; Janecka, A.; et al. Novel glycosylated endomorphin-2 analog produces potent centrally-mediated antinociception in mice after peripheral administration. Bioorg. Med. Chem. Lett. 2013, 23, 6673–6676. [Google Scholar] [CrossRef]
- Ballet, S.; Betti, C.; Novoa, A.; Tomboly, C.; Nielsen, C.U.; Helms, H.C.; Lesniak, A.; Kleczkowska, P.; Chung, N.N.; Lipkowski, A.W.; et al. In Vitro Membrane Permeation Studies and in Vivo Antinociception of Glycosylated Dmt(1)-DALDA Analogues. ACS Med. Chem. Lett. 2014, 5, 352–357. [Google Scholar] [CrossRef]
- Varamini, P.; Mansfeld, F.M.; Blanchfield, J.T.; Wyse, B.D.; Smith, M.T.; Toth, I. Synthesis and biological evaluation of an orally active glycosylated endomorphin-1. J. Med. Chem. 2012, 55, 5859–5867. [Google Scholar] [CrossRef]
- Tomatis, R.; Marastoni, M.; Balboni, G.; Guerrini, R.; Capasso, A.; Sorrentino, L.; Santagada, V.; Caliendo, G.; Lazarus, L.H.; Salvadori, S. Synthesis and pharmacological activity of deltorphin and dermorphin-related glycopeptides. J. Med. Chem. 1997, 40, 2948–2952. [Google Scholar] [CrossRef]
- Negri, L.; Lattanzi, R.; Tabacco, F.; Orru, L.; Severini, C.; Scolaro, B.; Rocchi, R. Dermorphin and deltorphin glycosylated analogues: Synthesis and antinociceptive activity after systemic administration. J. Med. Chem. 1999, 42, 400–404. [Google Scholar] [CrossRef]
- Mosberg, H.I.; Yeomans, L.; Anand, J.P.; Porter, V.; Sobczyk-Kojiro, K.; Traynor, J.R.; Jutkiewicz, E.M. Development of a bioavailable mu opioid receptor (MOPr) agonist, delta opioid receptor (DOPr) antagonist peptide that evokes antinociception without development of acute tolerance. J. Med. Chem. 2014, 57, 3148–3153. [Google Scholar] [CrossRef]
- Palian, M.M.; Boguslavsky, V.I.; O’Brien, D.F.; Polt, R. Glycopeptide-membrane interactions: Glycosyl enkephalin analogues adopt turn conformations by NMR and CD in amphipathic media. J. Am. Chem. Soc. 2003, 125, 5823–5831. [Google Scholar] [CrossRef]
- Witt, K.A.; Huber, J.D.; Egleton, R.D.; Roberts, M.J.; Bentley, M.D.; Guo, L.; Wei, H.; Yamamura, H.I.; Davis, T.P. Pharmacodynamic and pharmacokinetic characterization of poly(ethylene glycol) conjugation to met-enkephalin analog [D-Pen2, D-Pen5]-enkephalin (DPDPE). J. Pharmacol. Exp. Ther. 2001, 298, 848–856. [Google Scholar]
- Lindqvist, A.; Rip, J.; Gaillard, P.J.; Bjorkman, S.; Hammarlund-Udenaes, M. Enhanced brain delivery of the opioid peptide DAMGO in glutathione pegylated liposomes: A microdialysis study. Mol. Pharm. 2013, 10, 1533–1541. [Google Scholar] [CrossRef] [PubMed]
- Greene, D.L.; Hau, V.S.; Abbruscato, T.J.; Bartosz, H.; Misicka, A.; Lipkowski, A.W.; Hom, S.; Gillespie, T.J.; Hruby, V.J.; Davis, T.P. Enkephalin analog prodrugs: Assessment of in vitro conversion, enzyme cleavage characterization and blood-brain barrier permeability. J. Pharmacol. Exp. Ther. 1996, 277, 1366–1375. [Google Scholar] [PubMed]
- Ouyang, H.; Tang, F.; Siahaan, T.J.; Borchardt, R.T. A modified coumarinic acid-based cyclic prodrug of an opioid peptide: Its enzymatic and chemical stability and cell permeation characteristics. Pharm. Res. 2002, 19, 794–801. [Google Scholar] [CrossRef]
- Yang, J.Z.; Chen, W.; Borchardt, R.T. In vitro stability and in vivo pharmacokinetic studies of a model opioid peptide, H-Tyr-D-Ala-Gly-Phe-D-Leu-OH (DADLE), and its cyclic prodrugs. J. Pharmacol. Exp. Ther. 2002, 303, 840–848. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Prokai-Tatrai, K.; Kim, H.-S.; Prokai, L. The utility of oligopeptidase in brain-targeting delivery of an enkephalin analogue by prodrug design. Open Med. Chem. J. 2008, 2, 97. [Google Scholar] [CrossRef]
- Liederer, B.M.; Borchardt, R.T. Stability of oxymethyl-modified coumarinic acid cyclic prodrugs of diastereomeric opioid peptides in biological media from various animal species including human. J. Pharm. Sci. 2005, 94, 2198–2206. [Google Scholar] [CrossRef]
- Wang, J.; Hogenkamp, D.J.; Tran, M.; Li, W.-Y.; Yoshimura, R.F.; Johnstone, T.B.; Shen, W.-C.; Gee, K.W. Reversible lipidization for the oral delivery of leu-enkephalin. J. Drug Target. 2006, 14, 127–136. [Google Scholar] [CrossRef]
- Ogawa, T.; Araki, M.; Miyamae, T.; Okayama, T.; Hagiwara, M.; Sakurada, S.; Morikawa, T. Synthesis and antinociceptive activity of orally active opioid peptides: Improvement of oral bioavailability by esterification. Chem. Pharm. Bull. 2003, 51, 759–771. [Google Scholar] [CrossRef]
- Ogawa, T.; Miyamae, T.; Murayama, K.; Okuyama, K.; Okayama, T.; Hagiwara, M.; Sakurada, S.; Morikawa, T. Synthesis and structure-activity relationships of an orally available and long-acting analgesic peptide, N(alpha)-amidino-Tyr-D-Arg-Phe-MebetaAla-OH (ADAMB). J. Med. Chem. 2002, 45, 5081–5089. [Google Scholar] [CrossRef]
- Machelska, H.; Celik, M.O. Advances in Achieving Opioid Analgesia Without Side Effects. Front. Pharmacol. 2018, 9, 1388. [Google Scholar] [CrossRef]
- Anand, J.P.; Montgomery, D. Multifunctional Opioid Ligands. Handb. Exp. Pharmacol. 2018, 247, 21–51. [Google Scholar] [CrossRef]
- Hruby, V.J. Multivalent peptide and peptidomimetic ligands for the treatment of pain without toxicities and addiction. Peptides 2019, 116, 63–67. [Google Scholar] [CrossRef]
- Dietis, N.; Guerrini, R.; Calo, G.; Salvadori, S.; Rowbotham, D.J.; Lambert, D.G. Simultaneous targeting of multiple opioid receptors: A strategy to improve side-effect profile. Br. J. Anaesth 2009, 103, 38–49. [Google Scholar] [CrossRef]
- Zhu, Y.; King, M.A.; Schuller, A.G.; Nitsche, J.F.; Reidl, M.; Elde, R.P.; Unterwald, E.; Pasternak, G.W.; Pintar, J.E. Retention of supraspinal delta-like analgesia and loss of morphine tolerance in delta opioid receptor knockout mice. Neuron 1999, 24, 243–252. [Google Scholar] [CrossRef] [Green Version]
- Mosberg, H.I.; Yeomans, L.; Harland, A.A.; Bender, A.M.; Sobczyk-Kojiro, K.; Anand, J.P.; Clark, M.J.; Jutkiewicz, E.M.; Traynor, J.R. Opioid peptidomimetics: Leads for the design of bioavailable mixed efficacy mu opioid receptor (MOR) agonist/delta opioid receptor (DOR) antagonist ligands. J. Med. Chem. 2013, 56, 2139–2149. [Google Scholar] [CrossRef]
- Henry, S.; Anand, J.P.; Twarozynski, J.J.; Brinkel, A.C.; Pogozheva, I.D.; Sears, B.F.; Jutkiewicz, E.M.; Traynor, J.R.; Mosberg, H.I. Aromatic–Amine Pendants Produce Highly Potent and Efficacious Mixed Efficacy μ-Opioid Receptor (MOR)/δ-Opioid Receptor (DOR) Peptidomimetics with Enhanced Metabolic Stability. J. Med. Chem. 2020, 63, 1671–1683. [Google Scholar] [CrossRef]
- Lee, Y.S.; Kulkarani, V.; Cowell, S.M.; Ma, S.W.; Davis, P.; Hanlon, K.E.; Vanderah, T.W.; Lai, J.; Porreca, F.; Vardanyan, R.; et al. Development of potent mu and delta opioid agonists with high lipophilicity. J. Med. Chem. 2011, 54, 382–386. [Google Scholar] [CrossRef]
- Cowell, S.M.; Lee, Y.S. Biphalin: The Foundation of Bivalent Ligands. Curr. Med. Chem. 2016, 23, 3267–3284. [Google Scholar] [CrossRef]
- Horan, P.J.; Mattia, A.; Bilsky, E.J.; Weber, S.; Davis, T.P.; Yamamura, H.I.; Malatynska, E.; Appleyard, S.M.; Slaninova, J.; Misicka, A.; et al. Antinociceptive profile of biphalin, a dimeric enkephalin analog. J. Pharmacol. Exp. Ther. 1993, 265, 1446–1454. [Google Scholar]
- Lowery, J.J.; Raymond, T.J.; Giuvelis, D.; Bidlack, J.M.; Polt, R.; Bilsky, E.J. In vivo characterization of MMP-2200, a mixed delta/mu opioid agonist, in mice. J. Pharmacol. Exp. Ther. 2011, 336, 767–778. [Google Scholar] [CrossRef]
- Li, T.; Shiotani, K.; Miyazaki, A.; Tsuda, Y.; Ambo, A.; Sasaki, Y.; Jinsmaa, Y.; Marczak, E.; Bryant, S.D.; Lazarus, L.H.; et al. Bifunctional [2′,6′-dimethyl-L-tyrosine1]endomorphin-2 analogues substituted at position 3 with alkylated phenylalanine derivatives yield potent mixed mu-agonist/delta-antagonist and dual mu-agonist/delta-agonist opioid ligands. J. Med. Chem. 2007, 50, 2753–2766. [Google Scholar] [CrossRef]
- Frederickson, R.C.; Smithwick, E.L.; Shuman, R.; Bemis, K.G. Metkephamid, a systemically active analog of methionine enkephalin with potent opioid alpha-receptor activity. Science 1981, 211, 603–605. [Google Scholar] [CrossRef]
- Burkhardt, C.; Frederickson, R.C.; Pasternak, G.W. Metkephamid (Tyr-D-ala-Gly-Phe-N(Me)Met-NH2), a potent opioid peptide: Receptor binding and analgesic properties. Peptides 1982, 3, 869–871. [Google Scholar] [CrossRef]
- Schiller, P.W.; Schmidt, R.; Weltrowska, G.; Berezowska, I.; Nguyen, T.M.-D.; Dupuis, S.; Chung, N.N.; Lemieux, C.; Wilkes, B.C.; Carpenter, K.A. Conformationally constrained opioid peptide analogs with novel activity profiles. Lett. Peptide Sci. 1998, 5, 209–214. [Google Scholar] [CrossRef]
