Abstract
Zoonotic coronaviruses (CoV) have emerged twice and have caused severe respiratory diseases in humans. Due to the frequent outbreaks of different human coronaviruses (HCoVs), the development of a pan-HCoV vaccine is of great importance. Various conserved epitopes shared by HCoVs are reported to induce cross-reactive T-cell responses. Therefore, this study aimed to design a multi-epitope vaccine, targeting the HCoV spike protein. Genetic analysis revealed that the spike region is highly conserved among SARS-CoV-2, bat SL-CoV, and SARS-CoV. By employing the immunoinformatic approach, we prioritized 20 MHC I and 10 MHCII conserved epitopes to design a multi-epitope vaccine. This vaccine candidate is anticipated to strongly elicit both humoral and cell-mediated immune responses. These results warrant further development of this vaccine into real-world application.
1. Introduction
Coronaviruses are enveloped, single positive-stranded RNA viruses that have been discovered in a wide spectrum of hosts including humans, bats, camels, mice, and hedgehogs. These viruses belong to the family Coronaviridae and subfamily Coronavirinae, which are further subdivided into four groups, the alpha, beta, gamma, and delta coronaviruses [1]. In general, coronavirus infection in humans is self-limiting and only causes mild symptoms associated with the common cold. A new member of coronaviruses was identified in late December 2019 and designated as SARS-CoV-2. It was epidemiologically linked to a wet market in Wuhan, China, and is considered of zoonotic origin [2]. As of 22 February 2022 (according to Chinese CDC; 2019ncov.chinacdc.cn/2019-nCoV (accessed on 22 February 2022), more than 76,000 cases of COVID-19 have been confirmed in China. Similar to the previously identified SARS-CoV and MERS-CoV, SARS-CoV-2 causes severe acute respiratory diseases. However, it is more contagious with the capability of human-to-human transmission but is less pathogenic with a mortality rate of approximately 2–3%. Genetically, it is closely related to SARS-CoV and bat SARS-like coronavirus (SL-CoV), but more distal to MERS-CoV [3].
SARS-CoV-2 shows similarities with the genome composition of SARS-CoV, MERS-CoV, and other human coronaviruses. The 3′-terminus of the coronavirus genome encodes four major structural proteins including spike (S), envelope (E), membrane (M), and nucleocapsid (N) proteins. The 3′-terminus of the genome also encodes multiple accessory proteins that are usually genus-specific and helps to increase the virulence or evade immune response [4]. For instance, SARS-CoV contains accessory protein ORF 3a, 3b, 6, 7a, 7b, 8a, 8b and 9b; MERS-CoV contains ORF 3, 4a, 4b, 5, 8b; and SARS-CoV-2 contains ORF 3a, 6, 7a, 7b, 8, 10. Although there have been numerous attempts to develop vaccines against HCoV infections in recent decades, their considerable sequence diversity is a limiting factor. Given the high homology between SARS-CoV-2 and other coronaviruses, there is a high possibility of conserved antigenic epitopes [5]. Therefore, previous exposure to MERS, SARS, or seasonal human coronaviruses (i.e., 229E, NL63, OC43, and HKU1) may contribute to modulating immunity against SARS-CoV-2 infection.
No common effective pan-CoV licensed vaccines are available yet that have broad activity against these zoonotic viruses. Currently, scientists and biotech industries are in a race to develop a vaccine against SARS-CoV-2. However, conventional approaches require a yearlong process to develop a vaccine with the major issue of containment including biosafety and biosecurity requirements. This limitation can be overcome by using immunoinformatic approaches. Targeted delivery of vaccine antigen to antigen-presenting cells (APCs) is a major goal of immunoinformatic based vaccines [6]. This enhances vaccine exhibition and is an effective strategy for making more efficient vaccines. The induction of robust T-cell responses is required to increase the relevance for vaccine efficacy [7]. In a multiepitope vaccine processing pathway, the exogenous vaccine antigens are internalized by endosome, cleaved by proteases, presented to MHCII molecules in endosomes, and transported to the cell membrane for the priming of CD4+ T-cells. There are two pathways for cross-presentation of the multiepitope vaccine candidate. In the cytosolic pathway, exogenous vaccine antigens are endocytosed and chopped by proteases. The resulting peptides either escape by the endosomal membrane via endoplasmic reticulum associated degradation (ERAD). The escaped peptides will be processed by the proteasome and transported to ER where they are packaged onto MHC-I with the help of TAP and finally transported onto the cell membrane for CD8+ T-cell activation. These peptides can also be digested by the proteasome and transported back to the endosomes where they are loaded onto MHC-I molecules and subsequently transported to the cell membrane for CD8+ T-cell priming. In the vacuolar pathway, in contrast, the antigens will be degraded inside the endosome and directly loaded onto the MHC-I molecules that will be transported onto the cell membrane for CD8+ T-cell stimulation (Figure 1). In the classical MHC-I pathway, the proteasome will digest the endogenous vaccine antigens in the cytosol and transport it to the endoplasmic reticulum (ER) for loading onto MHC-I molecules with the help of the TAP protein. Here, the MHC-I-peptide will be transported onto the cell membrane for the CD8+ T cell priming [8].
