Next Article in Journal
Chemical Composition and Assessment of Antimicrobial Activity of Lavender Essential Oil and Some By-Products
Previous Article in Journal
Frontiers in the Standardization of the Plant Platform for High Scale Production of Vaccines
Previous Article in Special Issue
Light Spectral Composition Influences Structural and Eco-Physiological Traits of Solanum lycopersicum L. cv. ‘Microtom’ in Response to High-LET Ionizing Radiation
 
 
Search for Articles:
Title / Keyword
Author / Affiliation / Email
Journal
Article Type
 
 
Advanced Search
 
Section
Special Issue
Volume
Issue
Number
Page
 
Journals
Plants
Volume 10
Issue 9
10.3390/plants10091827
plants-logo
Submit to this Journal Review for this Journal Propose a Special Issue
► Article Menu

Article Menu

share Share announcement Help format_quote Cite question_answer Discuss in SciProfiles thumb_up
...
Endorse textsms
...
Comment
first_page
settings
Order Article Reprints
Font Type:
Arial Georgia Verdana
Font Size:
Aa Aa Aa
Line Spacing:
Column Width:
Background:
Article

Chloroplastic SaNADP-ME4 of C3–C4 Woody Desert Species Salsola laricifolia Confers Drought and Salt Stress Resistance to Arabidopsis

by
Zhibin Wen
1,2,3,†,
Yulan Wang
1,3,†,
Chunlan Xia
1,3,
Yuhui Zhang
1,3 and
Hongxiang Zhang
1,2,3,*
1
State Key Laboratory of Desert and Oasis Ecology, Xinjiang Institute of Ecology and Geography, Chinese Academy of Sciences, Urumqi 830011, China
2
The Specimen Museum of Xinjiang Institute of Ecology and Geography, Chinese Academy of Sciences, Urumqi 830011, China
3
University of Chinese Academy of Sciences, Beijing 100049, China
*
Author to whom correspondence should be addressed.
†
Authors contributed equally to this work.
Plants 2021, 10(9), 1827; https://doi.org/10.3390/plants10091827
Submission received: 2 July 2021 / Revised: 30 August 2021 / Accepted: 30 August 2021 / Published: 3 September 2021
(This article belongs to the Special Issue Effects of Abiotic Stress on Plants 2020–2021)
Browse Figures
Versions Notes

Abstract

:
The NADP-malic enzyme (NADP-ME) catalyzes the reversible decarboxylation of L-malate to produce pyruvate, CO2, and NADPH in the presence of a bivalent cation. In addition, this enzyme plays crucial roles in plant developmental and environment responses, especially for the plastidic isoform. However, this isoform is less studied in C3–C4 intermediate species under drought and salt stresses than in C3 and C4 species. In the present study, we characterized SaNADP-ME4 from the intermediate woody desert species Salsola laricifolia. SaNADP-ME4 encoded a protein of 646 amino acids, which was found to be located in the chloroplasts based on confocal imaging. Quantitative real-time PCR analysis showed that SaNADP-ME4 was highly expressed in leaves, followed by stems and roots, and SaNADP-ME4 expression was improved and reached its maximum under the 200 mm mannitol and 100 mm NaCl treatments, respectively. Arabidopsis overexpressing SaNADP-ME4 showed increased root length and fresh weight under mannitol and salt stress conditions at the seedling stage. In the adult stage, SaNADP-ME4 could alleviate the decreased in chlorophyll contents and PSII photochemical efficiency, as well as improve the expression of superoxide dismutase, peroxidase, and pyrroline-5-carboxylate synthase genes to enhance reactive oxygen species scavenging capability and proline levels. Our results suggest that SaNADP-ME4 overexpression in Arabidopsis increases drought and salt stress resistance.