- Dietis, N.; McDonald, J.; Molinari, S.; Calo, G.; Guerrini, R.; Rowbotham, D.J.; Lambert, D.G. Pharmacological characterization of the bifunctional opioid ligand H-Dmt-Tic-Gly-NH-Bzl (UFP-505). Br. J. Anaesth 2012, 108, 262–270. [Google Scholar] [CrossRef] [Green Version]
- Purington, L.C.; Sobczyk-Kojiro, K.; Pogozheva, I.D.; Traynor, J.R.; Mosberg, H.I. Development and in vitro characterization of a novel bifunctional mu-agonist/delta-antagonist opioid tetrapeptide. ACS Chem. Biol. 2011, 6, 1375–1381. [Google Scholar] [CrossRef]
- Harland, A.A.; Yeomans, L.; Griggs, N.W.; Anand, J.P.; Pogozheva, I.D.; Jutkiewicz, E.M.; Traynor, J.R.; Mosberg, H.I. Further optimization and evaluation of bioavailable, mixed-efficacy μ-opioid receptor (MOR) agonists/δ-opioid receptor (DOR) antagonists: Balancing MOR and DOR affinities. J. Med. Chem. 2015, 58, 8952–8969. [Google Scholar] [CrossRef]
- Henry, S.P.; Fernandez, T.J.; Anand, J.P.; Griggs, N.W.; Traynor, J.R.; Mosberg, H.I. Structural Simplification of a Tetrahydroquinoline-Core Peptidomimetic mu-Opioid Receptor (MOR) Agonist/delta-Opioid Receptor (DOR) Antagonist Produces Improved Metabolic Stability. J. Med. Chem. 2019, 62, 4142–4157. [Google Scholar] [CrossRef]
- Bender, A.M.; Clark, M.J.; Agius, M.P.; Traynor, J.R.; Mosberg, H.I. Synthesis and evaluation of 4-substituted piperidines and piperazines as balanced affinity mu opioid receptor (MOR) agonist/delta opioid receptor (DOR) antagonist ligands. Bioorg. Med. Chem. Lett. 2014, 24, 548–551. [Google Scholar] [CrossRef]
- Lee, Y.S.; Remesic, M.; Ramos-Colon, C.; Wu, Z.; LaVigne, J.; Molnar, G.; Tymecka, D.; Misicka, A.; Streicher, J.M.; Hruby, V.J. Multifunctional Enkephalin Analogs with a New Biological Profile: MOR/DOR Agonism and KOR Antagonism. Biomedicines 2021, 9, 625. [Google Scholar] [CrossRef]
- Perlikowska, R.; Malfacini, D.; Cerlesi, M.C.; Piekielna, J.; Floriot, L.; Henry, T.; Do-Rego, J.C.; Tömböly, C.; Kluczyk, A.; Janecka, A. Pharmacological characterization of endomorphin-2-based cyclic pentapeptides with methylated phenylalanine residues. Peptides 2014, 55, 145–150. [Google Scholar] [CrossRef]
- Gach-Janczak, K.; Piekielna-Ciesielska, J.; Adamska-Bartłomiejczyk, A.; Perlikowska, R.; Kruszyński, R.; Kluczyk, A.; Krzywik, J.; Sukiennik, J.; Cerlesi, M.C.; Calo, G. Synthesis and activity of opioid peptidomimetics with β2-and β3-amino acids. Peptides 2017, 95, 116–123. [Google Scholar] [CrossRef]
- Martinez, V.; Abalo, R. Peripherally acting opioid analgesics and peripherally-induced analgesia. Behav. Pharmacol. 2020, 31, 136–158. [Google Scholar] [CrossRef]
- Zaitseva, N.; Galan, S.; Pavlova, L. Prospects of a search for kappa-opioid receptor agonists with analgesic activity. Pharm. Chem. J. 2018, 51, 843–851. [Google Scholar] [CrossRef]
- Spampinato, S.; Qasem, A.R.; Calienni, M.; Murari, G.; Gentilucci, L.; Tolomelli, A.; Cardillo, G. Antinociception by a peripherally administered novel endomorphin-1 analogue containing beta-proline. Eur. J. Pharmacol. 2003, 469, 89–95. [Google Scholar] [CrossRef]
- Hesselink, J.M.K. CR845 (Difelikefalin), A Kappa Receptors Agonist In Phase III By CARA Therapeutics: A Case Of ‘Spin’In Scientific Writing? J. Pharmacol. Clin. Res. 2017, 2, 555588. [Google Scholar] [CrossRef]
- Wallace, M.S.; Moulin, D.; Clark, A.; Wasserman, R.; Neale, A.; Morley-Forster, P.; Castaigne, J.-P.; Teichman, S. A Phase II, multicenter, randomized, double-blind, placebo-controlled crossover study of CJC-1008—a long-acting, parenteral opioid analgesic—in the treatment of postherpetic neuralgia. J. Opioid. Manag. 2006, 2, 167–173. [Google Scholar] [CrossRef]
- Tiwari, V.; Yang, F.; He, S.Q.; Shechter, R.; Zhang, C.; Shu, B.; Zhang, T.; Tiwari, V.; Wang, Y.; Dong, X.; et al. Activation of Peripheral mu-opioid Receptors by Dermorphin [D-Arg2, Lys4] (1-4) Amide Leads to Modality-preferred Inhibition of Neuropathic Pain. Anesthesiology 2016, 124, 706–720. [Google Scholar] [CrossRef]
- Posner, J.; Moody, S.; Peck, A.; Rutter, D.; Telekes, A. Analgesic, central, cardiovascular and endocrine effects of the enkephalin analogue Tyr-D. Arg-Gly-Phe (4NO 2)-Pro-NH 2 (443C81) in healthy volunteers. Eur. J. Clin. Pharmacol. 1990, 38, 213–218. [Google Scholar] [CrossRef]
- Deeks, E.D. Difelikefalin: First Approval. Drugs 2021, 81, 1937–1944. [Google Scholar] [CrossRef]
- DeWire, S.M.; Yamashita, D.S.; Rominger, D.H.; Liu, G.; Cowan, C.L.; Graczyk, T.M.; Chen, X.T.; Pitis, P.M.; Gotchev, D.; Yuan, C.; et al. A G protein-biased ligand at the mu-opioid receptor is potently analgesic with reduced gastrointestinal and respiratory dysfunction compared with morphine. J. Pharmacol. Exp. Ther. 2013, 344, 708–717. [Google Scholar] [CrossRef]
- Piekielna-Ciesielska, J.; Wtorek, K.; Janecka, A. Biased Agonism as an Emerging Strategy in the Search for Better Opioid Analgesics. Curr. Med. Chem. 2020, 27, 1562–1575. [Google Scholar] [CrossRef]
- He, L.; Gooding, S.W.; Lewis, E.; Felth, L.C.; Gaur, A.; Whistler, J.L. Pharmacological and genetic manipulations at the µ-opioid receptor reveal arrestin-3 engagement limits analgesic tolerance and does not exacerbate respiratory depression in mice. Neuropsychopharmacology 2021, 46, 2241–2249. [Google Scholar] [CrossRef]
- Faouzi, A.; Varga, B.R.; Majumdar, S. Biased opioid ligands. Molecules 2020, 25, 4257. [Google Scholar] [CrossRef]
- Madariaga-Mazón, A.; Marmolejo-Valencia, A.F.; Li, Y.; Toll, L.; Houghten, R.A.; Martinez-Mayorga, K. Mu-Opioid receptor biased ligands: A safer and painless discovery of analgesics? Drug Discov. Today 2017, 22, 1719–1729. [Google Scholar] [CrossRef]
- Piekielna-Ciesielska, J.; Ferrari, F.; Calo, G.; Janecka, A. Cyclopeptide Dmt-[D-Lys-p-CF3-Phe-Phe-Asp]NH2, a novel G protein-biased agonist of the mu opioid receptor. Peptides 2018, 101, 227–233. [Google Scholar] [CrossRef]
- Bella Ndong, D.; Blais, V.; Holleran, B.J.; Proteau-Gagné, A.; Cantin-Savoie, I.; Robert, W.; Nadon, J.F.; Beauchemin, S.; Leduc, R.; Piñeyro, G. Exploration of the fifth position of leu-enkephalin and its role in binding and activating delta (DOP) and mu (MOP) opioid receptors. Peptide Sci. 2019, 111, e24070. [Google Scholar] [CrossRef]
- Sharma, K.K.; Cassell, R.J.; Su, H.; Blaine, A.T. Modulating β Arrestin-2 Recruitment at the δ- and µ-Opioid Receptors; Cambridge Open Engage: Cambridge, UK, 2020. [Google Scholar]
- Cassell, R.J.; Sharma, K.K.; Su, H.; Cummins, B.R.; Cui, H.; Mores, K.L.; Blaine, A.T.; Altman, R.A.; van Rijn, R.M. The Meta-Position of Phe4 in Leu-enkephalin Regulates Potency, Selectivity, Functional Activity, and Signaling Bias at the Delta and Mu Opioid Receptors. Molecules 2019, 24, 4542. [Google Scholar] [CrossRef]
- Kandasamy, R.; Hillhouse, T.M.; Livingston, K.E.; Kochan, K.E.; Meurice, C.; Eans, S.O.; Li, M.-H.; White, A.D.; Roques, B.P.; McLaughlin, J.P. Positive allosteric modulation of the mu-opioid receptor produces analgesia with reduced side effects. Proc. Natl. Acad. Sci. USA 2021, 118, e2000017118. [Google Scholar] [CrossRef]
- Remesic, M.; Hruby, V.J.; Porreca, F.; Lee, Y.S. Recent Advances in the Realm of Allosteric Modulators for Opioid Receptors for Future Therapeutics. ACS Chem. Neurosci. 2017, 8, 1147–1158. [Google Scholar] [CrossRef]
- Cowell, S.M.; Lee, Y.S.; Cain, J.P.; Hruby, V.J. Exploring Ramachandran and chi space: Conformationally constrained amino acids and peptides in the design of bioactive polypeptide ligands. Curr. Med. Chem. 2004, 11, 2785–2798. [Google Scholar] [CrossRef]
- Yamazaki, T.; Ro, S.; Goodman, M.; Chung, N.N.; Schiller, P.W. A topochemical approach to explain morphiceptin bioactivity. J. Med. Chem. 1993, 36, 708–719. [Google Scholar] [CrossRef]
- Granier, S.; Manglik, A.; Kruse, A.C.; Kobilka, T.S.; Thian, F.S.; Weis, W.I.; Kobilka, B.K. Structure of the delta-opioid receptor bound to naltrindole. Nature 2012, 485, 400–404. [Google Scholar] [CrossRef]
- Chavkin, C.; Goldstein, A. Specific receptor for the opioid peptide dynorphin: Structure--activity relationships. Proc. Natl. Acad. Sci. USA 1981, 78, 6543–6547. [Google Scholar] [CrossRef]
- Portoghese, P.S.; Sultana, M.; Takemori, A.E. Design of peptidomimetic delta opioid receptor antagonists using the message-address concept. J. Med. Chem. 1990, 33, 1714–1720. [Google Scholar] [CrossRef] [PubMed]
