Genome-Wide Identification and Analysis of MYB Transcription Factors in Pyropia yezoensis
Abstract
:1. Introduction
2. Results
2.1. Genome-Wide Identification of PyMYB Genes in Py. Yezoensis
2.2. Phylogenetic Analysis of PyMYB Genes
2.3. Motif Structure and Synteny Analysis
2.4. Cis-Regulatory Element Analysis of the PyMYB Gene Family
2.5. Expression Patterns of PyMYB Genes in Different Life Stages and Blade Parts of Py. yezoensis
2.6. Expression Patterns of PyMYB Genes in Response to Biotic and Abiotic Stress
3. Discussion
3.1. Evolution Analysis of MYB Genes in Red Algae
3.2. Functional Diversity of PyMYB Genes
4. Materials and Methods
4.1. Identification and Characteristics of MYB Genes in Py. yezoensis
4.2. Phylogenetic Analysis of MYB Proteins
4.3. Gene Synteny and Duplication for MYB Genes
4.4. Cis-Regulatory Element Analysis of PyMYBs
4.5. Expression Profile Analysis
4.6. RNA Isolation and qRT–PCR Analysis
5. Conclusions
Supplementary Materials
Author Contributions
Funding
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Moreira, D.; Le Guyader, H.; Philippe, H. The origin of red algae and the evolution of chloroplasts. Nature 2000, 405, 69–72. [Google Scholar] [CrossRef]
- Mumford, T.; Miura, A. Porphyra as food: Cultivation and economics. In Algae and Human Affairs; Cambridge University Press: Cambridge, UK, 1988; pp. 87–118. [Google Scholar]
- Wang, H.; Wang, H.; Shao, H.; Tang, X. Recent advances in utilizing transcription factors to improve plant abiotic stress tolerance by transgenic technology. Front. Plant Sci. 2016, 7, 67. [Google Scholar] [CrossRef]
- Dubos, C.; Stracke, R.; Grotewold, E.; Weisshaar, B.; Martin, C.; Lepiniec, L. MYB transcription factors in Arabidopsis. Trends Plant Sci. 2010, 15, 573–581. [Google Scholar] [CrossRef]
- Sun, W.; Ma, Z.; Chen, H.; Liu, M. MYB gene family in potato (Solanum tuberosum L.): Genome-wide identification of hormone-responsive reveals their potential functions in growth and development. Int. J. Mol. Sci. 2019, 20, 4847. [Google Scholar] [CrossRef]
- Paz-Ares, J.; Ghosal, D.; Wienand, U.; Peterson, P.; Saedler, H. The regulatory c1 locus of Zea mays encodes a protein with homology to MYB proto-oncogene products and with structural similarities to transcriptional activators. EMBO J. 1987, 6, 3553–3558. [Google Scholar] [CrossRef]
- Lin, B.L.; Wang, J.S.; Liu, H.C.; Chen, R.W.; Meyer, Y.; Barakat, A.; Delseny, M. Genomic analysis of the Hsp70 superfamily in Arabidopsis thaliana. Cell Stress Chaperones 2001, 6, 201–208. [Google Scholar] [CrossRef] [PubMed]
- Jia, L.; Clegg, M.T.; Jiang, T. Evolutionary dynamics of the DNA-binding domains in putative R2R3-MYB genes identified from rice subspecies indica and japonica genomes. Plant Physiol. 2004, 134, 575–585. [Google Scholar] [CrossRef]
- Ai, P.; Xue, J.; Shi, Z.; Liu, Y.; Li, Z.; Li, T.; Zhao, W.; Khan, M.A.; Kang, D.; Wang, K.; et al. Genome-wide characterization and expression analysis of MYB transcription factors in Chrysanthemum nankingense. BMC Plant Biol. 2023, 23, 140. [Google Scholar] [CrossRef] [PubMed]
- Si, Z.; Wang, L.; Ji, Z.; Zhao, M.; Zhang, K.; Qiao, Y. Comparative analysis of the MYB gene family in seven Ipomoea species. Front. Plant Sci. 2023, 14, 1155018. [Google Scholar] [CrossRef] [PubMed]
- Liu, M.; Li, K.; Sheng, S.; Wang, M.; Hua, P.; Wang, Y.; Chen, P.; Wang, K.; Zhao, M.; Wang, Y.; et al. Transcriptome analysis of MYB transcription factors family and PgMYB genes involved in salt stress resistance in Panax ginseng. BMC Plant Biol. 2022, 22, 479. [Google Scholar] [CrossRef]