1. Introduction

The NADP-malic enzyme (NADP-ME; EC 1.1.1.40) is an ancient and widely distributed enzyme involved in different metabolic pathways in bacteria, fungi, animals, and plants [1]. It catalyzes the reversible decarboxylation of L-malate to produce pyruvate, CO2, and NADPH in the presence of a bivalent cation [2]. Plant NADP-MEs are grouped into photosynthetic and non-photosynthetic isoforms. Photosynthetic NADP-MEs supply CO2 for carbon fixation in the bundle sheath cell chloroplasts of some C4 plants or the cytosol of some crassulacean acid metabolism (CAM) plants [2,3]. Additionally, non-photosynthetic NADP-MEs are distributed in the plastid or cytosol involved in various processes, including housekeeping roles such as the maintenances of cellular pH, generation of reductive power, regulation of guard cells, regulation of osmotic pressure for stomatal movement, fruit ripening, and response to multiple abiotic stresses [2,3,4,5,6,7,8,9].
The NADP-ME is encoded by a small multigene family, often including 2–5 NADP-MEs, and cytosolic and plastidic NADP-ME isoforms have also been described [4,10,11,12,13,14,15,16,17]. In C3 plants, there are four NADP-MEs in Arabidopsis thaliana and Oryza sativa consisting of three cytosolic and one plastidic NADP-ME [10,11], and there are five NADP-MEs in Populus trichocarpa consisting of three cytosolic and two putative plastidic NADP-MEs [16]. In C4 plants, there are five NADP-MEs in Zea mays including three cytosolic and two plastidic isoforms [4], and there are three NADP-MEs in Flaveria trinervia including one cytosolic and two plastidic isoforms [13,14]. Finally, there are three NADP-MEs in Hydrilla verticillata including two cytosolic and one plastidic NADP-ME [17]. In a CAM plant, Aloe arborescens, its NADP-ME family includes three genes, two cytosolic NADP-MEs, and one plastidic NADP-ME [12].
Suggestive data regarding the participation of NADP-ME in abiotic stress have been reported for several plant species [6,7], especially for the two common abiotic stress factors of drought and salinity [18,19]. In Oryza sativa, the expression level of plastidic NADP-MEs is elevated under all four stress conditions (mannitol, PEG, ABA, and NaCl) compared to that of controls. In contrast, the expression of three cytosolic NADP-MEs (OscytME1, OscytME2, and OscytME3) is induced by some stimuli and not by others. OscytME1 is induced by PEG and NaCl; OscytME2 is induced by mannitol, PEG, and NaCl; and OscytME3 is induced by mannitol and NaCl [10]. Additionally, transgenic Arabidopsis plants overexpressing OsNADP-ME2, OsNADP-ME3, or OsNADP-ME4 show resistance to salt and osmotic stresses [20,21,22]. In Populus trichocarpa, semi-quantitative RT-PCR analysis shows that five NADP-MEs respond to salt and osmotic stresses, and NaCl salts are found to significantly upregulate the transcripts of two putative plastidic NADP-MEs compared to another three cytosolic NADP-MEs [16]. In tobacco, PEG treatment or drought induces the increase of NADP-ME activity in leaves and increases transcript abundance of chloroplastic NADP-ME [15,23]. The constitutive expression of ZmNADP-ME in chloroplasts of tobacco plants confers drought tolerance by decreasing stomatal conductance and improving water use efficiency [24]. Restricted expression of chloroplastic NADP-ME (non-photosynthetic isoform) particularly in the guard and vascular companion cells of tobacco also enhances water use efficiency, and induces earlier flowering and shorter life cycle [15]. The overexpression of SbNADP-ME from sweet sorghum in Arabidopsis increases salt tolerance by improved proline content and alleviates PSII and PSI photoinhibition under salt stress by improving photosynthetic capacity [8]. These studies suggest that plastidic NADP-ME plays an important role in abiotic stresses [6].
However, little is known about the regulatory function of plastidic NADP-MEs from C3–C4 intermediate species under drought and salt stresses. C3–C4 intermediates have been identified in 56 species from 13 families of eudicots and monocots [25], which are different from C3 and C4 plants in structures and functions [26]. Additionally, C3–C4 lineages bridge the ecological gap to C4 photosynthesis [25]. Therefore, more NADP-MEs from C3–C4 intermediate species should be considered to better understand their functions and regulation mechanisms in plant tolerance to stress.
Salsola laricifolia is a woody desert species belonging to the family Amaranthaceae [27], and it is a typical C3–C4 intermediate species based on its anatomy, ultrastructure, and enzyme activity [28]. In previous studies, three NADP-MEs of S. laricifolia have been identified based on the transcriptome data of mixed leaf, stem, and root samples. Additionally, one of them (namely SaNADP-ME4) showed a higher similarity (74.7%) with AtNADP-ME4 (a plastidic isoform from Arabidopsis thaliana, AT1G79750.1) than the other two NADP-MEs from S. laricifolia. In this study, we further cloned SaNADP-ME4. Based on confocal imaging, the SaNADP-ME4 was found to be located in the chloroplasts. Additionally, the expression of SaNADP-ME4 was significantly induced by mannitol and salt stresses in S. laricifolia, suggesting that it might be involved in these two stresses. Then, we transformed SaNADP-ME4 into Arabidopsis and investigated the function of SaNADP-ME4 during drought and salt stresses. Our study provides insight into the function of chloroplast SaNADP-ME4 of C3–C4 intermediate species in abiotic stress resistance.