Figure 1.
(A) The phylogenetic analysis of the spike consensus sequences of SARS-CoV-2 and other representatives of the genus Betacoronavirus. The consensus sequences were generated from genome sequences of SARS-CoV-2 (n = 6000), HKU1-CoV (n = 37), SARS-CoV (n = 42), MERS-CoV (n = 101), OC43-CoV (n = 56), bat-SL-CoV (n = 39), murine-CoV (n = 19), camel-CoV (n = 14), and hedgehog-CoV (n = 5) [10,11]. (B) A comparison of the protein sequences of the S1 and S2 subunits of the spike region with the consensus sequences of SARS-CoV-2, bat SL-CoV, and SARS-CoV. Analysis was performed and displayed using MEGAX. (C) Tertiary structures of the spike region based on the consensus sequences of SARS-CoV-2, bat SL-CoV, and SARS-CoV predicted by ITASSER. CoV: coronavirus; MERS: Middle East respiratory syndrome; SARS: severe acute respiratory syndrome; SL: SARS-like.
In the current study, we targeted the spike (S) glycoprotein of the coronaviruses for the prediction of a pan-CoV vaccine. The glycoprotein of the coronavirus consists of two subunits, S1 and S2. It is responsible for recognizing the host cell receptors and is considered as a major target for coronavirus vaccine development [9]. By employing immunoinformatic approaches, we first analyzed the evolutionary features and genetic conservation of the spike (S) region of the coronavirus followed by mapping of the immunogenicity and epitope profile of the spike protein. We finally demonstrate a proof-of-concept for designing a multi-epitope vaccine against SARS-CoV-2 that can prove useful from a post-pandemic perspective to prevent subsequent infectious waves.
2. Materials and Methods
2.1. Sequence Retrieval
The genome sequences of SARS-CoV-2 (n = 6000), HKU1-CoV (n = 37), SARS-CoV (n = 42), MERS-CoV (n = 101), OC43-CoV (n = 56), bat-SL-CoV (n = 39), murine-CoV (n = 19), camel-CoV (n = 14), and hedgehog-CoV (n = 5) were retrieved from Genbank [10] and the virus pathogen resource database (ViPR) [11]. GenBank (http://www.ncbi.nlm.nih.gov (accessed on 23 February 2022) is a comprehensive database that contains publicly available nucleotide sequences obtained primarily through the sequence data received from individual laboratories and large-scale sequencing projects [12]. The workflow of the ViPR database provides access to sequence records, immune epitopes, 3D structures, gene and protein annotations as well as the host factor data of a broad range of virus pathogens including the entire Coronaviridae family [13].
2.2. Sequence Conservation, Similarity and Phylogenetic Analysis
In order to find the conserved regions of selected coronavirus sequences, sequence alignment was conducted. Sequences of the coronavirus spike protein from all groups were aligned by using CLC workbench7 [14], MEGAX [15], and Bioedit software [16] to generate the consensus sequence. All of the selected sequences with a similarity greater than 50% in relation to SARS-CoV-2 were subjected to further analysis. Overall conserved regions (OCR) of these species (similarity > 50%) were obtained by aligning their consensus sequence. Blastp [17] was used to calculate the similarity percentage with the human proteome to avoid an autoimmune response. Phylogenetic analyses of the spike regions were performed using RAxML software (version 8.2.9) [18] with 1000 bootstrap replicates by employing the general time reversible nucleotide substitution model.