- Xu, Q.; He, J.; Dong, J.; Hou, X.; Zhang, X. Genomic survey and expression profiling of the MYB gene family in watermelon. Hortic. Plant J. 2018, 4, 1–15. [Google Scholar] [CrossRef]
- Abbas, F.; Ke, Y.; Zhou, Y.; Yu, Y.; Waseem, M.; Ashraf, U.; Wang, C.; Wang, X.; Li, X.; Yue, Y.; et al. Genome-wide analysis reveals the potential role of MYB transcription factors in floral scent formation in Hedychium coronarium. Front. Plant Sci. 2021, 12, 623742. [Google Scholar] [CrossRef]
- Du, H.; Yang, S.-S.; Liang, Z.; Feng, B.-R.; Liu, L.; Huang, Y.-B.; Tang, Y.-X. Genome-wide analysis of the MYB transcription factor superfamily in soybean. BMC Plant Biol. 2012, 12, 106. [Google Scholar] [CrossRef] [PubMed]
- Abdullah-Zawawi, M.-R.; Ahmad-Nizammuddin, N.-F.; Govender, N.; Harun, S.; Mohd-Assaad, N.; Mohamed-Hussein, Z.-A. Comparative genome-wide analysis of WRKY, MADS-box and MYB transcription factor families in Arabidopsis and rice. Sci. Rep. 2021, 11, 19678. [Google Scholar] [CrossRef]
- Stracke, R.; Werber, M.; Weisshaar, B. The R2R3-MYB gene family in Arabidopsis thaliana. Curr. Opin. Plant Biol. 2001, 4, 447–456. [Google Scholar] [CrossRef] [PubMed]
- Haga, N.; Kato, K.; Murase, M.; Araki, S.; Kubo, M.; Demura, T.; Suzuki, K.; Müller, I.; Voß, U.; Jürgens, G. R1R2R3-MYB proteins positively regulate cytokinesis through activation of KNOLLE transcription in Arabidopsis thaliana. Development 2007, 134, 1101–1110. [Google Scholar] [CrossRef]
- Rosinski, J.A.; Atchley, W.R. Molecular evolution of the MYB family of transcription factors: Evidence for polyphyletic origin. J. Mol. Evol. 1998, 46, 74–83. [Google Scholar] [CrossRef]
- Jiang, C.; Gu, J.; Chopra, S.; Gu, X.; Peterson, T. Ordered origin of the typical two-and three-repeat MYB genes. Genetics 2004, 326, 13–22. [Google Scholar] [CrossRef]
- Huang, W.; Sun, W.; Lv, H.; Xiao, G.; Zeng, S.; Wang, Y. Isolation and molecular characterization of thirteen R2R3-MYB transcription factors from Epimedium sagittatum. Int. J. Mol. Sci. 2013, 14, 594–610. [Google Scholar] [CrossRef]
- Guo, H.; Wang, Y.; Wang, L.; Hu, P.; Wang, Y.; Jia, Y.; Zhang, C.; Zhang, Y.; Zhang, Y.; Wang, C.; et al. Expression of the MYB transcription factor gene BplMYB46 affects abiotic stress tolerance and secondary cell wall deposition in Betula platyphylla. Plant Biotechnol. J. 2017, 15, 107–121. [Google Scholar] [CrossRef] [PubMed]
- Cao, Y.; Jia, H.; Xing, M.; Jin, R.; Grierson, D.; Gao, Z.; Sun, C.; Chen, K.; Xu, C.; Li, X. Genome-wide analysis of MYB gene family in Chinese bayberry (Morella rubra) and identification of members regulating flavonoid biosynthesis. Front. Plant Sci. 2021, 12, 691384. [Google Scholar] [CrossRef] [PubMed]
- Vailleau, F.; Daniel, X.; Tronchet, M.; Montillet, J.-L.; Triantaphylides, C.; Roby, D. A R2R3-MYB gene, AtMYB30, acts as a positive regulator of the hypersensitive cell death program in plants in response to pathogen attack. Proc. Natl. Acad. Sci. USA 2002, 99, 10179–10184. [Google Scholar] [CrossRef] [PubMed]
- Wang, X.; Niu, Q.-W.; Teng, C.; Li, C.; Mu, J.; Chua, N.-H.; Zuo, J. Overexpression of PGA37/MYB118 and MYB115 promotes vegetative-to-embryonic transition in Arabidopsis. Cell Res. 2009, 19, 224. [Google Scholar] [CrossRef]
- Simon, M.; Lee, M.M.; Lin, Y.; Gish, L.; Schiefelbein, J. Distinct and overlapping roles of single-repeat MYB genes in root epidermal patterning. Dev. Biol. 2007, 311, 566–578. [Google Scholar] [CrossRef]