2. Results

2.1. The Protein SaNADP-ME4 Is Chloroplast-Localized

SaNADP-ME4 was a 1941 bp ORF (GenBank No. MZ420664) that was predicted to encode a 646 amino acid protein. To gain insights into the position of SaNADP-ME4, the phylogenetic analyses of SaNADP-ME4 and other plant NADP-MEs from 14 different plants (including Aloe arborescens, Arabidopsis thaliana, Flaveria bidentis, Flaveria pringlei, Hydrilla verticillata, Lycopersicon esculentum, Mesembryanthemum crystallinum, Nicotiana tabacum, Oryza sativa, Populus trichocarpa, Ricinus communis, Triticum aestivum, Vitis vinifera, and Zea mays) were carried out. All plant NADP-MEs were classified into four groups: Group I (cytosolic eudicot types), Group II (plastidic eudicot types), Group III (monocot types), and Group IV (found in both eudicots and monocots). SaNADP-ME4 clustered with the plastidic eudicot NADP-ME group (Group II) (Figure 1). The SaNADP-ME4-GFP fusion gene and GFP under the control of the CaMV35S promoter were found to be transiently expressed in Arabidopsis protoplasts. Confocal imaging showed that SaNADP-ME4-GFP was distributed in the chloroplasts (Figure 2a).
A comparison of SaNADP-ME4 and the other eight chloroplastic NADP-ME proteins in Group II showed that the predicted amino acid sequence of SaNADP-ME4 had five conserved sites (Figure S1), a typical feature of NADP-ME proteins. Additionally, these five sites were conserved, as only one or two differences were found to exist in sites I and II (Figure S1). SaNADP-ME4 was found to share 73.3% identity with AtChlNADP-ME (Arabidopsis thaliana, AT1G79750.1), 72.5% with FbChlNADP-ME (Flaveria bidentis, AAW56450.1), 73.5% with FpChlNADP-ME (Flaveria pringlei, P36444.1), 74.0% with LeChlNADP-ME (Lycopersicon esculentum, AAB58727), 73.7% with NtChlNADP-ME (Nicotiana tabacum, DQ923119), 75.6% with PtChlNADP-ME (Populus trichocarpa, 7470579), 76.3% with RcChlNADP-ME (Ricinus communis, AAF73006.1), and 76.5% with VvChlNADP-ME (Vitis vinifera, U67426), respectively.

2.2. Analysis of the Expression of SaNADP-ME4 in S. laricifolia

To determine the expression of SaNADP-ME4 in S. laricifolia, the expression of SaNADP-ME4 in three different tissues was determined using RT-qPCR. SaNADP-ME4 was highly expressed in leaves, followed by the stems and roots (Figure 2b). Additionally, its protein localization was found to be in chloroplasts (Figure 2a). Therefore, the expression of SaNADP-ME4 in leaves will be studied on abiotic stress.
For the investigation of whether SaNADP-ME4 is involved in abiotic stress, the expression of SaNADP-ME4 in response to mannitol and salt stresses was studied. Compared to the control, SaNADP-ME4 expression was significantly enhanced to 1.7, 1.7, and 3.2 fold in 100, 150, and 200 mm mannitol treatments, respectively (Figure 2c), and it was enhanced to 1.5, 2.2, and 1.8 fold in 50, 100, and 150 mm NaCl treatments, respectively (Figure 2d). Taken together, these results indicate that the expression of SaNADP-ME4 could be induced by mannitol and salt treatments.