- Borics, A.; Toth, G. Structural comparison of mu-opioid receptor selective peptides confirmed four parameters of bioactivity. J. Mol. Graph Model 2010, 28, 495–505. [Google Scholar] [CrossRef]
- Lasota, A.; Frączak, O.; Muchowska, A.; Nowakowski, M.; Maciejczyk, M.; Ejchart, A.; Olma, A. Synthesis, Biological Activity, and NMR-Based Structural Studies of Deltorphin I Analogs Modified in Message Domain with a New α, α-Disubstituted Glycines. Chem. Biol. Drug Design 2016, 87, 824–832. [Google Scholar] [CrossRef] [PubMed]
- Gentilucci, L.; Tolomelli, A. Recent advances in the investigation of the bioactive conformation of peptides active at the μ-opioid receptor. Conformational analysis of endomorphins. Curr. Top. Med. Chem. 2004, 4, 105–121. [Google Scholar] [CrossRef] [PubMed]
- Mallareddy, J.R.; Borics, A.; Keresztes, A.; Kover, K.E.; Tourwe, D.; Toth, G. Design, synthesis, pharmacological evaluation, and structure-activity study of novel endomorphin analogues with multiple structural modifications. J. Med. Chem. 2011, 54, 1462–1472. [Google Scholar] [CrossRef]
- Keller, M.; Boissard, C.; Patiny, L.; Chung, N.N.; Lemieux, C.; Mutter, M.; Schiller, P.W. Pseudoproline-containing analogues of morphiceptin and endomorphin-2: Evidence for a cis Tyr-Pro amide bond in the bioactive conformation. J. Med. Chem. 2001, 44, 3896–3903. [Google Scholar] [CrossRef] [PubMed]
- Doi, M.; Asano, A.; Komura, E.; Ueda, Y. The structure of an endomorphin analogue incorporating 1-aminocyclohexane-1-carboxlylic acid for proline is similar to the beta-turn of Leu-enkephalin. Biochem. Biophys. Res. Commun. 2002, 297, 138–142. [Google Scholar] [CrossRef]
- Eguchi, M.; Shen, R.Y.; Shea, J.P.; Lee, M.S.; Kahn, M. Design, synthesis, and evaluation of opioid analogues with non-peptidic beta-turn scaffold: Enkephalin and endomorphin mimetics. J. Med. Chem. 2002, 45, 1395–1398. [Google Scholar] [CrossRef]
- Giordano, C.; Sansone, A.; Masi, A.; Lucente, G.; Punzi, P.; Mollica, A.; Pinnen, F.; Feliciani, F.; Cacciatore, I.; Davis, P.; et al. Synthesis and activity of endomorphin-2 and morphiceptin analogues with proline surrogates in position 2. Eur. J. Med. Chem. 2010, 45, 4594–4600. [Google Scholar] [CrossRef]
- Keresztes, A.; Szucs, M.; Borics, A.; Kover, K.E.; Forro, E.; Fulop, F.; Tomboly, C.; Peter, A.; Pahi, A.; Fabian, G.; et al. New endomorphin analogues containing alicyclic beta-amino acids: Influence on bioactive conformation and pharmacological profile. J. Med. Chem. 2008, 51, 4270–4279. [Google Scholar] [CrossRef]
- Perlikowska, R.; Fichna, J.; Wyrebska, A.; Poels, J.; Vanden Broeck, J.; Toth, G.; Storr, M.; do Rego, J.C.; Janecka, A. Design, synthesis and pharmacological characterization of endomorphin analogues with non-cyclic amino acid residues in position 2. Basic Clin. Pharmacol. Toxicol. 2010, 106, 106–113. [Google Scholar] [CrossRef]
- Torino, D.; Mollica, A.; Pinnen, F.; Lucente, G.; Feliciani, F.; Davis, P.; Lai, J.; Ma, S.W.; Porreca, F.; Hruby, V.J. Synthesis and evaluation of new endomorphin analogues modified at the Pro(2) residue. Bioorg. Med. Chem. Lett. 2009, 19, 4115–4118. [Google Scholar] [CrossRef]
- Staniszewska, R.; Fichna, J.; Gach, K.; Toth, G.; Poels, J.; Vanden Broeck, J.; Janecka, A. Synthesis and biological activity of endomorphin-2 analogs incorporating piperidine-2-, 3- or 4-carboxylic acids instead of proline in position 2. Chem. Biol. Drug Des. 2008, 72, 91–94. [Google Scholar] [CrossRef]
- Perlikowska, R.; Gach, K.; Fichna, J.; Toth, G.; Walkowiak, B.; do-Rego, J.C.; Janecka, A. Biological activity of endomorphin and [Dmt1]endomorphin analogs with six-membered proline surrogates in position 2. Bioorg. Med. Chem. 2009, 17, 3789–3794. [Google Scholar] [CrossRef]
- Fujita, Y.; Tsuda, Y.; Li, T.; Motoyama, T.; Takahashi, M.; Shimizu, Y.; Yokoi, T.; Sasaki, Y.; Ambo, A.; Kita, A.; et al. Development of potent bifunctional endomorphin-2 analogues with mixed mu-/delta-opioid agonist and delta-opioid antagonist properties. J. Med. Chem. 2004, 47, 3591–3599. [Google Scholar] [CrossRef]
- Cardillo, G.; Gentilucci, L.; Tolomelli, A.; Spinosa, R.; Calienni, M.; Qasem, A.R.; Spampinato, S. Synthesis and evaluation of the affinity toward mu-opioid receptors of atypical, lipophilic ligands based on the sequence c[-Tyr-Pro-Trp-Phe-Gly-]. J. Med. Chem. 2004, 47, 5198–5203. [Google Scholar] [CrossRef]
- Honda, T.; Shirasu, N.; Isozaki, K.; Kawano, M.; Shigehiro, D.; Chuman, Y.; Fujita, T.; Nose, T.; Shimohigashi, Y. Differential receptor binding characteristics of consecutive phenylalanines in micro-opioid specific peptide ligand endomorphin-2. Bioorg. Med. Chem. 2007, 15, 3883–3888. [Google Scholar] [CrossRef]
- Mizoguchi, H.; Bagetta, G.; Sakurada, T.; Sakurada, S. Dermorphin tetrapeptide analogs as potent and long-lasting analgesics with pharmacological profiles distinct from morphine. Peptides 2011, 32, 421–427. [Google Scholar] [CrossRef]
- Negri, L.; Melchiorri, P.; Lattanzi, R. Pharmacology of amphibian opiate peptides. Peptides 2000, 21, 1639–1647. [Google Scholar] [CrossRef]
- Chaki, K.; Kawamura, S.; Kisara, K.; Sakurada, S.; Sakurada, T.; Sasaki, Y.; Sato, T.; Susuki, K. Antinociception and physical dependence produced by [D-Arg2] dermorphin tetrapeptide analogues and morphine in rats. Br. J. Pharmacol. 1988, 95, 15–22. [Google Scholar] [CrossRef]
- Sato, T.; Sakurada, S.; Sakurada, T.; Furuta, S.; Nakata, N.; Kisara, K.; Sasaki, Y.; Suzuki, K. Comparison of the antinociceptive effect between D-Arg containing dipeptides and tetrapeptides in mice. Neuropeptides 1984, 4, 269–279. [Google Scholar] [CrossRef]
- Sakurada, S.; Takeda, S.; Sato, T.; Hayashi, T.; Yuki, M.; Kutsuwa, M.; Tan-No, K.; Sakurada, C.; Kisara, K.; Sakurada, T. Selective antagonism by naloxonazine of antinociception by Tyr-D-Arg-Phe-beta-Ala, a novel dermorphin analogue with high affinity at mu-opioid receptors. Eur. J. Pharmacol. 2000, 395, 107–112. [Google Scholar] [CrossRef]
- Schiller, P.W.; Nguyen, T.M.-D.; Berezowska, I.; Dupuis, S.; Weltrowska, G.; Chung, N.N.; Lemieux, C. Synthesis and in vitro opioid activity profiles of DALDA analogues. Eur. J. Med. Chem. 2000, 35, 895–901. [Google Scholar] [CrossRef]
- Vandormael, B.; Fourla, D.-D.; Gramowski-Voß, A.; Kosson, P.; Weiss, D.G.; Schröder, O.H.-U.; Lipkowski, A.; Georgoussi, Z.; Tourwé, D. Superpotent [Dmt1] Dermorphin tetrapeptides containing the 4-aminotetrahydro-2-benzazepin-3-one scaffold with mixed μ/δ opioid receptor agonistic properties. J. Med. Chem. 2011, 54, 7848–7859. [Google Scholar] [CrossRef]
- Chang, K.J.; Lillian, A.; Hazum, E.; Cuatrecasas, P.; Chang, J.K. Morphiceptin (NH4-tyr-pro-phe-pro-COHN2): A potent and specific agonist for morphine (mu) receptors. Science 1981, 212, 75–77. [Google Scholar] [CrossRef]
- Yamazaki, T.; Probsti, A.; Schiller, P.W.; Goodman, M. Biological and conformational studies of [Val4]morphiceptin and [D-Val4]morphiceptin analogs incorporating cis-2-aminocyclopentane carboxylic acid as a peptidomimetic for proline. Int. J. Pept Protein Res. 1991, 37, 364–381. [Google Scholar] [CrossRef]
- Chang, K.J.; Wei, E.T.; Killian, A.; Chang, J.K. Potent morphiceptin analogs: Structure activity relationships and morphine-like activities. J. Pharmacol. Exp. Ther. 1983, 227, 403–408. [Google Scholar]
- Fichna, J.; do-Rego, J.-C.; Costentin, J.; Chung, N.N.; Schiller, P.W.; Kosson, P.; Janecka, A. Opioid receptor binding and in vivo antinociceptive activity of position 3-substituted morphiceptin analogs. Biochem. Biophys. Res. Commun. 2004, 320, 531–536. [Google Scholar] [CrossRef]
- Ambo, A.; Terashima, T.; Sasaki, Y. Novel [D-Arg2]dermorphin(1-4) analogs with mu-opioid receptor antagonist activity. Chem. Pharm. Bull. 2002, 50, 1401–1403. [Google Scholar] [CrossRef]
- Kazmierski, W.; Wire, W.S.; Lui, G.K.; Knapp, R.J.; Shook, J.E.; Burks, T.F.; Yamamura, H.I.; Hruby, V.J. Design and synthesis of somatostatin analogues with topographical properties that lead to highly potent and specific mu opioid receptor antagonists with greatly reduced binding at somatostatin receptors. J. Med. Chem. 1988, 31, 2170–2177. [Google Scholar] [CrossRef]
- Hruby, V.J.; Gehrig, C.A. Recent developments in the design of receptor specific opioid peptides. Med. Res. Rev. 1989, 9, 343–401. [Google Scholar] [CrossRef] [PubMed]