- Kasahara, R.D.; Portereiko, M.F.; Sandaklie-Nikolova, L.; Rabiger, D.S.; Drews, G.N. MYB98 is required for pollen tube guidance and synergid cell differentiation in Arabidopsis. Plant Cell 2005, 17, 2981–2992. [Google Scholar] [CrossRef]
- Baumann, K.; Perez-Rodriguez, M.; Bradley, D.; Venail, J.; Bailey, P.; Jin, H.; Koes, R.; Roberts, K.; Martin, C. Control of cell and petal morphogenesis by R2R3 MYB transcription factors. Development 2007, 134, 1691–1701. [Google Scholar] [CrossRef]
- Jung, C.; Seo, J.S.; Han, S.W.; Koo, Y.J.; Kim, C.H.; Song, S.I.; Nahm, B.H.; Do Choi, Y.; Cheong, J.-J. Overexpression of AtMYB44 enhances stomatal closure to confer abiotic stress tolerance in transgenic Arabidopsis. Plant Physiol. 2008, 146, 623–635. [Google Scholar] [CrossRef] [PubMed]
- He, Y.; Li, W.; Lv, J.; Jia, Y.; Wang, M.; Xia, G. Ectopic expression of a wheat MYB transcription factor gene, TaMYB73, improves salinity stress tolerance in Arabidopsis thaliana. J. Exp. Bot. 2011, 63, 1511–1522. [Google Scholar] [CrossRef] [PubMed]
- Chang, X.; Xie, S.; Wei, L.; Lu, Z.; Chen, Z.-H.; Chen, F.; Lai, Z.; Lin, Z.; Zhang, L. Origins and stepwise expansion of R2R3-MYB transcription factors for the terrestrial adaptation of plants. Front. Plant Sci. 2020, 11, 575360. [Google Scholar] [CrossRef]
- Wu, W.; Zhu, S.; Zhu, L.; Wang, D.; Liu, Y.; Liu, S.; Zhang, J.; Hao, Z.; Lu, Y.; Cheng, T.; et al. Characterization of the Liriodendron chinense MYB gene family and its role in abiotic stress response. Front. Plant Sci. 2021, 12, 641280. [Google Scholar] [CrossRef] [PubMed]
- Onkokesung, N.; Reichelt, M.; van Doorn, A.; Schuurink, R.C.; van Loon, J.J.A.; Dicke, M. Modulation of flavonoid metabolites in Arabidopsis thaliana through overexpression of the MYB75 transcription factor: Role of kaempferol-3,7-dirhamnoside in resistance to the specialist insect herbivore Pieris brassicae. J. Exp. Bot. 2014, 65, 2203–2217. [Google Scholar] [CrossRef]
- Tang, Y.; Bao, X.; Zhi, Y.; Wu, Q.; Guo, Y.; Yin, X.; Zeng, L.; Li, J.; Zhang, J.; He, W.; et al. Overexpression of a MYB family gene, OsMYB6, Increases drought and salinity stress tolerance in transgenic rice. Front. Plant Sci. 2019, 10, 168. [Google Scholar] [CrossRef]
- Luo, Q.; Liu, R.; Zeng l Wu, Y.; Jiang, Y.; Yang, Q.; Nie, Q. Isolation and molecular characterization of NtMYB4a, a putative transcription activation factor involved in anthocyanin synthesis in tobacco. Gene 2020, 760, 144990. [Google Scholar] [CrossRef]
- Dubos, C.; Le Gourrierec, J.; Baudry, A.; Huep, G.; Lanet, E.; Debeaujon, I.; Routaboul, J.M.; Alboresi, A.; Weisshaar, B.; Lepiniec, L. MYBL2 is a new regulator of flavonoid biosynthesis in Arabidopsis thaliana. Plant J. 2008, 55, 940–953. [Google Scholar] [CrossRef]
- Tominaga-Wada, R.; Nukumizu, Y. Expression analysis of an R3-Type MYB transcription factor CPC-LIKE MYB4 (TRICHOMELESS2) and CPL4-related transcripts in Arabidopsis. Int. J. Mol. Sci. 2012, 13, 3478–3491. [Google Scholar] [CrossRef]
- Du, H.; Wang, Y.-B.; Xie, Y.; Liang, Z.; Jiang, S.-J.; Zhang, S.-S.; Huang, Y.-B.; Tang, Y.-X. Genome-wide identification and evolutionary and expression analyses of MYB-related genes in land plants. DNA Res. 2013, 20, 437–448. [Google Scholar] [CrossRef] [PubMed]
- Blouin, N.A.; Brodie, J.A.; Grossman, A.C.; Xu, P.; Brawley, S.H. Porphyra: A marine crop shaped by stress. Trends Plant Sci. 2011, 16, 29–37. [Google Scholar] [CrossRef] [PubMed]
- Wang, D.; Yu, X.; Xu, K.; Bi, G.; Cao, M.; Zelzion, E.; Fu, C.; Sun, P.; Liu, Y.; Kong, F.; et al. Pyropia yezoensis genome reveals diverse mechanisms of carbon acquisition in the intertidal environment. Nat. Commun. 2020, 11, 4028. [Google Scholar] [CrossRef] [PubMed]