2.3. Overexpression of SaNADP-ME4 Enhances Osmotic and Salt Tolerances at the Seedling Stage

Transgenic Arabidopsis plants with the overexpression of SaNADP-ME4 were generated using an Agrobacterium-mediated transformation method for the analysis of the function of SaNADP-ME4. In total, 14 lines were generated. The transcript levels of SaNADP-ME4 were first determined using RT-qPCR. The results showed that the exogenous SaNADP-ME4 was significantly overexpressed in all transgenic lines, indicating that the overexpression lines had been successfully generated. Two transgenic lines (Lines 8 and 14) with relatively higher expression levels compared to other 12 lines were chosen for further studies on stress tolerance (Figure S2).
No significant difference in the germination percentage, root length, and fresh weight of the WT and Arabidopsis overexpression lines was observed in the control conditions (Figure 3d–f). Additionally, the seed germination percentage showed that there were no obvious differences between the WT and transgenic lines under the 225 mm mannitol treatment. However, the seed germination percentage was inhibited by salt stress; that of the overexpressing Lines 8 and 14 were 63% and 71%, respectively, and it was 83% in the WT under the 125 mm NaCl treatment (p < 0.05) (Figure 3d). Under both the 125 mm NaCl and 225 mm mannitol treatments, transgenic seedlings had obvious longer root lengths and higher fresh weights than the WT seedlings, respectively (Figure 3e,f). However, there was no significant difference in lateral root number between the WT and transgenic seedlings under all treatments (Figure 3a–c). These results indicated that the overexpression of SaNADP-ME4 enhanced the osmotic and salt stress resistance of transgenic Arabidopsis at the seedling stage.

2.4. Overexpression of SaNADP-ME4 Alleviates the Decreased in Chlorophyll Contents and PSII Photochemical Efficiency under Drought and Salt Stresses

Four-week-old WT and transgenic plants were compared under the control conditions, as well as drought and salt stresses. Under the control conditions, we observed no significant differences in chlorophyll a content, chlorophyll b content, and fresh weight (Figure 4b–d). Additionally, under drought and salt stresses, the overexpressing lines grew better than the WT line (Figure 4a). Though the chlorophyll a content, chlorophyll b content, and fresh weight were decreased compared to those in the control conditions, they were significantly higher than those in the WT plants under drought and salt stresses (Figure 4b–d).
We observed no significant differences in the PSII maximal photochemical efficiency (Fv/Fm) ratio and ETR (photosynthetic electron transportation rate) values of the WT and overexpressing Arabidopsis lines, respectively (Figure S3a,b). Though the Fv/Fm ratio and ETR values were decreased compared to those in the control conditions, they were significantly higher than those in the WT plants under drought and salt stresses (Figure S3a,b). The transgenic plants exhibited higher Y(II) (effective photochemical quantum yield of PSII) and Y(NPQ) (quantum yield of regulated energy dissipation of PSII)) values, as well as lower Y(NO) (quantum yield of non-regulated energy dissipation of PSII) values, relative to the WT line (p < 0.05) (Figure S3c–e). Under NaCl and drought stresses, Y(II) values were decreased compared to those in the control conditions, whereas Y(NPQ) and Y(NO) values were increased compared to those of the controls (Figure S3c–e). Under NaCl and drought stresses, the Y(NPQ) of the WT, Lane 8, and Lane 14 plants increased by 3.3 (3.3%), 11.8 (8.8%), and 6.1 (6.1%), respectively; the Y(NO) of WT, Lane 8, and Lane 14 increased by 8.0 (10.0%), 2.4 (9.7%), and 2.5 (7.5%), respectively. These results suggest that SaNADP-ME4 confers significant drought and salt stress resistance to transgenic plants by alleviating their decreased PSII photochemical efficiency.

2.5. Overexpression of SaNADP-ME4 Decreases Oxidative Damages under Drought and Salt Stresses

To evaluate oxidative accumulation, hydrogen peroxide (H2O2) content was examined. The measurement of H2O2 content showed that two overexpressing lines accumulated less H2O2 than the WT plants under both drought and salt stresses (Figure 5a). Malondialdehyde (MDA) content and electrolyte leakage were used as indexes of membrane injury [29]. Under the control conditions, the MDA content and electrolyte leakage of all test lines did not greatly vary (Figure 5b,c). However, both the MDA content and electrolyte leakage were increased when exposed to salt and drought stress conditions. The two overexpressing lines accumulated less MDA than the WT line under both drought and salt stresses (Figure 5b). Consistently, electrolyte leakage was lower in the transgenic plants compared to the WT plants under both drought and salt stress conditions (Figure 5c). These results together suggest that SaNADP-ME4 confers drought and salt stress resistance by decreasing oxidative damages.

2.6. Overexpression of SaNADP-ME4 Enhances Proline Biosynthesis under Drought and Salt Stresses

To determine whether SaNADP-ME4 is involved in adjusting osmotic potential, the proline contents were measured. Under the control conditions, the WT and two overexpression lines had similar proline contents (Figure 6a). However, when exposed to drought and salt stresses, all the studied lines displayed increased proline contents relative to those under the control conditions. In addition, compared to the WT plants, the overexpression lines accumulated significantly higher amounts of proline (Figure 6a). To further determine whether the overexpression of SaNADP-ME4 could affect the relative expression level of proline biosynthesis-related genes, two genes—pyrroline-5-carboxylate synthase 1 (P5CS1) and P5CS2—were studied. There was no difference in the relative expression level of P5CS1 and P5CS2 between the WT and overexpression lines under the control conditions based on RT-qPCR. When exposed to drought and salt stresses, the relative expression levels of P5CS1 and P5CS2 were significantly higher in the two overexpression lines compared to those in the WT plants (Figure 6b,c).