- Fournie-Zaluski, M.C.; Gacel, G.; Maigret, B.; Premilat, S.; Roques, B.P. Structural requirements for specific recognition of mu or delta opiate receptors. Mol. Pharmacol. 1981, 20, 484–491. [Google Scholar] [PubMed]
- Rochon, K.; Proteau-Gagné, A.; Bourassa, P.; Nadon, J.-F.o.; Côté, J.; Bournival, V.r.; Gobeil, F., Jr.; Guérin, B.; Dory, Y.L.; Gendron, L. Preparation and evaluation at the delta opioid receptor of a series of linear leu-enkephalin analogues obtained by systematic replacement of the amides. ACS Chem. Neurosci. 2013, 4, 1204–1216. [Google Scholar] [CrossRef] [PubMed]
- Nadon, J.-F.o.; Rochon, K.; Grastilleur, S.b.; Langlois, G.; Dao, T.T.H.; Blais, V.r.; Guérin, B.; Gendron, L.; Dory, Y.L. Synthesis of Gly-ψ [(Z) CF= CH]-Phe, a Fluoroalkene Dipeptide Isostere, and Its Incorporation into a Leu-enkephalin Peptidomimetic. ACS Chem. Neurosci. 2017, 8, 40–49. [Google Scholar] [CrossRef]
- Karad, S.N.; Pal, M.; Crowley, R.S.; Prisinzano, T.E.; Altman, R.A. Synthesis and Opioid Activity of Tyr1-ψ [(Z) CF= CH]-Gly2 and Tyr1-ψ [(S)/(R)-CF3CH-NH]-Gly2 Leu-enkephalin Fluorinated Peptidomimetics. ChemMedChem 2017, 12, 571–576. [Google Scholar] [CrossRef]
- Haaseth, R.C.; Sobczyk-Kojiro, K.; Medzihradsky, F.; Smith, C.B.; Mosberg, H.I. Single residue modifications of the delta opioid receptor selective peptide,[d-Pen2, d-Pen5]-enkephalin (DPDPE) Correlation of pharmacological effects with structural and conformational features. Int. J. Peptide Protein Res. 1990, 36, 139–146. [Google Scholar] [CrossRef]
- Mosberg, H.I.; Omnaas, J.R.; Medzihradsky, F.; Smith, C.B. Cyclic, disulfide-and dithioether-containing opioid tetrapeptides: Development of a ligard with high delta opioid receptor selectivity and affinity. Life Sci. 1988, 43, 1013–1020. [Google Scholar] [CrossRef]
- Liao, S.; Alfaro-Lopez, J.; Shenderovich, M.D.; Hosohata, K.; Lin, J.; Li, X.; Stropova, D.; Davis, P.; Jernigan, K.A.; Porreca, F. De novo design, synthesis, and biological activities of high-affinity and selective non-peptide agonists of the δ-opioid receptor. J. Med. Chem. 1998, 41, 4767–4776. [Google Scholar] [CrossRef]
- Liao, S.; Shenderovich, M.; Kover, K.E.; Zhang, Z.; Hosohata, K.; Davis, P.; Porreca, F.; Yamamura, H.I.; Hurby, V.J. Synthesis, biology, NMR and conformation studies of the topographically constrained delta-opioid selective peptide analogs of [beta-iPrPhe(3)]deltorphin I. J. Pept. Res. 2001, 57, 257–276. [Google Scholar] [CrossRef]
- Schullery, S.E.; Rodgers, D.W.; Tripathy, S.; Jayamaha, D.E.; Sanvordekar, M.D.; Renganathan, K.; Mousigian, C.; Heyl, D.L. The role of backbone conformation in deltorphin II binding: A QSAR study of new analogues modified in the 5-, 6-positions of the address domain. Bioorg. Med. Chem. 2001, 9, 2633–2642. [Google Scholar] [CrossRef]
- Breveglieri, A.; Guerrini, R.; Salvadori, S.; Bianchi, C.; Bryant, S.D.; Attila, M.; Lazarus, L.H. Design and synthesis of 1-aminocycloalkane-1-carboxylic acid-substituted deltorphin analogues: Unique delta and mu opioid activity in modified peptides. J. Med. Chem. 1996, 39, 773–780. [Google Scholar] [CrossRef]
- Misicka, A.; Lipkowski, A.W.; Horvath, R.; Davis, P.; Yamamura, H.I.; Porreca, F.; Hruby, V.J. Design of cyclic deltorphins and dermenkephalins with a disulfide bridge leads to analogs with high selectivity for. delta.-opioid receptors. J. Med. Chem. 1994, 37, 141–145. [Google Scholar] [CrossRef]
- Cotton, R.; Giles, M.G.; Miller, L.; Shaw, J.S.; Timms, D. ICI 174864: A highly selective antagonist for the opioid delta-receptor. Eur. J. Pharmacol. 1984, 97, 331–332. [Google Scholar] [CrossRef]
- Schiller, P.W.; Nguyen, T.M.; Weltrowska, G.; Wilkes, B.C.; Marsden, B.J.; Lemieux, C.; Chung, N.N. Differential stereochemical requirements of mu vs. delta opioid receptors for ligand binding and signal transduction: Development of a class of potent and highly delta-selective peptide antagonists. Proc. Natl. Acad. Sci. USA 1992, 89, 11871–11875. [Google Scholar] [CrossRef]
- Schiller, P.W.; Weltrowska, G.; Berezowska, I.; Nguyen, T.M.D.; Wilkes, B.C.; Lemieux, C.; Chung, N.N. The TIPP opioid peptide family: Development of δ antagonists, δ agonists, and mixed μ agonist/δ antagonists. Peptide Sci. 1999, 51, 411–425. [Google Scholar] [CrossRef]
- Schiller, P.W.; Fundytus, M.E.; Merovitz, L.; Weltrowska, G.; Nguyen, T.M.-D.; Lemieux, C.; Chung, N.N.; Coderre, T.J. The opioid μ agonist/δ antagonist DIPP-NH2 [Ψ] produces a potent analgesic effect, no physical dependence, and less tolerance than morphine in rats. J. Med. Chem. 1999, 42, 3520–3526. [Google Scholar] [CrossRef]
- Pagé, D.; Naismith, A.; Schmidt, R.; Coupal, M.; Labarre, M.; Gosselin, M.; Bellemare, D.; Payza, K.; Brown, W. Novel C-terminus modifications of the Dmt-Tic motif: A new class of dipeptide analogues showing altered pharmacological profiles toward the opioid receptors. J. Med. Chem. 2001, 44, 2387–2390. [Google Scholar] [CrossRef]
- Salvadori, S.; Attila, M.; Balboni, G.; Bianchi, C.; Bryant, S.D.; Crescenzi, O.; Guerrini, R.; Picone, D.; Tancredi, T.; Temussi, P.A. δ Opioidmimetic antagonists: Prototypes for designing a new generation of ultraselective opioid peptides. Mol. Med. 1995, 1, 678–689. [Google Scholar] [CrossRef]
- Lee, Y.S.; Qu, H.C.; Davis, P.; Ma, S.W.; Vardanyan, R.; Lai, J.; Porreca, F.; Hruby, V.J. Chiral Effect of a Phe Residue in Position 3 of the Dmt(1)-L(or D)-Tic(2) Analogues on Opioid Functional Activities. ACS Med. Chem. Lett. 2013, 4, 656–659. [Google Scholar] [CrossRef]
- Van den Eynde, I.; Laus, G.; Schiller, P.W.; Kosson, P.; Chung, N.N.; Lipkowski, A.W.; Tourwé, D. A new structural motif for μ-opioid antagonists. J. Med. Chem. 2005, 48, 3644–3648. [Google Scholar] [CrossRef]
- Aldrich, J.V.; McLaughlin, J.P. Peptide kappa opioid receptor ligands: Potential for drug development. AAPS J. 2009, 11, 312–322. [Google Scholar] [CrossRef]
- Dalefield, M.L.; Scouller, B.; Bibi, R.; Kivell, B.M. The Kappa Opioid Receptor: A Promising Therapeutic Target for Multiple Pathologies. Front. Pharmacol. 2022, 13, 837671. [Google Scholar] [CrossRef]
- Aldrich, J.V.; McLaughlin, J.P. Peptide Kappa opioid receptor ligands and their potential for drug development. In The Kappa Opioid Receptor; Liu-Chen, L.Y., Inan, S., Eds.; Springer: Berlin, Germany, 2021; Volume 271. [Google Scholar]
- Yoshino, H.; Nakazawa, T.; Arakawa, Y.; Kaneko, T.; Tsuchiya, Y.; Matsunaga, M.; Araki, S.; Ikeda, M.; Yamatsu, K.; Tachibana, S. Synthesis and structure-activity relationships of dynorphin A-(1-8) amide analogs. J. Med. Chem. 1990, 33, 206–212. [Google Scholar] [CrossRef]
- Nakazawa, T.; Furuya, Y.; Kaneko, T.; Yamatsu, K.; Yoshino, H.; Tachibana, S. Analgesia produced by E-2078, a systemically active dynorphin analog, in mice. J. Pharmacol. Exp. Ther. 1990, 252, 1247–1254. [Google Scholar]
- Hiramatsu, M.; Inoue, K.; Ambo, A.; Sasaki, Y.; Kameyama, T. Long-lasting antinociceptive effects of a novel dynorphin analogue, Tyr-D-Ala-Phe-Leu-Arg ψ (CH2NH) Arg-NH2, in mice. Br. J. Pharmacol. 2001, 132, 1948–1956. [Google Scholar] [CrossRef]
- Ronsisvalle, G.; Pappalardo, M.; Carboni, L.; Vittorio, F.; Pasquinucci, L.; Marrazzo, A.; Cacciaguerra, S.; Spampinato, S. Peptidomimetics of the κ-opioid receptor. A hybrid MPCB/peptide ligand (MPCB-RRI) binds κ cloned receptor with nanomolar affinity. Analgesia 1996, 2, 283–286. [Google Scholar]
- Binder, W.; Machelska, H.; Mousa, S.; Schmitt, T.; Rivière, P.J.; Junien, J.-L.; Stein, C.; Schäfer, M. Analgesic and antiinflammatory effects of two novel κ-opioid peptides. Anesth. J. Am. Soc. Anesthesiol. 2001, 94, 1034–1044. [Google Scholar] [CrossRef]
- Vanderah, T.W.; Largent-Milnes, T.; Lai, J.; Porreca, F.; Houghten, R.A.; Menzaghi, F.; Wisniewski, K.; Stalewski, J.; Sueiras-Diaz, J.; Galyean, R.; et al. Novel D-amino acid tetrapeptides produce potent antinociception by selectively acting at peripheral kappa-opioid receptors. Eur. J. Pharmacol. 2008, 583, 62–72. [Google Scholar] [CrossRef]
- Arendt-Nielsen, L.; Olesen, A.E.; Staahl, C.; Menzaghi, F.; Kell, S.; Wong, G.Y.; Drewes, A.M. Analgesic Efficacy of Peripheral κ-Opioid Receptor Agonist CR665 Compared to Oxycodone in a Multi-modal, Multi-tissue Experimental Human Pain ModelSelective Effect on Visceral Pain. Anesth. J. Am. Soc. Anesthesiol. 2009, 111, 616–624. [Google Scholar] [CrossRef]
- Dooley, C.T.; Ny, P.; Bidlack, J.M.; Houghten, R.A. Selective ligands for the μ, δ, and κ opioid receptors identified from a single mixture based tetrapeptide positional scanning combinatorial library. J. Biol. Chem. 1998, 273, 18848–18856. [Google Scholar] [CrossRef]