2.3. Epitope Mapping and Selection
For the production of an epitope-based vaccine, T-cell (MHC-I and MHC-II) epitope prediction is very important. By using a consensus sequence of the selected coronavirus spike, MHC I and MHC II epitopes were predicted by the HLApred server [19] and by an online immune epitope database resource (IEDB) available online http://tools.iedb.org/bcell/ (accessed on 25 March 2022) [20]. IEDB, Discotope (http://www.cbs.dtu.dk/services/DiscoTope (accessed on 25 March 2022)) and Ellipro [3] software were also used for B-cell epitope prediction. Epitopes predicted by more than one software were considered for further analysis. In order to select suitable B-cell epitopes, the prediction was conducted on the basis of their antigenicity, surface accessibility, flexibility, beta turn, and hydrophilicity. Only epitopes that were present on the outer surface were selected. Intracellular epitopes were eliminated. In order to determine the IFN-gamma inducing MHC class II binding peptides, the IFN epitope server was used [6]. Furthermore, all of the T-cell epitopes overlapped with the B-cell and IFN-γ epitopes, and those also present in conserved regions were prioritized. The antigenicity of the selected epitopes was analyzed by using the Vaxijen server [21]. The epitopes with higher antigenicity were selected for further analysis. To construct a sub-unit vaccine, the epitopes with the following properties were selected: (i) antigenic, (ii) conserved, (iii) overlapping with B and IFny epitopes, (iv) having high binding affinity with human allele, and (vi) have no similarity to the human proteins.
2.4. Multi-Epitope Vaccine Design and Secondary/Tertiary Structure Prediction
All of the selected epitopes were linked together with the AAY linker. AAY linkers increase the structural stability of epitopes by avoiding self-folding, improve the epitope presentation, and enhance the immunogenicity of th vaccine construct [22]. To further increase the immunogenicity of the vaccine construct, β-defensin (45 amino acids; GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK) was added at its N-terminal by the EAAAK linker. The 3D structure of the vaccine construct was predicted by I-TASSER [23]. I-TASSER is an integrated server and a hierarchical protein structure modeling approach based on the sequence-to-structure-to-function paradigm and structure convergence of the Monte Carlo simulations [24]. A higher C-score of the predicted structure represents the model with a higher stability and confidence. A further secondary structure was evaluated by PSIPRED [25]. Refinement of the predicted structure was conducted by using GlaxyRefine (http://galaxy.seoklab.org/cgi-bin/submit.cgi?type=REFINE (accessed on 28 March 2022)) and Modrefiner [26]. These two methods can improve the quality of the vaccine construct. GalaxyRefine server performed the best in improving the local structure quality according to community-wide CASP10 experiments [27]. Structure validation was performed by the Ramachandran plot (http://mordred.bioc.cam.ac.uk/~rapper/rampage.php accessed on 3 April 2022) and PROSA server [28].
2.5. Comparison of Secondary Structures
The secondary structures of the selected spike protein were predicted by using PSIPRED [25] and PDBsum [29]. The online server PRISPRED (http://bioinf.cs.ucl.ac.uk/psipred (accessed on 6 April 2022), efficiently generates the secondary structure as well as predicts the transmembrane topology, transmembrane helix, fold, and domain recognition regions of a given query protein. The PDBsum database portrays the structural features and molecular composition of DNA, ligands, proteins, and metal ions as well as a pictorial representation of their interactions [30]. These structures were evaluated for changes in the alpha helix, strands, and coils in spike proteins.
2.6. Evaluation of Physiochemical Properties and Molecular Docking of the Vaccine Construct with Toll-like Receptor 3
The physical and chemical characteristics of the final vaccine construct including molecular weight, aliphatic index, grand average of hydropathicity, theoretical isoelectric point, in-vitro and in-vivo half-life and stability index were evaluated by using online server Protparam (http://web.expasy.org/protparam (accessed on 6 April 2022). Molecular docking analysis of the vaccine construct with Toll-like receptor (TLR3) was performed by information-driven, integrative flexible docking with the HADDOCK server [31]. HADDOCK makes use of a variety of restraints including NMR chemical shift perturbations, chemical cross-linking, hydrogen/deuterium exchange, and mutagenesis during the docking process to drive and score the complex formation [32].
3. Results
3.1. The Evolutionary Features SARS-CoV-2 Spike Region
Phylogenetic analysis is used to evaluate the evolutionary relatedness among different viruses by using their genomic sequences. To comprehensive map and avoid sequence selection bias, we first retrieved a large number of spike sequences from different types of coronaviruses (human and zoonotic). We then performed consensus sequence analysis to generate one consensus sequence for each type (Supplementary Figure S1). These sequences were subjected to phylogenetic analysis. As shown in the phylogenetic tree, the spike of SARS-CoV-2 is closely related to bat SL-CoV and SARS-CoV, but distal to other members KU1-CoV, MERS-CoV, OC43-CoV, camel-CoV, murine-CoV, and hedgehog-CoV (Figure 1A). The betacoronaviruses that are important to human health include OC43, HKU1, SARS-CoV, SARS-CoV-2, and MERS-CoV. The natural reservoir for betacoronaviruses are bats and rodents. Therefore, in the present study, we used the spike protein of the human infecting coronavirus and the rodent infecting betacoronavirus.