2.7. Overexpression of SaNADP-ME4 Regulates of ROS Scavenging Capability under Drought and Salt Stresses

The activities of two main reactive oxygen species (ROS) scavenging enzymes including superoxide dismutase (SOD) and peroxidase (POD) were analyzed in transgenic and WT plants under drought and salt stress conditions. Similar changes were observed in the two overexpressing lines, since similar levels of SOD and POD activities were detected in the transgenic and WT plants under the control conditions, but we also observed substantial increases in SOD and POD activities in the drought-treated and salt-treated transgenic lines compared to the WT plants (Figure 7a,b). To further determine whether the varied SOD and POD activities were caused by changes in the expression of SOD and POD genes, the relative expression levels of six related genes were examined. There were no differences in the relative expression levels of SOD1, SOD2, SOD3, POD1, POD2, and POD3 among all studied lines under the control conditions. When exposed to drought and salt stresses, the relative expression levels of these six genes were significantly higher in the two overexpressing lines compared to those in the WT plants (Figure 7c–h).

2.8. Overexpression of SaNADP-ME4 Increases of the Total NADP-ME Activity under Drought and Salt Stresses

The total NADP-ME activity in the leaf protein extracts of the overexpressing plants was examined. The two overexpressing lines showed ~2 fold increases of NADP-ME activity relative to the WT plants under the control conditions. Additionally, when exposed to drought and salt stresses, all the studied lines displayed increased NADP-ME activity relative to those under the control conditions. In addition, compared to the WT plants, the overexpression lines accumulated significantly higher NADP-ME activities under drought and salt stresses (Figure S4).