- Choi, H.; Murray, T.F.; DeLander, G.E.; Schmidt, W.K.; Aldrich, J.V. Synthesis and opioid activity of [D-Pro10]dynorphin A-(1-11) analogues with N-terminal alkyl substitution. J. Med. Chem. 1997, 40, 2733–2739. [Google Scholar] [CrossRef]
- Patkar, K.A.; Murray, T.F.; Aldrich, J.V. The Effects of C-Terminal Modifications on the Opioid Activity of [N-BenzylTyr1] Dynorphin A-(1− 11) Analogues. J. Med. Chem. 2009, 52, 6814–6821. [Google Scholar] [CrossRef]
- Vig, B.S.; Murray, T.F.; Aldrich, J.V. Synthesis and opioid activity of side-chain-to-side-chain cyclic dynorphin A-(1− 11) amide analogues cyclized between positions 2 and 5. 1. Substitutions in position 3. J. Med. Chem. 2004, 47, 446–455. [Google Scholar] [CrossRef]
- Lu, Y.; Nguyen, T.M.; Weltrowska, G.; Berezowska, I.; Lemieux, C.; Chung, N.N.; Schiller, P.W. [2′,6′-Dimethyltyrosine]dynorphin A(1-11)-NH2 analogues lacking an N-terminal amino group: Potent and selective kappa opioid antagonists. J. Med. Chem. 2001, 44, 3048–3053. [Google Scholar] [CrossRef]
- Corbett, A.D.; Gillan, M.G.; Kosterlitz, H.W.; McKnight, A.T.; Paterson, S.J.; Robson, L.E. Selectivities of opioid peptide analogues as agonists and antagonists at the delta-receptor. Br. J. Pharmacol. 1984, 83, 271–279. [Google Scholar] [CrossRef]
- Kreil, G.; Barra, D.; Simmaco, M.; Erspamer, V.; Erspamer, G.F.; Negri, L.; Severini, C.; Corsi, R.; Melchiorri, P. Deltorphin, a novel amphibian skin peptide with high selectivity and affinity for δ opioid receptors. Eur. J. Pharmacol. 1989, 162, 123–128. [Google Scholar] [CrossRef]
- McFadyen, I.; Ho, J.; Mosberg, H.I.; Traynor, J.R. Modifications of the cyclic mu receptor selective tetrapeptide Tyr-c [d-Cys-Phe-d-Pen] NH2 (Et): Effects on opioid receptor binding and activation. J. Peptide Res. 2000, 55, 255–261. [Google Scholar] [CrossRef]
- Yaksh, T.L.; Malmberg, A.B.; Ro, S.; Schiller, P.; Goodman, M. Characterization of the spinal antinociceptive activity of constrained peptidomimetic opioids. J. Pharmacol. Exp. Ther. 1995, 275, 63–72. [Google Scholar]
- Brantl, V.; Pfeiffer, A.; Herz, A.; Henschen, A.; Lottspeich, F. Antinociceptive potencies of β-casomorphin analogs as compared to their affinities towards μ and δ opiate receptor sites in brain and periphery. Peptides 1982, 3, 793–797. [Google Scholar] [CrossRef]
- Weber, E.; Esch, F.; Böhlen, P.; Paterson, S.; Corbett, A.; McKnight, A.; Kosterlitz, H.; Barchas, J.; Evans, C. Metorphamide: Isolation, structure, and biologic activity of an amidated opioid octapeptide from bovine brain. Proc. Natl. Acad. Sci. USA 1983, 80, 7362–7366. [Google Scholar] [CrossRef]
- Hruby, V.J.; Bartosz-Bechowski, H.; Davis, P.; Slaninova, J.; Zalewska, T.; Stropova, D.; Porreca, F.; Yamamura, H.I. Cyclic enkephalin analogues with exceptional potency and selectivity for δ-opioid receptors. J. Med. Chem. 1997, 40, 3957–3962. [Google Scholar] [CrossRef]
- Mosberg, H.I.; Lomize, A.L.; Wang, C.; Kroona, H.; Heyl, D.L.; Sobczyk-Kojiro, K.; Ma, W.; Mousigian, C.; Porreca, F. Development of a Model for the. delta. Opioid Receptor Pharmacophore. 1. Conformationally Restricted Tyr1 Replacements in the Cyclic. delta. Receptor Selective Tetrapeptide Tyr-c [D-Cys-Phe-D-Pen] OH (JOM-13). J. Med. Chem. 1994, 37, 4371–4383. [Google Scholar] [CrossRef]
- Gacel, G.; Fournie-Zaluski, M.-C.; Roques, B.P. D-Tyr—Ser—Gly—Phe—Leu—Thr, a highly preferential ligand for δ-opiate receptors. FEBS Lett. 1980, 118, 245–247. [Google Scholar] [CrossRef]
- Raynor, K.; Kong, H.; Chen, Y.; Yasuda, K.; Yu, L.; Bell, G.I.; Reisine, T. Pharmacological characterization of the cloned kappa-, delta-, and mu-opioid receptors. Mol. Pharmacol. 1994, 45, 330–334. [Google Scholar]
- Sanchez-Blazquez, P.; Garzon, J.; Lee, N. [Leu5] enkephalin containing peptides derived from a common precursor: Evaluation of opioid activity in in vitro bioassays. Eur. J. Pharmacol. 1984, 98, 389–396. [Google Scholar] [CrossRef]
- Lipkowski, A.W.; Misicka, A.; Davis, P.; Stropova, D.; Janders, J.; Lachwa, M.; Porreca, F.; Yamamura, H.I.; Hruby, V.J. Biological activity of fragments and analogues of the potent dimeric opioid peptide, biphalin. Bioorg. Med. Chem. Lett. 1999, 9, 2763–2766. [Google Scholar] [CrossRef]
- Kawasaki, A.M.; Knapp, R.J.; Walton, A.; Wire, W.S.; Zalewska, T.; Yamamura, H.I.; Porreca, F.; Burks, T.F.; Hruby, V.J. Syntheses, opioid binding affinities, and potencies of dynorphin A analogues substituted in positions 1, 6, 7, 8 and 10. Int. J. Peptide Protein Res. 1993, 42, 411–419. [Google Scholar] [CrossRef]
- Schlechtingen, G.; Zhang, L.; Maycock, A.; DeHaven, R.N.; Daubert, J.D.; Cassel, J.; Chung, N.N.; Schiller, P.W.; Goodman, M. [Pro3] Dyn A (1−11)-NH2: A Dynorphin Analogue with High Selectivity for the κ Opioid Receptor. J. Med. Chem. 2000, 43, 2698–2702. [Google Scholar] [CrossRef]
- Albert-Vartanian, A.; Boyd, M.R.; Hall, A.L.; Morgado, S.J.; Nguyen, E.; Nguyen, V.P.H.; Patel, S.P.; Russo, L.J.; Shao, A.J.; Raffa, R.B. Will peripherally restricted kappa-opioid receptor agonists (pKORA s) relieve pain with less opioid adverse effects and abuse potential? J. Clin. Pharm. Ther. 2016, 41, 371–382. [Google Scholar] [CrossRef]
- Bennett, M.A.; Murray, T.F.; Aldrich, J.V. Identification of arodyn, a novel acetylated dynorphin A-(1− 11) analogue, as a κ opioid receptor antagonist. J. Med. Chem. 2002, 45, 5617–5619. [Google Scholar] [CrossRef]
- Patkar, K.A.; Yan, X.; Murray, T.F.; Aldrich, J.V. [N α-BenzylTyr, c yclo (d-Asp5, Dap8)]-dynorphin A-(1− 11) NH2 Cyclized in the “Address” Domain Is a Novel κ-Opioid Receptor Antagonist. J. Med. Chem. 2005, 48, 4500–4503. [Google Scholar] [CrossRef] [PubMed]
- Zuckermann, R.N.; Martin, E.J.; Spellmeyer, D.C.; Stauber, G.B.; Shoemaker, K.R.; Kerr, J.M.; Figliozzi, G.M.; Goff, D.A.; Siani, M.A.; Simon, R.J.; et al. Discovery of nanomolar ligands for 7-transmembrane G-protein-coupled receptors from a diverse N-(substituted)glycine peptoid library. J. Med. Chem. 1994, 37, 2678–2685. [Google Scholar] [CrossRef] [PubMed]
- Simon, R.J.; Kania, R.S.; Zuckermann, R.N.; Huebner, V.D.; Jewell, D.A.; Banville, S.; Ng, S.; Wang, L.; Rosenberg, S.; Marlowe, C.K.; et al. Peptoids: A modular approach to drug discovery. Proc. Natl. Acad. Sci. USA 1992, 89, 9367–9371. [Google Scholar] [CrossRef] [PubMed]
- Biondi, L.; Giannini, E.; Filira, F.; Gobbo, M.; Marastoni, M.; Negri, L.; Scolaro, B.; Tomatisc, R.; Rocchi, R. Synthesis, conformation and biological activity of dermorphin and deltorphin I analogues containing N-alkylglycine in place of residues in position 1, 3, 5 and 6. J. Pept. Sci. 2003, 9, 638–648. [Google Scholar] [CrossRef] [PubMed]
- Wilczyńska, D.; Kosson, P.; Kwasiborska, M.; Ejchart, A.; Olma, A. Synthesis and receptor binding of opioid peptide analogues containing β3-homo-amino acids. J. Peptide Sci. 2009, 15, 777–782. [Google Scholar] [CrossRef] [PubMed]
- Chorev, M. The partial retro–inverso modification: A road traveled together. Pept. Sci. Orig. Res. Biomol. 2005, 80, 67–84. [Google Scholar] [CrossRef] [PubMed]
- Salvadori, S.; Marastoni, M.; Balboni, G.; Sarto, G.P.; Tomatis, R. Synthesis and pharmacological activity of partially modified retro-inverso dermorphin tetrapeptides. J. Med. Chem. 1985, 28, 769–774. [Google Scholar] [CrossRef]
- Remesic, M.; Lee, Y.S.; Hruby, V.J. Cyclic Opioid Peptides. Curr. Med. Chem. 2016, 23, 1288–1303. [Google Scholar] [CrossRef]
- Piekielna, J.; Perlikowska, R.; Gach, K.; Janecka, A. Cyclization in opioid peptides. Curr Drug Targets 2013, 14, 798–816. [Google Scholar] [CrossRef]
- Pencheva, N.; Milanov, P.; Vezenkov, L.; Pajpanova, T.; Naydenova, E. Opioid profiles of Cys2-containing enkephalin analogues. Eur. J. Pharmacol. 2004, 498, 249–256. [Google Scholar] [CrossRef]
- Rew, Y.; Malkmus, S.; Svensson, C.; Yaksh, T.L.; Chung, N.N.; Schiller, P.W.; Cassel, J.A.; DeHaven, R.N.; Taulane, J.P.; Goodman, M. Synthesis and biological activities of cyclic lanthionine enkephalin analogues: Delta-opioid receptor selective ligands. J. Med. Chem. 2002, 45, 3746–3754. [Google Scholar] [CrossRef]
- Mollica, A.; Guardiani, G.; Davis, P.; Ma, S.W.; Porreca, F.; Lai, J.; Mannina, L.; Sobolev, A.P.; Hruby, V.J. Synthesis of stable and potent delta/mu opioid peptides: Analogues of H-Tyr-c[D-Cys-Gly-Phe-D-Cys]-OH by ring-closing metathesis. J. Med. Chem. 2007, 50, 3138–3142. [Google Scholar] [CrossRef]