3.2. Genetic Conservation Analysis
Blastp analysis of the consensus sequence of the SARS-CoV-2 spike region showed a 77% identity with bat SL-CoV and 76% identity with SARS-CoV. Additionally, no identity was observed with the human proteome. The conserved regions greater than nine amino acids were observed with these two betacoronavirus. Within the S1 subunit of the spike, the signal peptide of SARS-CoV was only 21% identical to bat SL-CoV and 58% identical to SARS-CoV. The core domain was 56% identical to bat SL-CoV and 52% to SARS-CoV. The binding domain had a 71% similarity with bat SL-COV and 73.6% with SARS-CoV (Figure 1B). The S2 domain was highly conserved and showed a 92% similarity with bat SL-CoV and 90% with SARS-CoV (Figure 1B). Thus, the S2 domain represents an ideal target for vaccine and drug design. Overall, 27 conserved regions (>9 amino acids) were identified among the spike regions of these three types of coronaviruses (Supplementary Table S1). In contrast, much less similarity of the SARS-CoV-2 spike to KU1-CoV (35%), MERS-CoV (35%), OC43-CoV (38%), camel-CoV (38%), murine-CoV (36.4%), and hedgehog-CoV (33.5%) was observed, and no conserved region greater than nine amino acids was identified.
3.3. Epitope Mapping of Spike Protein
Based on the analyzed genetic features, we believe that the spike is a candidate target for multi-epitope vaccine development. We thus adopted strict and regressive criteria to identify the epitopes. Nine mer MHC I and II epitopes with a binding affinity to the maximum number of alleles were predicted against the spike region of SARS-CoV-2, bat SL-CoV, and SARS-CoV. Furthermore, twenty mer B-cell and nine mer IFN-γ epitopes were also predicted. All T-cell epitopes overlapping the B-cell and IFN-γ epitopes and present in the conserved regions based on the consensus sequences were screened out. By evaluating the antigenicity, epitopes with an antigenicity less than 5 threshold were excluded for further study. Blastp was performed to avoid any human protein homologous epitope and autoimmune response. Based on the strict screening approach, the prioritized epitopes had the following features: (1) Maximum binding affinity to a large number of human alleles (2) present in the conserved region and colocalized with predicted epitopes (IFN-γ and B-cell), and (3) highly antigenic and nonhuman homologs. Based on these filters. Based on these criteria, we finally prioritized 20 MHC I (named T1-T20) and 10 MHCII epitopes (named L1-L10) for the vaccine design (Table 1).
Table 1.
A list of the final selected epitopes that fulfilled all of the criteria for antigenicity (>4), nonallergenicity, non-toxicity, and could also induce the IFN-γ immune response. The respective position represents the location of epitope in the spike protein. Epitopes T1–T20 represent the MHC I epitopes while epitopes L1–L10 represent the MHCII epitopes.
We next characterized the secondary (Supplementary Figure S1) and tertiary structures of the spike (Figure 1C) based on the consensus sequences of SARS-CoV-2, bat SL-CoV, and SARS-CoV.
3.4. Multi-Epitope Vaccine Design and Characterization
To design a multi-epitope vaccine, the prioritized epitopes were joined together by using the AAY linker. The AAY linker increases the structural stability and immunogenicity of the vaccine construct. An adjuvant β-defensin was added at the N-terminal of the vaccine construct by the EAAAK linker to enhance the antigenicity (Figure 2A). Overall antigenicity was confirmed by analysis with the Vaxijen server, and allergenicity was checked by AllergenPro, confirming that it was not an allergen in nature. Overall antigenicity of the vaccine construct was 2, proposing the vaccine construct as antigenic in nature.
Figure 2.
(A) A schematic illustration of the vaccine construct showing epitopes with linkers and adjuvant (β-defensin). The predicted tertiary structure (3D) of the vaccine construct by homology modeling on I-TASSER. (B) Validation of the refined tertiary structure with Ramachandran plot analysis showing 92.7% region in favored region, 6.5% in allowed regions, and 0.8% in outlier regions. (C) The tertiary structure validation by ProSA-web showing a Z-score of −1.5. (D) Molecular docking of the vaccine construct with the immune receptor TLR3. Red color indicates the vaccine construct (chain B) while the blue color indicates TLR3 (chain A). Molecular interactions are shown between chain A and B.