3. Discussion

Salsola laricifolia is a typical desert C3–C4 intermediate species [28]. In the present work, we isolated the chloroplastic SaNADP-ME4 and transformed it into Arabidopsis to investigate its function under drought and salt stresses. SaNADP-ME4 was found to encode a protein of 646 amino acids, to be located in the chloroplasts based on confocal imaging (Figure 2a), and to have amino acid sequences with five conserved sites (sites I–V) (Figure S1) common to plant NADP-MEs [3]. Additionally, the expression of SaNADP-ME4 was not found to be tissue-specific (Figure 2b), as shown in Arabidopsis thaliana NADP-ME4 (chloroplastic type) [11], Populus trichocarpa NADP-ME4, and NADP-ME5 (putative plastidic types) [16]. Plant NADP-MEs have been divided into four groups: Group I (cytosolic dicot types), Group II (plastidic dicot types), Group III (monocot types), and Group IV (both eudicots and monocots) [3,11,16,30]. The present results showed that SaNADP-ME4 clustered with the plastidic eudicot NADP-ME group (Group II) (Figure 1). Additionally, the alignment of the protein sequences of SaNADP-ME4 and the other eight chloroplastic NADP-MEs in Group II showed that SaNADP-ME4 had higher chloroplastic NADP-ME sequences from seven C3 plants than the photosynthetic isoform from the C4 plant Flaveria bidentis (FbChlNADP-ME) (see Section 2.1).
In the present study, the analysis of SaNADP-ME4 transcripts in the leaves of S. laricifolia under different mannitol and salt treatments showed that the highest transcript level was attained under the 200 mm mannitol and 100 mm NaCl treatments (Figure 2c,d), suggesting that SaNADP-ME4 may be involved in osmotic and salt responses. Furthermore, SaNADP-ME4 can positively regulate the osmotic and salt stress tolerance of Arabidopsis overexpression plants in both the seedling and adult stages. At the seedling stage, the root length of the WT and overexpression lines were inhibited in both the 125 mm NaCl and 225 mm mannitol treatments compared to that of all studied lines in the control conditions. Additionally, the degree of inhibition in the WT line was significantly higher than that of the overexpression lines (Figure 3e). Similar changes of fresh weight were found in all studied lines under the mannitol treatment. However, under NaCl stress, the fresh weight of the overexpression lines was higher than that in the control conditions (Figure 3f). These results suggest that the overexpression of SaNADP-ME4 increases plant osmotic and salt stress resistance to some extent at the seedling stage.
Previous studies have described the plastidic NADP-ME as a stress-responsive enzyme [4,8,15]. In this present study, the overexpression of SaNADP-ME4 conferred drought and salt stress resistance to Arabidopsis in the adult stage. SaNADP-ME4-overexpressed plants showed better growth phenotypes and possessed greater fresh weights than the WT line under the drought and salt stress conditions (Figure 4a). The chlorophyll content and florescence parameters of the WT and overexpression lines were compared under NaCl and drought treatments in all studied lines (Figure 4b,c and Figure S3). Chlorophyll content is an important indicator of photosynthetic capacity and can reflect it to some degree [31]. Under drought and salt stress conditions, the chlorophyll a and b contents of the Arabidopsis plants were reduced. In addition, the chlorophyll a and b contents decreased less in the overexpression lines than in the WT line (Figure 4b,c). There is usually a close connection between the chlorophyll content and photochemical efficiency of PSII [31]. A higher chlorophyll a content was found to result in higher photochemical efficiency values of PSII in SaNADP-ME4 overexpression lines (Figure S3a–d).
The model of Kramer et al. [32] suggests that the quantum yield of PS II consists of Y(II), Y(NPQ), and Y(NO), which represent light energy absorbed by PSII used in photochemical reactions, heat dissipation via safe light-regulated quenching, and heat dissipation via harmful non-regulated non-photochemical quenching in PSII, respectively. In the present study, higher Y(II) and Y(NPQ) and lower Y(NO) values relative to the WT line were exhibited in the control condition, suggesting that the overexpression levels led to a higher photochemical efficiency of PSII. Under salt and drought stresses, Y(II) values decreased to a lesser degree than that of the WT line (Figure S3c), suggesting that the decrease in light energy used in photochemical reaction was alleviated in the overexpression lines compared to the WT line. The heat dissipation through the NPQ of chlorophyll fluorescence plays an important role in protecting plants from stresses. Additionally, Y(NO) is an important index of light damage [32,33]. The present results showed that the extent of increase in the Y(NPQ) and Y(NO) of overexpression lines was different under NaCl and drought stresses, i.e., to a greater extent in Y(NPQ) and a lesser extent in Y(NO) compared to the WT line (Figure S3d,e), suggesting that the extent of damage from excess light energy was less in the overexpression lines; as a result, the Fv/Fm and ETR were higher (Figure S3a,b). These results suggest that the decrease of PS II photochemical efficiency was alleviated by the overexpression of SaNADP-ME4 in Arabidopsis. A similar study showed that the overexpression of SbNADP-ME from sweet sorghum in Arabidopsis alleviates the decreased in PSII and PSI photoinhibition under salt stress in the seedling stage [8].
When exposed to various abiotic stresses, the excess production of ROS can cause oxidative damage to cellular components, such as membranes, DNA, protein, and lipids [34]. Therefore, it is important for plants to control ROS at a suitable level. The activities of two main ROS scavenging enzymes (SOD and POD) were analyzed in all studied lines under drought and salt stress conditions. The present results showed that under drought and salt stress conditions, the activities of SOD and POD were significantly improved in transgenic plants relative to those in the WT plants (Figure 7a,b), as did in the expression of the SOD and POD genes (Figure 7c–h). Additionally, the H2O2 content in the transgenic plants was greatly reduced compared to the WT plants (Figure 5a). In general, these results showed that SaNADP-ME4 positively affected the regulation of the SOD and POD genes, thus contributing to the increased SOD and POD activities and resulting in decreased H2O2 levels and enhanced drought and salt stress tolerance.
The present results showed that the total NADP-ME activity in the WT and transgenic plants was significantly increased under drought and salt stress conditions (Figure S4). Both the PEG treatment and drought stress caused increases in NADP-ME activity in tomato leaves and chloroplast NADP-ME expression [15,23]. The NADP-ME, especially the chloroplast NADP-ME, plays an important role in drought stress sensing and confers excessive ROS detoxification in chloroplasts [6]. The NADP-ME, which provides NADPH, is essential for antioxidant functions [35]. The NADP-ME and other NADPH-producing dehydrogenases such as glucose-6-phosphate dehydrogenase (G6PDH), isocitrate dehydrogenase (ICDH), and ferredoxin-NADP reductase (FNR), which recycle NADPH, are necessary for protection against oxidative damages in olive plants [35]. NADPH is also an important molecule in the redox balance of a cell [6,35,36]. Redox regulation and ROS metabolism are interlinked and interconnect mitochondria, chloroplast, and other organelles to a wider cellular redox-network. The redox state of NAD(P)H is one of the factors that influences that network [36]. Additionally, new tools are available for monitoring NADPH dynamics and manipulating NADP+/NADPH in live cells [37,38]. Therefore, NADPH may be important in revealing the function of SaNADP-ME4 in ROS scavenging under stress.
Proline is an important oxmolyte when exposed to various abiotic stresses, acting to maintain redox balance and radically scavenging to protect plant cells [39]. In the present study, both proline content (Figure 6a) and the expression of proline biosynthesis genes (P5CS1 and P5CS2) in the WT and transgenic plants were greatly increased under drought and salt stress conditions (Figure 6b,c). Therefore, the increase in proline content caused by SaNADP-ME4 may enable positive adjustments in Arabidopsis under drought and salt stress conditions. The overexpression of SbNADP-ME from sweet sorghum in Arabidopsis was found to increase proline content and result in salt resistance [8]. The induced NADP-ME activity linked to drought and salt stresses (Figure S4) was probably involved in providing particular NAD(P)H, not only to supply reducing power for the synthesis of proline but also in general for the basal metabolism of plants—in particular, under stress [36,40].