- Berezowska, I.; Chung, N.N.; Lemieux, C.; Wilkes, B.C.; Schiller, P.W. Dicarba analogues of the cyclic enkephalin peptides H-Tyr-c[D-Cys-Gly-Phe-D(or L)-Cys]NH(2) retain high opioid activity. J. Med. Chem. 2007, 50, 1414–1417. [Google Scholar] [CrossRef]
- Pawlak, D.; Oleszczuk, M.; Wójcik, J.; Pachulska, M.; Chung, N.N.; Schiller, P.W.; Izdebski, J. Highly potent side-chain to side-chain cyclized enkephalin analogues containing a carbonyl bridge: Synthesis, biology and conformation. J. Peptide Sci. Off. Publ. Eur. Peptide Soc. 2001, 7, 128–140. [Google Scholar] [CrossRef]
- Piekielna, J.; Kluczyk, A.; Gentilucci, L.; Cerlesi, M.C.; Tomböly, C.; Łapiński, K.; Janecki, T.; Janecka, A. Ring size in cyclic endomorphin-2 analogs modulates receptor binding affinity and selectivity. Organ. Biomol. Chem. 2015, 13, 6039–6046. [Google Scholar] [CrossRef]
- Zadina, J.E.; Nilges, M.R.; Morgenweck, J.; Zhang, X.; Hackler, L.; Fasold, M.B. Endomorphin analog analgesics with reduced abuse liability, respiratory depression, motor impairment, tolerance, and glial activation relative to morphine. Neuropharmacology 2016, 105, 215–227. [Google Scholar] [CrossRef]
- Purington, L.C.; Pogozheva, I.D.; Traynor, J.R.; Mosberg, H.I. Pentapeptides displaying μ opioid receptor agonist and δ opioid receptor partial agonist/antagonist properties. J. Med. Chem. 2009, 52, 7724–7731. [Google Scholar] [CrossRef]
- Fichna, J.; Perlikowska, R.; Wyrebska, A.; Gach, K.; Piekielna, J.; do-Rego, J.C.; Toth, G.; Kluczyk, A.; Janecki, T.; Janecka, A. Effect of 2′,6′-dimethyl-L-tyrosine (Dmt) on pharmacological activity of cyclic endomorphin-2 and morphiceptin analogs. Bioorg. Med. Chem. 2011, 19, 6977–6981. [Google Scholar] [CrossRef]
- Zielińska, M.; Chen, C.; Mokrowiecka, A.; Cygankiewicz, A.I.; Zakrzewski, P.K.; Sałaga, M.; Małecka-Panas, E.; Wlaź, P.; Krajewska, W.M.; Fichna, J. Orally administered novel cyclic pentapeptide P-317 alleviates symptoms of diarrhoea-predominant irritable bowel syndrome. J. Pharm. Pharmacol. 2015, 67, 244–254. [Google Scholar] [CrossRef]
- Burden, J.E.; Davis, P.; Porreca, F.; Spatola, A.F. Synthesis and biological activities of YkFA analogues: Effects of position 4 substitutions and altered ring size on in vitro opioid activity. Bioorg. Med. Chem. Lett. 2002, 12, 213–216. [Google Scholar] [CrossRef]
- Shreder, K.; Zhang, L.; Dang, T.; Yaksh, T.L.; Umeno, H.; DeHaven, R.; Daubert, J.; Goodman, M. Synthesis and biological activity of a novel methylamine-bridged enkephalin analogue (MABE): A new route to cyclic peptides and peptidomimetics. J. Med. Chem. 1998, 41, 2631–2635. [Google Scholar] [CrossRef]
- Kotlinska, J.; Bochenski, M.; Lagowska-Lenard, M.; Gibula-Bruzda, E.; Witkowska, E.; Izdebski, J. Enkephalin derivative, cyclo [Nε, Nβ-carbonyl-D-Lys2, Dap5] enkephalinamide (CUENK6), induces a highly potent antinociception in rats. Neuropeptides 2009, 43, 221–228. [Google Scholar] [CrossRef]
- Stefanucci, A.; Carotenuto, A.; Macedonio, G.; Novellino, E.; Pieretti, S.; Marzoli, F.; Szucs, E.; Erdei, A.I.; Zador, F.; Benyhe, S.; et al. Cyclic Biphalin Analogues Incorporating a Xylene Bridge: Synthesis, Characterization, and Biological Profile. ACS Med. Chem. Lett. 2017, 8, 858–863. [Google Scholar] [CrossRef]
- Mollica, A.; Davis, P.; Ma, S.-W.; Porreca, F.; Lai, J.; Hruby, V.J. Synthesis and biological activity of the first cyclic biphalin analogues. Bioorg. Med. Chem. letters 2006, 16, 367–372. [Google Scholar] [CrossRef]
- Remesic, M.; Macedonio, G.; Mollica, A.; Porreca, F.; Hruby, V.; Lee, Y.S. Cyclic biphalin analogues with a novel linker lead to potent agonist activities at mu, delta, and kappa opioid receptors. Bioorg. Med. Chem. 2018, 26, 3664–3667. [Google Scholar] [CrossRef]
- Vig, B.S.; Murray, T.F.; Aldrich, J.V. A novel N-terminal cyclic dynorphin A analogue cyclo(N,5)[Trp(3),Trp(4),Glu(5)] dynorphin A-(1-11)NH(2) that lacks the basic N-terminus. J. Med. Chem. 2003, 46, 1279–1282. [Google Scholar] [CrossRef]
- Fang, W.J.; Cui, Y.; Murray, T.F.; Aldrich, J.V. Design, synthesis, and pharmacological activities of dynorphin A analogues cyclized by ring-closing metathesis. J. Med. Chem. 2009, 52, 5619–5625. [Google Scholar] [CrossRef]
- Adamska-Bartłomiejczyk, A.; Lipiński, P.F.; Piekielna-Ciesielska, J.; Kluczyk, A.; Janecka, A. Pharmacological profile and molecular modeling of cyclic opioid analogs incorporating various phenylalanine derivatives. ChemMedChem 2020, 15, 1322–1329. [Google Scholar] [CrossRef]
- Przydzial, M.; Pogozheva, I.; Ho, J.; Bosse, K.; Sawyer, E.; Traynor, J.R.; Mosberg, H.I. Design of high affinity cyclic pentapeptide ligands for κ-opioid receptors. J. Peptide Res. 2005, 66, 255–262. [Google Scholar] [CrossRef]
- Piekielna, J.; Gentilucci, L.; De Marco, R.; Perlikowska, R.; Adamska, A.; Olczak, J.; Mazur, M.; Artali, R.; Modranka, J.; Janecki, T. Cyclic side-chain-linked opioid analogs utilizing cis-and trans-4-aminocyclohexyl-D-alanine. Bioorg. Med. Chem. 2014, 22, 6545–6551. [Google Scholar] [CrossRef]
- Touati-Jallabe, Y.; Bojnik, E.; Legrand, B.; Mauchauffée, E.; Chung, N.N.; Schiller, P.W.; Benyhe, S.; Averlant-Petit, M.-C.; Martinez, J.; Hernandez, J.-F.o. Cyclic enkephalins with a diversely substituted guanidine bridge or a thiourea bridge: Synthesis, biological and structural evaluations. J. Med. Chem. 2013, 56, 5964–5973. [Google Scholar] [CrossRef]
- Lu, Y.; Lum, T.K.; Leow Augustine, Y.W.; Weltrowska, G.; Nguyen, T.M.-D.; Lemieux, C.; Chung, N.N.; Schiller, P.W. Replacement of the N-terminal tyrosine residue in opioid peptides with 3-(2, 6-dimethyl-4-carbamoylphenyl) propanoic acid (Dcp) results in novel opioid antagonists. J. Med. Chem. 2006, 49, 5382–5385. [Google Scholar] [CrossRef]
- Lee, Y.S.; Petrov, R.; Park, C.K.; Ma, S.-w.; Davis, P.; Lai, J.; Porreca, F.; Vardanyan, R.; Hruby, V.J. Development of novel enkephalin analogues that have enhanced opioid activities at both μ and δ opioid receptors. J. Med. Chem. 2007, 50, 5528–5532. [Google Scholar] [CrossRef]
- Wiszniewska, A.; Kunce, D.; Chung, N.N.; Schiller, P.W.; Izdebski, J. p-Nitrophenoxycarbonyl derivatives of Boc-protected diaminoalkanes in the synthesis of enkephalin peptidomimetics. J. Pept. Sci. 2005, 11, 579–583. [Google Scholar] [CrossRef]
- Sharma, K.K.; Cassell, R.J.; Meqbil, Y.J.; Su, H.; Blaine, A.T.; Cummins, B.R.; Mores, K.L.; Johnson, D.K.; van Rijn, R.M.; Altman, R.A. Modulating β-arrestin 2 recruitment at the δ-and μ-opioid receptors using peptidomimetic ligands. RSC Med. Chem. 2021, 12, 1958–1967. [Google Scholar] [CrossRef]
- Bankowski, K.; Michalak, O.M.; Lesniak, A.; Filip, K.E.; Cmoch, P.; Szewczuk, Z.; Stefanowicz, P.; Izdebski, J. N-terminal guanidinylation of the cyclic 1,4-ureido-deltorphin analogues: The synthesis, receptor binding studies, and resistance to proteolytic digestion. J. Pept. Sci. 2015, 21, 467–475. [Google Scholar] [CrossRef]
- Hazum, E.; Chang, K.-J.; Leighton, H.; Lever, O.W., Jr.; Cuatrecasas, P. Increased biological activity of dimers of oxymorphone and enkephalin: Possible role of receptor crosslinking. Biochem. Biophys. Res. Commun. 1982, 104, 347–353. [Google Scholar] [CrossRef]
- Dyniewicz, J.; Lipinski, P.F.; Kosson, P.; Lesniak, A.; Bochynska-Czyz, M.; Muchowska, A.; Tourwe, D.; Ballet, S.; Misicka, A.; Lipkowski, A.W. Hydrazone Linker as a Useful Tool for Preparing Chimeric Peptide/Nonpeptide Bifunctional Compounds. ACS Med. Chem. Lett. 2017, 8, 73–77. [Google Scholar] [CrossRef]
- Weltrowska, G.; Lemieux, C.; Chung, N.; Schiller, P. A chimeric opioid peptide with mixed μ agonist/δ antagonist properties. J. Peptide Res. 2004, 63, 63–68. [Google Scholar] [CrossRef]
- Gomes, I.; IJzerman, A.P.; Ye, K.; Maillet, E.L.; Devi, L.A. G protein-coupled receptor heteromerization: A role in allosteric modulation of ligand binding. Mol. Pharmacol. 2011, 79, 1044–1052. [Google Scholar] [CrossRef]
- Wiszniewska, A.; Kunce, D.; Chung, N.N.; Schiller, P.W.; Izdebski, J. Synthesis of peptidomimetics: An evaluation of p-nitrophenyl carbamate of ethylenediamine. Lett. Peptide Sci. 2003, 10, 33–39. [Google Scholar] [CrossRef]
- Sinisi, R.; Ghilardi, A.; Ruiu, S.; Lazzari, P.; Malpezzi, L.; Sani, M.; Pani, L.; Zanda, M. Synthesis and in vitro evaluation of trifluoroethylamine analogues of enkephalins. ChemMedChem 2009, 4, 1416–1420. [Google Scholar] [CrossRef] [PubMed]