3.5. Secondary and Tertiary Structure Prediction and Validation
The information regarding the quality of the secondary and tertiary structure of the vaccine construct is of significant importance in designing a vaccine. It is important for the efficient presentation of epitopes on MHC to stimulate a strong immune response [33,34]. The secondary structure of the vaccine was predicted by PESIPRED and PDBsum. The secondary structure analysis showed that it had three sheets, three beta alpha beta units, two beta hairpin, one beta bulge, nine strands, 18 helices, 14 helix–helix interacts, 37 beta turns, and 13 gamma turns (Supplementary Figure S2). The further tertiary structure was predicted by using I-TASSER [35]. Five 3D structures of vaccine construct were predicted by the I-TASSER on the basis of ten threading templates, with confidence score (C-score) values (−3.96 to −1.31). Usually, the high C score model represents high stability and confidence. Tertiary structure refinement (Figure 2A) indicates that an area of 92.7% of the vaccine construct was in the favorable region, 6.5% in the allowed region while 0.8% was in the outlier region, suggesting that it is a stable structure (Figure 2B). The predicted model quality was further confirmed by ProSA, showing a Z score as 1.5 (Figure 2C).
3.6. Prediction of Physiochemical Properties
The ideal vaccine construct should have viable physiochemical properties. The physiochemical properties of this vaccine candidate were estimated by ProtParam. The molecular weight of the vaccine construct was 40,812 and the isoelectric point was 8.5, thus representing it as basic in nature. The vaccine half-life was estimated to be 30 h in mammalian reticulocytes in vitro, less than 20 h in yeast in vivo, and less than 10 h in Escherichia coli in vivo. The instability index was calculated to be 26.91 classifying it as a stable protein. The aliphatic index was 94.04 and the grand average of hydropathicity was 0.134.
3.7. Molecular Docking Analysis with TLR3
The vaccine candidate association with a specific immune receptor is required in the activation of innate immunity and the synchronization of the adaptive immune response after the recognition of pathogen associated molecular patterns (PAMPs) of pathogens. The immune receptor TLR3 is essential in defending coronavirus infections [36]. Interestingly, molecular docking indicates active interactions between our vaccine construct with TLR3. The vaccine construct developed eight hydrogen bonds with TLR3. All of the hydrogen bonds were laid at a distance of 2–3 Å, revealing strong interactions (Figure 2D). These results collectively suggest that this designed vaccine is stable and highly immunogenic, holding promise for further development.
4. Discussion
The prevalence of SARS-CoV-2 has raised concerns regarding future pandemics. Therefore, there is an urgent need to develop pan-coronavirus vaccines that can target not only the current SARS-CoV-2 variants of concern, but also future putative pandemics. Although dozens of ‘universal’ coronavirus vaccines are in development, there is no pan-coronavirus vaccine. Therefore, there is an urgent need for a pan-coronavirus vaccine with broad neutralizing activity. Powerful genomics technologies have a significant impact on reverse vaccinology, and decreased the time for vaccine development. Genome mining’, and the information driven from functional and structural proteomics, provide novel approaches for a more rapid screening of antigens, leading to a third generation of vaccines. In addition, pan-genomic reverse vaccinology, with the comparison of protein sequences from various isolates of the same species of a pathogen, increases the possibility of the identification of conserved vaccine candidates [37]. Based on these technologies, immunoinformatic approaches can be applied to design a pan-coronavirus vaccine.
The coronavirus spike protein is the major surface protein that binds to the host cell receptor and mediates virus entry. Thus, the genetic information within the spike region constitutes the essential clues for understanding virus evolution, transmission, and pathogenesis. The receptor binding domain in the spike protein is the most variable part of the virus genome. This region of SARS-CoV-2 is also closely related to bat SL-CoV and SARS-CoV [38]. Instead of using individual coronavirus sequences, we mapped the genetic features of the spike by generating the consensus sequences for each type of coronavirus from a large set of individual sequences. Such information is important when considering sequence-dependent functions of the viral proteins. Our results confirmed that the spike of SARS-CoV-2 is most closely related to bat SL-CoV and SARS-CoV. Importantly, our conservation analysis has paved the way for the design of a multi-epitope vaccine targeting the spike protein. In this study, we took the advantage of an immunoinformatics strategy, and designed a multi-epitope vaccine based on highly conserved regions of the spike protein. These selected epitopes have the potential to generate more specific, effective, strong, and long-lasting immune responses while avoiding undesired side effects. This pan-coronavirus vaccine is proposed to provide broad protective immunity against major coronaviruses and is durable. Designing vaccines that activate T-cells is yet another route toward a pan-coronavirus vaccine. T-cells and inflammatory cytokines may contribute to viral clearance [38]. In the present study, we used the conserved T-cell epitopes with high antigenicity values. In addition, these epitopes were present in both the S1 and S2 regions of the spike protein. However, most of the epitopes were located in the S2 region. The S2 region is more conserved among coronaviruses than S1. Therefore, it may elicit more cross-reactivity and thus be able to combat other betacoronaviruses, elicit a stronger and longer-lasting memory response, and reduce the likelihood of variations. Among the selected epitopes for designing a vaccine construct, few predicted epitopes have been experimentally validated. For example, epitopes T3, L2, L3, T12–T18 are reported to be present in the antigen region [39]. Similarly, the epitopes T2–T3 and L3 were also present in the linear epitope “hot” regions reported by Li et al. [40]. In light of these experimentally validated epitopes, our results and the designed methodology were further authenticated. The designed vaccine also possesses suitable physiochemical and structural properties. Interestingly, our vaccine construct is expected to strongly interact with TLR3 to enhance immune responses.