4. Materials and Methods

4.1. Plant Materials and Growth Conditions

Seeds of Salsola laricifolia were collected from Toli City (Xinjiang, China). Seeds were stored at 4 °C before being germinated on moist paper at room temperature, and they were then placed in a growth chamber (a relative humidity of approximately 40–50%, day/night temperatures of 25/18 °C, a 14/10 h light/night photoperiod, and an irradiance of 400 μmol photons m–2s–1). Then, two-week-old seedlings were transplanted to 9 cm diameter pots with a Hoagland solution. Each pot was supplemented with a float with eight holes and contained eight plants. Irradiance was increased to 1000 μmol photons m–2s–1 [41] until two-month-old plants were chosen. The Hoagland solution was changed every week.
The Arabidopsis thaliana L. Col-0 ecotype was used as the genetic background/wild type (WT) for the transgenic plants generated in this study. Plants were grown in a chamber with standard growth conditions (a relative humidity of approximately 60–70%, day/night temperatures of 22/20 °C, a 16/8 h light/night photoperiod, and an irradiance of 400 μmol photons m−2s−1).

4.2. Sequence and Phylogenetic Analysis

Multiple alignments of complete predicted amino acid sequences of NADP-MEs from 14 different plants accessible from NCBI public databases were performed using ClusterW 2. The phylogenetic tree was constructed with the neighbor joining method using the MEGA 6.0 program [42]. Usually, there were five sites within the amino acid sequences of the NADP-MEs on the basis of the C4-NADP-ME from maize: site I (VYTPTVGEACQKYG), site II (IQVIVVTDGERILGLGDLGCQGMGIPVGKL), site III (QFEDFANHNAF), site IV (FNDDIQGTASVVL), and site V (LFLGAGEAGTGIAEL) [2]. To ascertain whether SaNADP-ME4 had these five conserved sites, the protein sequences of SaNADP-ME4 and eight other chloroplastic NADP-MEs were aligned: AtChlNADP-ME, FbChlNADP-ME; FpChlNADP-ME, LeChlNADP-ME, NtChlNADP-ME, PtChlNADP-ME, RcChlNADP-ME, and VvChlNADP-ME.

4.3. Subcellular Localization Analysis

The PCR products corresponding to the full coding sequence (without stop codon) were first cloned in pMD18-T using gene-specific primers containing an SmaI restriction site and then fused with the N-terminus of the green fluorescent protein (GFP) reporter, the expression of which was driven by the CaMV 35S promoter in the pBI121 vector. The primers for vector construction were designed with Primer Premier 5 were: pBI121-GFP-F: TTTCATTTGGAGAGAACACG; pBI121-GFP-R: CGACCAGGATGGGCACCAC; pBI121(in-fusion)-SaNADP-ME4-F: ACTCTAGACTGGTACCCATGATCTCTCTTCAAA; and pBI121(in-fusion)-SaNADP-ME4-R: CTAGTCAGTCGACCCTCACCGGTAGCTTCTGT. The vector sequences were underlined.
The SaNADP-ME4-GFP construct was used to transform the Arabidopsis protoplasts obtained from the fresh leaf tissue of 3-week-old plants for transient transformation. Protoplast isolation from A. thaliana leaves, as well as a transient expression assay, was conducted as previously described [43,44]. GFP and chlorophyll were excited with 488 and 633 nm laser lines, respectively, using a laser confocal microscope (Zeiss LSM 800, Jena, Germany) equipped with Zen software to process the image. The fluorescence signals were detected at 500–530 nm for GFP and at 650–750 nm for chlorophyll after exciting at 488 and 633 nm, respectively. Representative protoplasts from at least two independent experiments are shown on the same scale, including their merged and light fields.