- Sun, P.; Tang, X.; Bi, G.; Xu, K.; Kong, F.; Mao, Y. Gene expression profiles of Pyropia yezoensis in response to dehydration and rehydration stresses. Mar. Genom. 2019, 43, 43–49. [Google Scholar] [CrossRef]
- Sun, P.; Mao, Y.; Li, G.; Cao, M.; Kong, F.; Wang, L.; Bi, G. Comparative transcriptome profiling of Pyropia yezoensis (Ueda) M.S. Hwang & H.G. Choi in response to temperature stresses. BMC Genom. 2015, 16, 463. [Google Scholar]
- Cao, M.; Xu, K.; Yu, X.; Bi, G.; Liu, Y.; Kong, F.; Sun, P.; Tang, X.; Du, G.; Ge, Y.; et al. A chromosome-level genome assembly of Pyropia haitanensis (Bangiales, Rhodophyta). Mol. Ecol. Resour. 2020, 20, 216–227. [Google Scholar] [CrossRef]
- Yang, X.; Guo, T.; Li, J.; Chen, Z.; Guo, B.; An, X. Genome-wide analysis of the MYB-related transcription factor family and associated responses to abiotic stressors in Populus. Int. J. Biol. Macromol. 2021, 191, 359–376. [Google Scholar] [CrossRef] [PubMed]
- Chen, Y.; Yang, X.; He, K.; Liu, M.; Li, J.; Gao, Z.; Lin, Z.; Zhang, Y.; Wang, X.; Qiu, X. The MYB transcription factor superfamily of Arabidopsis: Expression analysis and phylogenetic comparison with the rice MYB family. Plant Mol. Biol. 2006, 60, 107–124. [Google Scholar]
- Qiu, H.; Price, D.C.; Yang, E.C.; Yoon, H.S.; Bhattacharya, D. Evidence of ancient genome reduction in red algae (Rhodophyta). J. Phycol. 2015, 51, 624–636. [Google Scholar] [CrossRef] [PubMed]
- Bhattacharya, D.; Qiu, H.; Lee, J.; Su Yoon, H.; Weber, A.P.M.; Price, D.C. When less is more: Red algae as models for studying gene loss and genome evolution in eukaryotes. Crit. Rev. Plant Sci. 2018, 37, 81–99. [Google Scholar] [CrossRef]
- Pu, X.; Yang, L.; Liu, L.; Dong, X.; Chen, S.; Chen, Z.; Liu, G.; Jia, Y.; Yuan, W.; Liu, L. Genome-wide analysis of the MYB transcription factor superfamily in Physcomitrella patens. Int. J. Mol. Sci. 2020, 21, 975. [Google Scholar] [CrossRef]
- Wu, Z.-J.; Li, X.-H.; Liu, Z.-W.; Li, H.; Wang, Y.-X.; Zhuang, J. Transcriptome-wide identification of Camellia sinensis WRKY transcription factors in response to temperature stress. Mol. Genet. Genom. 2016, 291, 255–269. [Google Scholar] [CrossRef] [PubMed]
- Hellweger, F.L.; Huang, Y.; Luo, H. Carbon limitation drives GC content evolution of a marine bacterium in an individual-based genome-scale model. ISME J. 2018, 12, 1180–1187. [Google Scholar] [CrossRef]
- Yu, X.; Mo, Z.; Tang, X.; Gao, T.; Mao, Y. Genome-wide analysis of HSP70 gene superfamily in Pyropia yezoensis (Bangiales, Rhodophyta): Identification, characterization and expression profiles in response to dehydration stress. BMC Plant Biol. 2021, 21, 435. [Google Scholar] [CrossRef]
- Gao, T.; Mo, Z.; Tang, L.; Yu, X.; Du, G.; Mao, Y. Heat shock protein 20 gene superfamilies in red algae: Evolutionary and functional diversities. Front. Plant Sci. 2022, 13, 817852. [Google Scholar] [CrossRef]
- Fujino, A.; Fukushima, K.; Namiki, N.; Kosugi, T.; Takimoto-Kamimura, M. Structural analysis of an MK2-inhibitor complex: Insight into the regulation of the secondary structure of the Gly-rich loop by TEI-I01800. Acta Crystallogr. Sect. D Biol. Crystallogr. 2010, 66 Pt 1, 80–87. [Google Scholar] [CrossRef] [PubMed]
- Ishiguro, A.; Kimura, N.; Noma, T.; Shimo-Kon, R.; Ishihama, A.; Kon, T. Molecular dissection of ALS-linked TDP-43—Involvement of the Gly-rich domain in interaction with G-quadruplex mRNA. FEBS Lett. 2020, 594, 2254–2265. [Google Scholar] [CrossRef]