Upon multistage in silico analysis, this vaccine candidate is anticipated to strongly elicit both humoral and cell-mediated immune responses. Thus, we postulate that this vaccine could be a potentially powerful prophylactic and therapeutic agent against SARS-CoV-2. As it is designed based on the most conserved regions of the spike, it should be applicable for the current and future epidemics evolved from these related coronaviruses. Future experimental research is warranted to develop this vaccine further into real-world applications.
Supplementary Materials
The following supporting information can be downloaded at: https://www.mdpi.com/article/10.3390/vaccines10071150/s1, Table S1. All 27 conserved regions observed in SARS-CoV-2, bat SL-CoV and SARS-CoV consensus sequences of spike region; Figure S1. Illustration of generating spike consensus sequences using SARS-CoV-2 and bat SL-CoV as examples; Figure S2. Schematic representation of secondary structure prediction of spike of SARS-CoV-2 (left), bat SL-CoV (middle) and SARS-CoV (right) based on the consensus sequences; Figure S3. Schematic representation of secondary structure prediction of the multi-epitope vaccine construct.
Author Contributions
Z.B. and A.I. wrote the first draft of the manuscript; A.I. designed the study; A.I., Z.B., S.S., A.N., B.R., K.G., J.A.Q., F.M.A. and A.O. finished the bioinformatic process as well as statistical analysis; and A.I. was responsible for supervising, manuscript writing, and revising. All authors have read and agreed to the published version of the manuscript.
Funding
This work was supported by the key research and development programs (2019ZF004 and 202103AC100001) of Yunnan Province.
Institutional Review Board Statement
Not applicable.
Informed Consent Statement
Not applicable.
Data Availability Statement
Not applicable.
Acknowledgments
We acknowledge IMBB, UOL for their administrative support.
Conflicts of Interest
All authors declare no conflict of interest.
References
- Woo, P.C.; Huang, Y.; Lau, S.K.; Yuen, K.-Y. Coronavirus genomics and bioinformatics analysis. Viruses 2010, 2, 1804–1820. [Google Scholar] [CrossRef] [Green Version]
- Zhu, N.; Zhang, D.; Wang, W.; Li, X.; Yang, B.; Song, J.; Zhao, X.; Huang, B.; Shi, W.; Lu, R. A novel coronavirus from patients with pneumonia in China, 2019. N. Engl. J. Med. 2020, 382, 727–733. [Google Scholar] [CrossRef]
- Zhou, P.; Yang, X.-L.; Wang, X.-G.; Hu, B.; Zhang, L.; Zhang, W.; Si, H.-R.; Zhu, Y.; Li, B.; Huang, C.-L. A pneumonia outbreak associated with a new coronavirus of probable bat origin. Nature 2020, 579, 270–273. [Google Scholar] [CrossRef] [Green Version]
- Fang, P.; Fang, L.; Zhang, H.; Xia, S.; Xiao, S. Functions of coronavirus accessory proteins: Overview of the state of the art. Viruses 2021, 13, 1139. [Google Scholar] [CrossRef]
- Mathew, S.; Fakhroo, A.D.; Smatti, M.; Al Thani, A.A.; Yassine, H.M. Immunoinformatics prediction of potential immunodominant epitopes from human coronaviruses and association with autoimmunity. Immunogenetics 2022, 74, 213–229. [Google Scholar] [CrossRef]
- Dhanda, S.K.; Vir, P.; Raghava, G.P. Designing of interferon-gamma inducing MHC class-II binders. Biol. Direct 2013, 8, 30. [Google Scholar] [CrossRef] [Green Version]
- Panagioti, E.; Klenerman, P.; Lee, L.N.; Van Der Burg, S.H.; Arens, R. Features of effective T cell-inducing vaccines against chronic viral infections. Front. Immunol. 2018, 9, 276. [Google Scholar] [CrossRef] [Green Version]