- Blomberg, D.; Kreye, P.; Fowler, C.; Brickmann, K.; Kihlberg, J. Synthesis and biological evaluation of leucine enkephalin turn mimetics. Organ. Biomol. Chem. 2006, 4, 416–423. [Google Scholar] [CrossRef] [PubMed]
- Altman, R.A.; Sharma, K.K.; Rajewski, L.G.; Toren, P.C.; Baltezor, M.J.; Pal, M.; Karad, S.N. Tyr1-ψ [(Z) CF═ CH]-Gly2 Fluorinated Peptidomimetic Improves Distribution and Metabolism Properties of Leu-Enkephalin. ACS Chem. Neurosci. 2018, 9, 1735–1742. [Google Scholar] [CrossRef]
- Chingle, R.; Mulumba, M.; Chung, N.N.; Nguyen, T.M.-D.; Ong, H.; Ballet, S.; Schiller, P.W.; Lubell, W.D. Solid-Phase Azopeptide Diels–Alder Chemistry for Aza-pipecolyl Residue Synthesis To Study Peptide Conformation. J. Organ. Chem. 2019, 84, 6006–6016. [Google Scholar] [CrossRef]
- Cabrele, C.; Martinek, T.s.A.; Reiser, O.; Berlicki, Ł. Peptides containing β-amino acid patterns: Challenges and successes in medicinal chemistry. J. Med. Chem. 2014, 57, 9718–9739. [Google Scholar] [CrossRef]
- Cardillo, G.; Gentilucci, L.; Qasem, A.R.; Sgarzi, F.; Spampinato, S. Endomorphin-1 analogues containing beta-proline are mu-opioid receptor agonists and display enhanced enzymatic hydrolysis resistance. J. Med. Chem. 2002, 45, 2571–2578. [Google Scholar] [CrossRef]
- Cardillo, G.; Gentilucci, L.; Melchiorre, P.; Spampinato, S. Synthesis and binding activity of endomorphin-1 analogues containing beta-amino acids. Bioorg. Med. Chem. Lett. 2000, 10, 2755–2758. [Google Scholar] [CrossRef]
- Lesma, G.; Salvadori, S.; Airaghi, F.; Bojnik, E.; Borsodi, A.; Recca, T.; Sacchetti, A.; Balboni, G.; Silvani, A. Synthesis, pharmacological evaluation and conformational investigation of endomorphin-2 hybrid analogues. Mol. Divers 2013, 17, 19–31. [Google Scholar] [CrossRef]
- Lesma, G.; Salvadori, S.; Airaghi, F.; Murray, T.F.; Recca, T.; Sacchetti, A.; Balboni, G.; Silvani, A. Structural and Biological Exploration of Phe3–Phe4-Modified Endomorphin-2 Peptidomimetics. Med. Chem. Lett. 2013, 4, 795–799. [Google Scholar] [CrossRef]
- Wang, Y.; Xing, Y.; Liu, X.; Ji, H.; Kai, M.; Chen, Z.; Yu, J.; Zhao, D.; Ren, H.; Wang, R. A new class of highly potent and selective endomorphin-1 analogues containing alpha-methylene-beta-aminopropanoic acids (map). J. Med. Chem. 2012, 55, 6224–6236. [Google Scholar] [CrossRef]
- Hu, M.; Giulianotti, M.A.; McLaughlin, J.P.; Shao, J.; Debevec, G.; Maida, L.E.; Geer, P.; Cazares, M.; Misler, J.; Li, L.; et al. Synthesis and biological evaluations of novel endomorphin analogues containing alpha-hydroxy-beta-phenylalanine (AHPBA) displaying mixed mu/delta opioid receptor agonist and delta opioid receptor antagonist activities. Eur. J. Med. Chem. 2015, 92, 270–281. [Google Scholar] [CrossRef]
- Bozu, B.; Fulop, F.; Toth, G.K.; Toth, G.; Szucs, M. Synthesis and opioid binding activity of dermorphin analogues containing cyclic beta-amino acids. Neuropeptides 1997, 31, 367–372. [Google Scholar] [CrossRef]
- Janecka, A.; Kruszynski, R. Conformationally restricted peptides as tools in opioid receptor studies. Curr. Med. Chem. 2005, 12, 471–481. [Google Scholar] [CrossRef]
- Bryant, S.D.; Jinsmaa, Y.; Salvadori, S.; Okada, Y.; Lazarus, L.H. Dmt and opioid peptides: A potent alliance. Peptide Sci. 2003, 71, 86–102. [Google Scholar] [CrossRef]
- Montgomery, D.; Anand, J.P.; Griggs, N.W.; Fernandez, T.J.; Hartman, J.G.; Sánchez-Santiago, A.A.; Pogozheva, I.D.; Traynor, J.R.; Mosberg, H.I. Novel Dimethyltyrosine–Tetrahydroisoquinoline Peptidomimetics with Aromatic Tetrahydroisoquinoline Substitutions Show in Vitro Kappa and Mu Opioid Receptor Agonism. ACS Chem. Neurosci. 2019, 10, 3682–3689. [Google Scholar] [CrossRef]
- Wang, C.; McFadyen, I.J.; Traynor, J.R.; Mosberg, H.I. Design of a high affinity peptidomimetic opioid agonist from peptide pharmacophore models. Bioorg. Med. Chem. Lett. 1998, 8, 2685–2688. [Google Scholar] [CrossRef]
- Nastase, A.F.; Griggs, N.W.; Anand, J.P.; Fernandez, T.J.; Harland, A.A.; Trask, T.J.; Jutkiewicz, E.M.; Traynor, J.R.; Mosberg, H.I. Synthesis and Pharmacological Evaluation of Novel C-8 Substituted Tetrahydroquinolines as Balanced-Affinity Mu/Delta Opioid Ligands for the Treatment of Pain. ACS Chem. Neurosci. 2018, 9, 1840–1848. [Google Scholar] [CrossRef]
- Bender, A.M.; Griggs, N.W.; Anand, J.P.; Traynor, J.R.; Jutkiewicz, E.M.; Mosberg, H.I. Asymmetric synthesis and in vitro and in vivo activity of tetrahydroquinolines featuring a diverse set of polar substitutions at the 6 position as mixed-efficacy mu opioid receptor/delta opioid receptor ligands. ACS Chem. Neurosci. 2015, 6, 1428–1435. [Google Scholar] [CrossRef]
- Harland, A.A.; Pogozheva, I.D.; Griggs, N.W.; Trask, T.J.; Traynor, J.R.; Mosberg, H.I. Placement of Hydroxy Moiety on Pendant of Peptidomimetic Scaffold Modulates Mu and Kappa Opioid Receptor Efficacy. ACS Chem. Neurosci. 2017, 8, 2549–2557. [Google Scholar] [CrossRef]
- Torino, D.; Mollica, A.; Pinnen, F.; Feliciani, F.; Lucente, G.; Fabrizi, G.; Portalone, G.; Davis, P.; Lai, J.; Ma, S.W.; et al. Synthesis and evaluation of new endomorphin-2 analogues containing (Z)-alpha,beta-didehydrophenylalanine (Delta(Z)Phe) residues. J. Med. Chem. 2010, 53, 4550–4554. [Google Scholar] [CrossRef]
- Siodłak, D. α, β-Dehydroamino acids in naturally occurring peptides. Amino Acids 2015, 47, 1–17. [Google Scholar] [CrossRef]
- Rinnova, M.; Nefzi, A.; Houghten, R.A. Opioid activity of 4-imidazolidinone positional analogues of Leu-Enkephalin. Bioorg. Med. Chem. Lett. 2002, 12, 3175–3178. [Google Scholar] [CrossRef]
- Shiotani, K.; Li, T.; Miyazaki, A.; Tsuda, Y.; Yokoi, T.; Ambo, A.; Sasaki, Y.; Bryant, S.D.; Lazarus, L.H.; Okada, Y. Design and synthesis of opioidmimetics containing 2’,6’-dimethyl-L-tyrosine and a pyrazinone-ring platform. Bioorg. Med. Chem. Lett. 2007, 17, 5768–5771. [Google Scholar] [CrossRef]
- Okada, Y.; Tsukatani, M.; Taguchi, H.; Yokoi, T.; Bryant, S.D.; Lazarus, L.H. Amino acids and peptides. LII. Design and synthesis of opioid mimetics containing a pyrazinone ring and examination of their opioid receptor binding activity. Chem. Pharm. Bull. 1998, 46, 1374–1382. [Google Scholar] [CrossRef]
- Proteau-Gagné, A.; Rochon, K.; Roy, M.; Albert, P.-J.; Guérin, B.; Gendron, L.; Dory, Y.L. Systematic replacement of amides by 1, 4-disubstituted [1-3] triazoles in Leu-enkephalin and the impact on the delta opioid receptor activity. Bioorg. Med. Chem. Lett. 2013, 23, 5267–5269. [Google Scholar] [CrossRef] [Green Version]
- Olczak, J.; Kaczmarek, K.; Maszczyńska, I.; Lisowski, M.; Stropova, D.; Hruby, V.J.; Yamamura, H.I.; Lipkowski, A.W.; Zabrocki, J. Consequences of cis-amide bond simulation in opioid peptides. Lett. Peptide Sci. 1998, 5, 437–440. [Google Scholar] [CrossRef]
- Martin, S.F.; Dwyer, M.P.; Hartmann, B.; Knight, K.S. Cyclopropane-derived peptidomimetics. Design, synthesis, and evaluation of novel enkephalin analogues. J. Org. Chem. 2000, 65, 1305–1318. [Google Scholar] [CrossRef] [PubMed]
- Yamashita, T.; Tsuru, E.; Banjyo, E.; Doe, M.; Shibata, K.; Yasuda, M.; Gemba, M. Synthesis and opiate activity of pseudo-tetrapeptides containing chiral piperazin-2-one and piperazine derivatives. Chem. Pharm. Bull. 1997, 45, 1940–1944. [Google Scholar] [CrossRef] [PubMed]
- Gu, X.; Ying, J.; Min, B.; Cain, J.P.; Davis, P.; Willey, P.; Navratilova, E.; Yamamura, H.I.; Porreca, F.; Hruby, V.J. Parallel synthesis and biological evaluation of different sizes of bicyclo [2,3]-Leu-enkephalin analogues. Biopolymers 2005, 80, 151–163. [Google Scholar] [CrossRef] [PubMed]
- Ballet, S.; Salvadori, S.; Trapella, C.; Bryant, S.D.; Jinsmaa, Y.; Lazarus, L.H.; Negri, L.; Giannini, E.; Lattanzi, R.; Tourwe, D.; et al. New 2′,6′-dimethyl-L-tyrosine (Dmt) opioid peptidomimetics based on the Aba-Gly scaffold. Development of unique mu-opioid receptor ligands. J. Med. Chem. 2006, 49, 3990–3993. [Google Scholar] [CrossRef]
- Ballet, S.; Guillemyn, K.; Van der Poorten, O.; Schurgers, B.; Verniest, G.; Tourwé, D. Azepinone-Constrained Amino Acids in Peptide and Peptidomimetic Design. In Peptidomimetics I; Springer: Amsterdam, The Netherlands, 2015; pp. 177–209. [Google Scholar]
- Ballet, S.; Feytens, D.; De Wachter, R.; De Vlaeminck, M.; Marczak, E.D.; Salvadori, S.; de Graaf, C.; Rognan, D.; Negri, L.; Lattanzi, R. Conformationally constrained opioid ligands: The Dmt-Aba and Dmt-Aia versus Dmt-Tic scaffold. Bioorg. Med. Chem. Lett. 2009, 19, 433–437. [Google Scholar] [CrossRef]