- Hanano, S.; Sugita, M.; Sugiura, M. Isolation of a novel RNA-binding protein and its association with a large ribonucleoprotein particle present in the nucleoplasm of tobacco cells. Plant Mol. Biol. 1996, 31, 57–68. [Google Scholar] [CrossRef] [PubMed]
- Czolpinska, M.; Rurek, M. Plant glycine-rich proteins in stress response: An emerging, still prospective story. Front. Plant Sci. 2018, 9, 302. [Google Scholar] [CrossRef] [PubMed]
- Yamaguchi-Shinozaki, K.; Shinozaki, K. Organization of cis-acting regulatory elements in osmotic- and cold-stress-responsive promoters. Trends Plant Sci. 2005, 10, 88–94. [Google Scholar] [CrossRef]
- Kim, S.Y. The role of ABF family bZIP class transcription factors in stress response. Physiol. Plant. 2006, 126, 519–527. [Google Scholar] [CrossRef]
- Yamaguchi-Shinozaki, K.; Shinozaki, K. A novel cis-acting element in an Arabidopsis gene is involved in responsiveness to drought, low-temperature, or high-salt stress. Plant Cell 1994, 6, 251–264. [Google Scholar]
- Jiang, C.; Iu, B.; Singh, J. Requirement of a CCGAC cis-acting element for cold induction of the BN115 gene from winter Brassica napus. Plant Mol. Biol. 1996, 30, 679–684. [Google Scholar] [CrossRef]
- Jin, H.; Martin, C. Multifunctionality and diversity within the plant MYB-gene family. Plant Mol. Biol. 1999, 41, 577–585. [Google Scholar] [CrossRef]
- Zheng, S.; Lin, Y.; Lai, Z.; Lin, J. Isolation and characterisation of a MYB transcription factor associated with epigallocatechin-3-gallate biosynthesis in Camellia sinensis L. J. Hortic. Sci. Biotechnol. 2019, 94, 41–48. [Google Scholar] [CrossRef]
- Yu, Y.; Guo, D.; Li, G.; Yang, Y.; Zhang, G.; Li, S.; Liang, Z. The grapevine R2R3-type MYB transcription factor VdMYB1 positively regulates defense responses by activating the stilbene synthase gene 2 (VdSTS2). BMC Plant Biol. 2019, 19, 478. [Google Scholar] [CrossRef] [PubMed]
- Cominelli, E.; Tonelli, C. A new role for plant R2R3-MYB transcription factors in cell cycle regulation. Cell Res. 2009, 19, 1231–1232. [Google Scholar] [CrossRef]
- Brownfield, L.; Hafidh, S.; Borg, M.; Sidorova, A.; Mori, T.; Twell, D. A plant germline-specific integrator of sperm specification and cell cycle progression. PLoS Genet. 2009, 5, e1000430. [Google Scholar] [CrossRef] [PubMed]
- Borg, M.; Brownfield, L.; Khatab, H.; Sidorova, A.; Lingaya, M.; Twell, D. The R2R3 MYB transcription factor DUO1 activates a male germline-specific regulon essential for sperm cell differentiation in Arabidopsis. Plant Cell 2011, 23, 534–549. [Google Scholar] [CrossRef]
- Hisanaga, T.; Okahashi, K.; Yamaoka, S.; Kajiwara, T.; Nishihama, R.; Shimamura, M.; Yamato, K.T.; Bowman, J.L.; Kohchi, T.; Nakajima, K. A cis-acting bidirectional transcription switch controls sexual dimorphism in the liverwort. EMBO J. 2019, 38, e100240. [Google Scholar] [CrossRef]
- Hennig, L.; Gruissem, W.; Grossniklaus, U.; Köhler, C. Transcriptional programs of early reproductive stages in Arabidopsis. Plant Physiol. 2004, 135, 1765–1775. [Google Scholar] [CrossRef]
- Von Dassow, P.; Ogata, H.; Probert, I.; Wincker, P.; Da Silva, C.; Audic, S.; Claverie, J.-M.; de Vargas, C. Transcriptome analysis of functional differentiation between haploid and diploid cells of Emiliania huxleyi, a globally significant photosynthetic calcifying cell. Genome Biol. 2009, 10, R114. [Google Scholar] [CrossRef] [PubMed]