- Du, G.; Sun, X. Engineering nanoparticulate vaccines for enhancing antigen cross-presentation. Curr. Opin. Biotechnol. 2020, 66, 113–122. [Google Scholar] [CrossRef]
- Wang, Q.; Wong, G.; Lu, G.; Yan, J.; Gao, G.F. MERS-CoV spike protein: Targets for vaccines and therapeutics. Antivir. Res. 2016, 133, 165–177. [Google Scholar] [CrossRef]
- Benson, D.A.; Cavanaugh, M.; Clark, K.; Karsch-Mizrachi, I.; Lipman, D.J.; Ostell, J.; Sayers, E.W. GenBank. Nucleic Acids Res. 2012, 41, D36–D42. [Google Scholar] [CrossRef] [Green Version]
- Pickett, B.E.; Sadat, E.L.; Zhang, Y.; Noronha, J.M.; Squires, R.B.; Hunt, V.; Liu, M.; Kumar, S.; Zaremba, S.; Gu, Z. ViPR: An open bioinformatics database and analysis resource for virology research. Nucleic Acids Res. 2012, 40, D593–D598. [Google Scholar] [CrossRef]
- Clark, K.; Karsch-Mizrachi, I.; Lipman, D.J.; Ostell, J.; Sayers, E.W. GenBank. Nucleic Acids Res. 2016, 44, D67–D72. [Google Scholar] [CrossRef] [Green Version]
- Pickett, B.E.; Greer, D.S.; Zhang, Y.; Stewart, L.; Zhou, L.; Sun, G.; Gu, Z.; Kumar, S.; Zaremba, S.; Larsen, C.N. Virus pathogen database and analysis resource (ViPR): A comprehensive bioinformatics database and analysis resource for the coronavirus research community. Viruses 2012, 4, 3209–3226. [Google Scholar] [CrossRef] [Green Version]
- Workbench, C.G. v3. 6. 2010. Available online: http://www.clcbio.com/products/clcgenomicsworkbench (accessed on 27 March 2022).
- Kumar, S.; Stecher, G.; Li, M.; Knyaz, C.; Tamura, K. MEGA X: Molecular evolutionary genetics analysis across computing platforms. Mol. Biol. Evol. 2018, 35, 1547. [Google Scholar] [CrossRef]
- Hall, T.; Biosciences, I.; Carlsbad, C. BioEdit: An important software for molecular biology. GERF Bull. Biosci. 2011, 2, 60–61. [Google Scholar]
- Mahram, A.; Herbordt, M.C. Fast and accurate NCBI BLASTP: Acceleration with multiphase FPGA-based prefiltering. In Proceedings of the 24th ACM International Conference on Supercomputing, Ibaraki, Japan, 2–4 June 2010; pp. 73–82. [Google Scholar]
- Stamatakis, A. RA × ML version 8: A tool for phylogenetic analysis and post-analysis of large phylogenies. Bioinformatics 2014, 30, 1312–1313. [Google Scholar] [CrossRef]
- Singh, H.; Raghava, G. ProPred: Prediction of HLA-DR binding sites. Bioinformatics 2001, 17, 1236–1237. [Google Scholar] [CrossRef] [Green Version]
- Vita, R.; Overton, J.A.; Greenbaum, J.A.; Ponomarenko, J.; Clark, J.D.; Cantrell, J.R.; Wheeler, D.K.; Gabbard, J.L.; Hix, D.; Sette, A. The immune epitope database (IEDB) 3.0. Nucleic Acids Res. 2014, 43, D405–D412. [Google Scholar] [CrossRef]
- Doytchinova, I.A.; Flower, D.R. VaxiJen: A server for prediction of protective antigens, tumour antigens and subunit vaccines. BMC Bioinform. 2007, 8, 1. [Google Scholar] [CrossRef] [Green Version]
- Shamriz, S.; Ofoghi, H.; Moazami, N. Effect of linker length and residues on the structure and stability of a fusion protein with malaria vaccine application. Comput. Biol. Med. 2016, 76, 24–29. [Google Scholar] [CrossRef]
- Zhang, Y. I-TASSER server for protein 3D structure prediction. BMC Bioinform. 2008, 9, 40. [Google Scholar] [CrossRef] [Green Version]
- Yang, J.; Zhang, Y. I-TASSER server: New development for protein structure and function predictions. Nucleic Acids Res. 2015, 43, W174–W181. [Google Scholar] [CrossRef] [Green Version]