- Ballet, S.; Marczak, E.D.; Feytens, D.; Salvadori, S.; Sasaki, Y.; Abell, A.D.; Lazarus, L.H.; Balboni, G.; Tourwé, D. Novel multiple opioid ligands based on 4-aminobenzazepinone (Aba), azepinoindole (Aia) and tetrahydroisoquinoline (Tic) scaffolds. Bioorg. Med. Chem. Lett. 2010, 20, 1610–1613. [Google Scholar] [CrossRef]
- Ballet, S.; Frycia, A.; Piron, J.; Chung, N.; Schiller, P.; Kosson, P.; Lipkowski, A.; Tourwé, D. Synthesis and biological evaluation of constrained analogues of the opioid peptide H-Tyr-d-Ala-Phe-Gly-NH2 using the 4-amino-2-benzazepin-3-one scaffold. J. Peptide Res. 2005, 66, 222–230. [Google Scholar] [CrossRef]
- Goodman, M.; Cai, W.; Smith, N.D. The bold legacy of Emil Fischer. J. Pept. Sci. 2003, 9, 594–603. [Google Scholar] [CrossRef]
- Schmidt, R.; Menard, D.; Mrestani-Klaus, C.; Chung, N.N.; Lemieux, C.; Schiller, P.W. Structural modifications of the N-terminal tetrapeptide segment of [D-Ala2] deltorphin I: Effects on opioid receptor affinities and activities in vitro and on antinociceptive potency. Peptides 1997, 18, 1615–1621. [Google Scholar] [CrossRef]
- Bryant, S.D.; Guerrini, R.; Salvadori, S.; Bianchi, C.; Tomatis, R.; Attila, M.; Lazarus, L.H. Helix-inducing α-aminoisobutyric acid in opioid mimetic deltorphin C analogues. J. Med. Chem. 1997, 40, 2579–2587. [Google Scholar] [CrossRef]
- Witt, K.A.; Slate, C.A.; Egleton, R.D.; Huber, J.D.; Yamamura, H.I.; Hruby, V.J.; Davis, T.P. Assessment of stereoselectivity of trimethylphenylalanine analogues of delta-opioid [D-Pen(2),D-Pen(5)]-enkephalin. J. Neurochem. 2000, 75, 424–435. [Google Scholar] [CrossRef]
- Bilsky, E.J.; Qian, X.; Hruby, V.J.; Porreca, F. Antinociceptive activity of [beta-methyl-2′, 6′-dimethyltyrosine(1)]-substituted cyclic [D-Pen(2), D-Pen(5)]Enkephalin and [D-Ala(2),Asp(4)]Deltorphin analogs. J. Pharmacol. Exp. Ther. 2000, 293, 151–158. [Google Scholar]
- Qian, X.; Shenderovich, M.D.; Kövér, K.E.; Davis, P.; Horváth, R.; Zalewska, T.; Yamamura, H.I.; Porreca, F.; Hruby, V.J. Probing the stereochemical requirements for receptor recognition of δ opioid agonists through topographic modifications in position 1. J. Am. Chem. Soc. 1996, 118, 7280–7290. [Google Scholar] [CrossRef]
- Bryan, W.M.; Callahan, J.F.; Codd, E.E.; Lemieux, C.; Moore, M.L.; Schiller, P.W.; Walker, R.F.; Huffman, W.F. Cyclic enkephalin analogues containing alpha-amino-beta-mercapto-beta, beta-pentamethylenepropionic acid at positions 2 or 5. J. Med. Chem. 1989, 32, 302–304. [Google Scholar] [CrossRef]
- Cai, Y.; Lu, D.; Chen, Z.; Ding, Y.; Chung, N.N.; Li, T.; Schiller, P.W. [Dmt1] DALDA analogues modified with tyrosine analogues at position 1. Bioorg. Med. Chem. Lett. 2016, 26, 3629–3631. [Google Scholar] [CrossRef]
- Shimoyama, M.; Shimoyama, N.; Zhao, G.M.; Schiller, P.W.; Szeto, H.H. Antinociceptive and respiratory effects of intrathecal H-Tyr-D-Arg-Phe-Lys-NH2 (DALDA) and [Dmt1] DALDA. J. Pharmacol. Exp. Ther. 2001, 297, 364–371. [Google Scholar]
- Neilan, C.L.; Nguyen, T.M.; Schiller, P.W.; Pasternak, G.W. Pharmacological characterization of the dermorphin analog [Dmt(1)]DALDA, a highly potent and selective mu-opioid peptide. Eur. J. Pharmacol. 2001, 419, 15–23. [Google Scholar] [CrossRef]
- Dumitrascuta, M.; Bermudez, M.; Ballet, S.; Wolber, G.; Spetea, M. Mechanistic Understanding of Peptide Analogues, DALDA,[Dmt1] DALDA, and KGOP01, Binding to the Mu Opioid Receptor. Molecules 2020, 25, 2087. [Google Scholar] [CrossRef]
- Mierke, D.F.; Said-Nejad, O.E.; Schiller, P.W.; Goodman, M. Enkephalin analogues containing β-naphthylalanine at the fourth position. Biopolym. Ori. Res. Biomol. 1990, 29, 179–196. [Google Scholar] [CrossRef]
- Schmidt, R.; Vogel, D.; Mrestani-Klaus, C.; Brandt, W.; Neubert, K.; Chung, N.N.; Lemieux, C.; Schiller, P.W. Cyclic. beta.-Casomorphin Analogs with Mixed. mu. Agonist/.delta. Antagonist Properties: Synthesis, Pharmacological Characterization, and Conformational Aspects. J. Med. Chem. 1994, 37, 1136–1144. [Google Scholar] [CrossRef]
- Yamazaki, T.; Said-Nejad, O.E.; Schiller, P.W.; Goodman, M. Conformational studies of stereoisomeric 14-membered cyclic enkephalin analogues containing 1-naphthylalanine at the fourth position: Chirality effect of leucine at the fifth position on biological activity and receptor selectivity. Biopolymers 1991, 31, 877–898. [Google Scholar] [CrossRef]
- Dolle, R.E.; Michaut, M.; Martinez-Teipel, B.; Belanger, S.; Graczyk, T.M.; DeHaven, R.N. Further studies of tyrosine surrogates in opioid receptor peptide ligands. Bioorg. Med. Chem. Lett. 2007, 17, 2656–2660. [Google Scholar] [CrossRef]
- Choi, H.; Murray, T.F.; Aldrich, J.V. Synthesis and evaluation of derivatives of leucine enkephalin as potential affinity labels for delta opioid receptors. Biopolymers 2003, 71, 552–557. [Google Scholar] [CrossRef]
- Choi, H.; Murray, T.F.; Aldrich, J.V. Dermorphin-based potential affinity labels for mu-opioid receptors. J. Pept. Res. 2003, 61, 40–45. [Google Scholar] [CrossRef] [PubMed]
- Choi, H.; Murray, T.F.; Aldrich, J.V. Synthesis and evaluation of potential affinity labels. derived from endomorphin-2. J. Pept. Res. 2003, 61, 58–62. [Google Scholar] [CrossRef] [PubMed]
- Sartania, N.; Szatmári, I.; Orosz, G.; Rónai, A.Z.; Medzihradszky, K.; Borsodi, A.; Benyhe, S. Irreversible labelling of the opioid receptors by a melphalan-substituted [Met5] enkephalin-Arg-Phe derivative. Eur. J. Pharmacol. 1999, 373, 241–249. [Google Scholar] [CrossRef]
- Dooley, C.; Chung, N.; Schiller, P.; Houghten, R. Acetalins: Opioid receptor antagonists determined through the use of synthetic peptide combinatorial libraries. Proc. Natl. Acad. Sci. USA 1993, 90, 10811–10815. [Google Scholar] [CrossRef]
- Dooley, C.T.; Houghten, R.A. New opioid peptides, peptidomimetics, and heterocyclic compounds from combinatorial libraries. Biopolymers 1999, 51, 379–390. [Google Scholar] [CrossRef]
Peptides | Structure | Selectivity |
---|---|---|
β-Endorphin (END) | YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE | MOR > DOR |
Enkephalins (ENKs) | YGGFL | DOR > MOR |
YGGFM | DOR > MOR | |
YGGFMRF | MOR > DOR > KOR | |
YGGFMRGL | MOR > DOR > KOR | |
Dynorphin (DYN) A | YGGFLRRIRPKLKWDNQ | KOR > MOR > DOR |
DYN B | YGGFLRRQFKVVT | KOR > MOR > DOR |
Endomorphin (EM)-1 | YPWF-NH2 | MOR |
EM-2 | YPFF-NH2 | MOR |
Dermorphines (DERs) | YaFGYPS-NH2 | MOR |
YaFGYPK | MOR | |
YaFWYPN | MOR | |
Deltorphine (DLT) A | YmFHLMD-NH2 | DOR |
DLT-1 | YaFDVVG-NH2 | DOR |
DLT-2 | YaFEVVG-NH2 | DOR |
Structure | Ki or IC50 (nM) | Ref. | ||
---|---|---|---|---|
MOR | DOR | KOR | ||
Tyr-c2,4[DLys-Phe-Asp]-NH2 | 0.21 | 461 | 684 | [227] |
Tyr-c2,5[DLys-Phe-Phe-Asp]-NH2 | 0.35 | 171 | 1.12 | [240] |
Tyr-c2,5[DCys-Phe-Phe-DCys]-NH2 | 0.05 | 0.4 | 1.6 | [241] |
Tyr-c2,4[DDap-Phe-Phe-Asp]-NH2 | 0.51 | >1000 | >1000 | [227] |
Tyr-c2,5[cis-DACAla-Phe-Phe-Asp]-NH2 | 3.2 | >1000 | - | [242] |
Dmt-c2,5[cis-DACAla-Phe-Phe-Asp]-NH2 | 0.04 | >1000 | >1000 | [242] |
Dmt-c[DLys-Phe-DPro-Asp]-NH2 (P-317) | ||||
Tyr-c2,5(-SCH2S-)[DCys-Phe-2-Nal-Cys]-NH2 | 0.47 | 0.48 | 1.3 | [229] |
cN,C[Tyr-DPro-DTrp-Phe-Gly] | 34 | - | - | [147] |
Tyr-c2,5(-S-)[DVal-Gly-Phe-DAla]-OH | 630 | 0.93 | 1600 | [223] |
Tyr-c2,5(-S-)[DAla-Gly-Phe-DAla]-OH | 2.0 | 2.0 | 1600 | [223] |
Tyr-c2,5(-CH2CH2-)[DAla-Gly-Phe-Ala]-NH2 | 2.3 | 5.9 | 309 | [225] |
Tyr c2,5(-cisCH=CH-) [DAla-Gly-Phe-DAla]-OH | 1.35 | 0.43 | 576 | [224] |
Tyr-c2,5(-NHCSNH-)[DDap-Gly-Phe-Dap]-NH2 | 0.4 | 5.4 | - | [243] |
Dcp-c2,5[DCys-Gly-Phe(4-NO2)-DCys]-NH2 | 2.84 b | 25.8 | 980 | [244] |
c2,2′(Tyr-DCys-Gly-Phe-NH)2 | 0.60 | 0.87 | - | [236] |
c2,2′(Dmt-DCys-Gly-Phe)2-cystamine | 0.27 | 0.36 | 0.87 | [237] |
c2,5[DAsp2,DAla3,Dap5]-Dyn A (1–11)-NH2 | 3.89 | 139 | 0.21 | [195] |
c5,8(-transCH=CH-)[Ala5,Ala8]Dyn A (1–11)-NH2 | 36.0 | 460 | 2.46 | [239] |
cN,5[Trp3,Trp4,Glu5]-DYN A (1–11)-NH2 | 331 | >8900 | 26.8 | [238] |
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the author. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Lee, Y.S. Peptidomimetics and Their Applications for Opioid Peptide Drug Discovery. Biomolecules 2022, 12, 1241. https://doi.org/10.3390/biom12091241
Lee YS. Peptidomimetics and Their Applications for Opioid Peptide Drug Discovery. Biomolecules. 2022; 12(9):1241. https://doi.org/10.3390/biom12091241
Chicago/Turabian StyleLee, Yeon Sun. 2022. "Peptidomimetics and Their Applications for Opioid Peptide Drug Discovery" Biomolecules 12, no. 9: 1241. https://doi.org/10.3390/biom12091241