- Seo, P.J.; Xiang, F.; Qiao, M.; Park, J.-Y.; Lee, Y.N.; Kim, S.-G.; Lee, Y.-H.; Park, W.J.; Park, C.-M. The MYB96 transcription factor mediates abscisic acid signaling during drought stress response in Arabidopsis. Plant Physiol. 2009, 151, 275–289. [Google Scholar] [CrossRef] [PubMed]
- Dossa, K.; Mmadi, M.A.; Zhou, R.; Liu, A.; Yang, Y.; Diouf, D.; You, J.; Zhang, X. Ectopic expression of the sesame MYB transcription factor SiMYB305 promotes root growth and modulates ABA-mediated tolerance to drought and salt stresses in Arabidopsis. AoB Plants 2019, 12, plz081. [Google Scholar] [CrossRef]
- Ambawat, S.; Sharma, P.; Yadav, N.R.; Yadav, R.C. MYB transcription factor genes as regulators for plant responses: An overview. Physiol. Mol. Biol. Plants 2013, 19, 307–321. [Google Scholar] [CrossRef]
- Yong, Y.; Zhang, Y.; Lyu, Y. A MYB-related transcription factor from Lilium lancifolium L. (LlMYB3) is involved in anthocyanin biosynthesis pathway and enhances multiple abiotic stress tolerance in Arabidopsis thaliana. Int. J. Mol. Sci. 2019, 20, 3195. [Google Scholar] [CrossRef] [PubMed]
- Shan, H.; Chen, S.; Jiang, J.; Chen, F.; Chen, Y.; Gu, C.; Li, P.; Song, A.; Zhu, X.; Gao, H. Heterologous expression of the chrysanthemum R2R3-MYB transcription factor CmMYB2 enhances drought and salinity tolerance, increases hypersensitivity to ABA and delays flowering in Arabidopsis thaliana. Mol. Biotechnol. 2012, 51, 160–173. [Google Scholar] [CrossRef] [PubMed]
- Park, M.Y.; Kang, J.-Y.; Kim, S.Y. Overexpression of AtMYB52 confers ABA hypersensitivity and drought tolerance. Mol. Cells 2011, 31, 447–454. [Google Scholar] [CrossRef] [PubMed]
- Brawley, S.H.; Blouin, N.A.; Ficko-Blean, E.; Wheeler, G.L.; Lohr, M.; Goodson, H.V.; Jenkins, J.W.; Blaby-Haas, C.E.; Helliwell, K.E.; Chan, C.X.; et al. Insights into the red algae and eukaryotic evolution from the genome of Porphyra umbilicalis (Bangiophyceae, Rhodophyta). Proc. Natl. Acad. Sci. USA 2017, 114, E6361–E6370. [Google Scholar] [CrossRef]
- Collén, J.; Porcel, B.; Carré, W.; Ball, S.G.; Chaparro, C.; Tonon, T.; Barbeyron, T.; Michel, G.; Noel, B.; Valentin, K.; et al. Genome structure and metabolic features in the red seaweed Chondrus crispus shed light on evolution of the Archaeplastida. Proc. Natl. Acad. Sci. USA 2013, 110, 5247–5252. [Google Scholar] [CrossRef]
- Nozaki, H.; Takano, H.; Misumi, O.; Terasawa, K.; Matsuzaki, M.; Maruyama, S.; Nishida, K.; Yagisawa, F.; Yoshida, Y.; Fujiwara, T.; et al. A 100%-complete sequence reveals unusually simple genomic features in the hot-spring red alga Cyanidioschyzon merolae. BMC Biol. 2007, 5, 28. [Google Scholar] [CrossRef]
- Lee, J.; Yang, E.C.; Graf, L.; Yang, J.H.; Qiu, H.; Zelzion, U.; Chan, C.X.; Stephens, T.G.; Weber, A.P.M.; Boo, G.H.; et al. Analysis of the draft genome of the red seaweed Gracilariopsis chorda provides insights into genome size evolution in Rhodophyta. Mol. Biol. Evol. 2018, 35, 1869–1886. [Google Scholar] [CrossRef]
- Lee, J.; Kim, D.; Bhattacharya, D.; Yoon, H.S. Expansion of phycobilisome linker gene families in mesophilic red algae. Nat. Commun. 2019, 10, 4823. [Google Scholar] [CrossRef]
- Schönknecht, G.; Chen, W.; Ternes, C.; Barbier, G.; Shrestha, R.; Stanke, M.; Bräutigam, A.; Baker, B.; Banfield, J.; Garavito, R.; et al. Gene transfer from bacteria and archaea facilitated evolution of an extremophilic eukaryote. Science 2013, 339, 1207–1210. [Google Scholar] [CrossRef]
- Price, D.C.; Chan, C.X.; Yoon, H.S.; Yang, E.C.; Qiu, H.; Weber, A.P.; Schwacke, R.; Gross, J.; Blouin, N.A.; Lane, C.; et al. Cyanophora paradoxa genome elucidates origin of photosynthesis in algae and plants. Science 2012, 335, 843–847. [Google Scholar] [CrossRef]