- McGuffin, L.J.; Bryson, K.; Jones, D.T. The PSIPRED protein structure prediction server. Bioinformatics 2000, 16, 404–405. [Google Scholar] [CrossRef]
- Xu, D.; Zhang, Y. Improving the physical realism and structural accuracy of protein models by a two-step atomic-level energy minimization. Biophys. J. 2011, 101, 2525–2534. [Google Scholar] [CrossRef] [Green Version]
- Heo, L.; Park, H.; Seok, C. GalaxyRefine: Protein structure refinement driven by side-chain repacking. Nucleic Acids Res. 2013, 41, W384–W388. [Google Scholar] [CrossRef] [Green Version]
- Wiederstein, M.; Sippl, M.J. ProSA-web: Interactive web service for the recognition of errors in three-dimensional structures of proteins. Nucleic Acids Res. 2007, 35, W407–W410. [Google Scholar] [CrossRef] [Green Version]
- Laskowski, R.A. PDBsum: Summaries and analyses of PDB structures. Nucleic Acids Res. 2001, 29, 221–222. [Google Scholar] [CrossRef]
- Laskowski, R.A.; Thornton, J.M. PDBsum extras: SARS-CoV-2 and AlphaFold models. Protein Sci. 2022, 31, 283–289. [Google Scholar] [CrossRef]
- van Dijk, M.; van Dijk, A.D.; Hsu, V.; Boelens, R.; Bonvin, A.M. Information-driven protein–DNA docking using HADDOCK: It is a matter of flexibility. Nucleic Acids Res. 2006, 34, 3317–3325. [Google Scholar] [CrossRef]
- Dominguez, C.; Boelens, R.; Bonvin, A.M. HADDOCK: A protein−protein docking approach based on biochemical or biophysical information. J. Am. Chem. Soc. 2003, 125, 1731–1737. [Google Scholar] [CrossRef] [Green Version]
- Meza, B.; Ascencio, F.; Sierra-Beltrán, A.P.; Torres, J.; Angulo, C. A novel design of a multi-antigenic, multistage and multi-epitope vaccine against Helicobacter pylori: An in silico approach. Infect. Genet. Evol. 2017, 49, 309–317. [Google Scholar] [CrossRef] [PubMed]
- Scheiblhofer, S.; Laimer, J.; Machado, Y.; Weiss, R.; Thalhamer, J. Influence of protein fold stability on immunogenicity and its implications for vaccine design. Expert Rev. Vaccines 2017, 16, 479–489. [Google Scholar] [CrossRef] [PubMed]
- Yang, J.; Yan, R.; Roy, A.; Xu, D.; Poisson, J.; Zhang, Y. The I-TASSER Suite: Protein structure and function prediction. Nat. Methods 2015, 12, 7–8. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Totura, A.L.; Whitmore, A.; Agnihothram, S.; Schafer, A.; Katze, M.G.; Heise, M.T.; Baric, R.S. Toll-Like Receptor 3 Signaling via TRIF Contributes to a Protective Innate Immune Response to Severe Acute Respiratory Syndrome Coronavirus Infection. MBio 2015, 6, e00638-15. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Bambini, S.; Rappuoli, R. The use of genomics in microbial vaccine development. Drug Discov. Today 2009, 14, 252–260. [Google Scholar] [CrossRef]
- Dolgin, E. Pan-coronavirus vaccine pipeline takes form. Nat. Reviews. Drug Discov. 2022, 21, 324–326. [Google Scholar] [CrossRef]
- Chen, L.; Pang, P.; Qi, H.; Yan, K.; Ren, Y.; Ma, M.; Cao, R.; Li, H.; Hu, C.; Li, Y. Evaluation of Spike Protein Epitopes by Assessing the Dynamics of Humoral Immune Responses in Moderate COVID-19. Front. Immunol. 2022, 13, 770982. [Google Scholar] [CrossRef]
- Li, Y.; Ma, M.-l.; Lei, Q.; Wang, F.; Hong, W.; Lai, D.-Y.; Hou, H.; Xu, Z.-W.; Zhang, B.; Chen, H. Linear epitope landscape of the SARS-CoV-2 Spike protein constructed from 1051 COVID-19 patients. Cell Rep. 2021, 34, 108915. [Google Scholar] [CrossRef]
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations. |
© 2022 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).