- Gasteiger, E.; Gattiker, A.; Hoogland, C.; Ivanyi, I.; Appel, R.D.; Bairoch, A. ExPASy: The proteomics server for in-depth protein knowledge and analysis. Nucleic Acids Res. 2003, 31, 3784–3788. [Google Scholar] [CrossRef]
- Bailey, T.L.; Williams, N.; Misleh, C.; Li, W.W. MEME: Discovering and analyzing DNA and protein sequence motifs. Nucleic Acids Res. 2006, 34 (Suppl. S2), W369–W373. [Google Scholar] [CrossRef] [PubMed]
- Edgar, R.C. MUSCLE: Multiple sequence alignment with high accuracy and high throughput. Nucleic Acids Res. 2004, 32, 1792–1797. [Google Scholar] [CrossRef]
- Nguyen, L.-T.; Schmidt, H.A.; von Haeseler, A.; Minh, B.Q. IQ-TREE: A fast and effective stochastic algorithm for estimating maximum-likelihood phylogenies. Mol. Biol. Evol. 2015, 32, 268–274. [Google Scholar] [CrossRef] [PubMed]
- Wang, Y.; Tang, H.; DeBarry, J.D.; Tan, X.; Li, J.; Wang, X.; Lee, T.-h.; Jin, H.; Marler, B.; Guo, H.; et al. MCScanX: A toolkit for detection and evolutionary analysis of gene synteny and collinearity. Nucleic Acids Res. 2012, 40, e49. [Google Scholar] [CrossRef]
- Vatansever, R.; Koc, I.; Ozyigit, I.I.; Sen, U.; Uras, M.E.; Anjum, N.A.; Pereira, E.; Filiz, E. Genome-wide identification and expression analysis of sulfate transporter (SULTR) genes in potato (Solanum tuberosum L.). Planta 2016, 244, 1167–1183. [Google Scholar] [CrossRef] [PubMed]
- Zhang, Z.; Li, J.; Zhao, X.-Q.; Wang, J.; Wong, G.K.-S.; Yu, J. KaKs_Calculator: Calculating Ka and Ks through model selection and model averaging. Genom. Proteom. Bioinform. 2006, 4, 259–263. [Google Scholar] [CrossRef] [PubMed]
- Lescot, M.; Déhais, P.; Thijs, G.; Marchal, K.; Moreau, Y.; Van de Peer, Y.; Rouzé, P.; Rombauts, S. PlantCARE, a database of plant cis-acting regulatory elements and a portal to tools for in silico analysis of promoter sequences. Nucleic Acids Res. 2002, 30, 325–327. [Google Scholar] [CrossRef] [PubMed]
- Tang, L.; Qiu, L.; Liu, C.; Du, G.; Mo, Z.; Tang, X.; Mao, Y. Transcriptomic insights into innate immunity responding to red rot disease in red alga Pyropia yezoensis. Int. J. Mol. Sci. 2019, 20, 5970. [Google Scholar] [CrossRef]
- Brown, J.; Pirrung, M.; McCue, L.A. FQC Dashboard: Integrates FastQC results into a web-based, interactive, and extensible FASTQ quality control tool. Bioinformatics 2017, 33, 3137–3139. [Google Scholar] [CrossRef]
- Bolger, A.M.; Lohse, M.; Usadel, B. Trimmomatic: A flexible trimmer for Illumina sequence data. Bioinformatics 2014, 30, 2114–2120. [Google Scholar] [CrossRef] [PubMed]
- Trapnell, C.; Roberts, A.; Goff, L.; Pertea, G.; Kim, D.; Kelley, D.R.; Pimentel, H.; Salzberg, S.L.; Rinn, J.L.; Pachter, L. Differential gene and transcript expression analysis of RNA-seq experiments with TopHat and Cufflinks. Nat. Protoc. 2012, 7, 562–578. [Google Scholar] [CrossRef] [PubMed]
- Chen, C.; Chen, H.; Zhang, Y.; Thomas, H.R.; Frank, M.H.; He, Y.; Xia, R. TBtools: An integrative toolkit developed for interactive analyses of big biological data. Mol. Plant 2020, 13, 1194–1202. [Google Scholar] [CrossRef] [PubMed]
- Yu, X.; Wang, L.; Xu, K.; Kong, F.; Wang, D.; Tang, X.; Sun, B.; Mao, Y. Fine mapping to identify the functional genetic locus for red coloration in Pyropia yezoensis thallus. Front. Plant Sci. 2020, 11, 867. [Google Scholar] [CrossRef] [PubMed]
- Gao, D.; Kong, F.; Sun, P.; Bi, G.; Mao, Y. Transcriptome-wide identification of optimal reference genes for expression analysis of Pyropia yezoensis responses to abiotic stress. BMC Genom. 2018, 19, 251. [Google Scholar] [CrossRef]
No. | Gene ID | Chr. | Location Coordinates (5′–3′) | Gene Length (bp) | Introns | Protein | Instability Index | ||
---|---|---|---|---|---|---|---|---|---|
Length (aa) | pI | MW (Da) | |||||||
PyMYB1 | py05834 | Chr_2 | 20,775,567–20,777,675(−) | 2109 | 0 | 655 | 9.65 | 65,595.95 | 71.18 |
PyMYB2 | py09814 | Chr_2 | 29,201,221–29,204,172(−) | 2952 | 0 | 954 | 9.71 | 92,734.27 | 56.15 |
PyMYB3 | py09955 | Chr_3 | 1,412,341–1,414,602(−) | 2262 | 1 | 663 | 8.4 | 65,431.41 | 46.32 |
PyMYB4 | py08181 | Chr_1 | 9,248,952–9,251,564(+) | 2613 | 1 | 870 | 6.14 | 85,547.49 | 45.30 |
PyMYB5 | py00388 | Chr_1 | 15,749,165–15,752,214(−) | 3050 | 1 | 636 | 8.17 | 69,882.18 | 43.76 |
PyMYB6 | py10564 | Chr_1 | 19,596,875–19,602,348(+) | 5474 | 0 | 1693 | 5.25 | 169,473.82 | 54.09 |
PyMYB7 | py03838 | Chr_1 | 30,760,790–30,762,242(−) | 1453 | 0 | 465 | 10.37 | 45,669.49 | 49.07 |
PyMYB8 | py08093 | Chr_1 | 42,710,239–42,712,056(−) | 1818 | 0 | 562 | 7.63 | 59,193.78 | 44.60 |
PyMYB9 | py08650 | Chr_2 | 2,996,682–3,001,254(−) | 4573 | 1 | 1283 | 10.17 | 126,648.01 | 64.16 |
PyMYB10 | py09282 | Chr_2 | 12,729,693–12,731,086(+) | 1394 | 2 | 263 | 9.56 | 25,747.1 | 53.78 |
PyMYB11 | py06564 | Chr_2 | 24,928,598–24,935,043(+) | 6446 | 1 | 900 | 8.84 | 93,136.05 | 42.03 |
PyMYB12 | py07923 | Chr_2 | 31,305,719–31,310,122(+) | 4404 | 0 | 1425 | 11.05 | 143,276.79 | 55.83 |
PyMYB13 | py08311 | Chr_2 | 31,620,311–31,622,302(−) | 1992 | 0 | 663 | 10.39 | 65,237.37 | 69.35 |
PyMYB14 | py05796 | Chr_3 | 726,004–729,747(−) | 3744 | 0 | 1247 | 6.67 | 111,473.37 | 54.42 |
PyMYB15 | py01811 | Chr_3 | 13,184,111–13,186,746(−) | 2636 | 2 | 360 | 8.59 | 33,652.99 | 68.39 |
PyMYB16 | py04398 | Chr_3 | 24,701,888–24,706,378(−) | 4491 | 1 | 1268 | 10.28 | 125,218.85 | 65.42 |
Motifs | Width (aa) | Pfam (p < 1 × 10−5) | Sequences |
---|---|---|---|
Motif1 | 43 | Myb DNA-binding domain | SIKRGWWTEEEDELLLELLKLGGRNWKRIAKHLPGRTDNQCRS |
Motif2 | 69 | SWIRM domain | LPEFFLGRFASKTPEVYKQYRBFMIDTWRQDPTRYLTATAVRRHLAGDACAILRVHAFLEHWGLINYGV |
Motif3 | 68 | - | GWMPKRGDFDYEWDDEAEEIIADMEILEDDTPEEVELKLRLLEIYNAKLDERERRKEFVLSRNLLDFK |
Motif4 | 44 | Myb DNA-binding domain | RRRWTPEEDELLREAVAKYGAGDWARLAAEYLPGRTGKQLRARW |
Motif5 | 47 | Zinc finger, ZZ type | IEYCCDCCGDDCSRLRYHCATCADMDLCPDCFSVGRYPSPHKARDFI |
Motif6 | 35 | - | HAQKYFLKVQKNKTGEYVPPPRPKRRASSPYPRAA |
Motif7 | 49 | - | AGVAGAGAGGGGAAGGGGGAAGAGGGGGGGGGGGGGGGGGGGGGGGGGA |
Motif8 | 82 | DnaJ | KLTARNSDDLYELLELGDKRWHATEDDIKKAFRRLSLKYHPDKIAHAGEEAMEDAGEHFKAMRKAFDTLSDRRKRAAYDSID |
Motif9 | 69 | - | LGDENTPMEEVHAFYDFWYRFKSWRDFSADLEFDPEQADSREERRWMDRQNAKHIKKRRAAEASRIRLL |
Motif10 | 53 | SWIRM-associated domain at the N-terminal | ATHIVYPDPPGTTEAETEGEDYCRALKRKGBQVLVHWWYYPDSYDSWIPRQEV |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2023 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Yu, X.; Tang, L.; Tang, X.; Mao, Y. Genome-Wide Identification and Analysis of MYB Transcription Factors in Pyropia yezoensis. Plants 2023, 12, 3613. https://doi.org/10.3390/plants12203613
Yu X, Tang L, Tang X, Mao Y. Genome-Wide Identification and Analysis of MYB Transcription Factors in Pyropia yezoensis. Plants. 2023; 12(20):3613. https://doi.org/10.3390/plants12203613
Chicago/Turabian StyleYu, Xinzi, Lei Tang, Xianghai Tang, and Yunxiang Mao. 2023. "Genome-Wide Identification and Analysis of MYB Transcription Factors in Pyropia yezoensis" Plants 12, no. 20: 3613. https://doi.org/10.3390/plants12203613