4.4. Expression Analysis of SaNADP-ME4 in S. laricifolia under Different Tissues, Mannitol and NaCl Stresses

Two-month-old plants were chosen. All treatments started at 2 h after the beginning of a photoperiod. For different tissues, leaves, stems, and roots were all collected, immediately frozen in liquid nitrogen, and stored at −80 °C until use. For mannitol and NaCl stresses, a Hoagland solution with 0, 50, 100, 150, 200, 250, and 300 mm mannitol or 0, 50, 100, 150, and 200 mm NaCl was applied for 4 h, and then leaves were collected, immediately frozen in liquid nitrogen, and stored at −80 °C until use. Each treatment had four biological replicates.
Total RNA was isolated from 100 mg of frozen samples using a TransZol reagent (Transgen Biotech, Beijing, China) (four independent extractions for each treatment) following the manufacturer’s instructions. The RNA samples with absorption ratios of A260/A280 = 1.8–2.2 and A260/A230 higher than 2.0 were used for subsequent complementary DNA synthesis. The first-strand cDNA was synthesized using a Reversal Transcription Reagent Kit (Takara, Tokyo, Japan), following the manufacturer’s instructions. RT-qPCR was performed with a CFX96 Real-Time PCR detection system (Bio-Rad, Hercules, CA, USA) using SYBR Premix Ex Taq™ (Takara, Tokyo, Japan). The Sa18S and SaEF1-α of S. laricifolia were used as suitable reference genes for RT-qPCR in different tissues and different stresses, respectively [41]. The conditions for the amplification of RT-qPCR were: polymerase activation at 95 °C for 30 s and 40 cycles, with each cycle comprising 95 °C for 30 s, 55 °C for 10 s, and 72 °C for 15 s. All samples were run with two technical replicates, and three no template controls (replacing the template product with PCR-grade water) were included in every run to monitor possible DNA contamination. The relative expression of the detected genes was calculated using the 2−ΔΔCt method [45]. The primer pairs were designed with Primer Premier 5 as follows: SaNADP-ME4-F: GTTGTTACTGATGGTGAGCGGATTT; SaNADP-ME4-R: GGACGAATGCCACCAAGAGC; Sa18S-F: GGGCATTCGTATTTCATAGTCA; Sa18S-R: CGGCATCGTTTATGGTTGA; SaEF1-α-F: TCAGTTTGGTGGTTATTGGACA; and SaEF1-α-R: ACCTCTTGTTCATCTCAGCAGC.

4.5. Generation of SaNADP-ME4 Overexpressing Arabidopsis

The SaNADP-ME4-GFP construct was introduced into the WT Arabidopsis plant via the floral dip method [46]. T1–T3 generation seeds of transgenic plants were selected on a Murashige and Skoog (MS) medium containing 50 μg/mL of kanamycin. The kanamycin-resistant T1 seedlings were tested by PCR analysis and sequencing, and transgenic T3 homozygous lines were chosen for further studies based on their high expression levels of SaNADP-ME4. α-tubulin (AT1G50010) was used as a suitable reference for RT-qPCR in SaNADP-ME4 expression and different stresses [47]. The primers used in this experiment are listed in Table S1.

4.6. Assessment of the Mannitol and NaCl Stress Tolerance of Transgenic Arabidopsis at Germination Stage

For the germination stage, both the WT and transgenic T3 seeds were sterilized and then placed on MS medium plates (control) or MS medium plates supplied with either 125 mm NaCl or 225 mm mannitol. These plates were placed in refrigerator at 4 °C for 48 h and then on chamber benches with the standard growth conditions of A. thaliana. For each plate, at least 40 seeds were placed. Germination percentages were calculated after 7 days. Each treatment had four biological replicates.

4.7. Assessment of Mannitol and NaCl Stress Tolerance of Transgenic Arabidopsis at Seedling Stage

For the seedling stage, 7-day-old seedlings of WT and transgenic Arabidopsis cultured on the MS medium were transferred on the MS medium (control) or the MS medium supplied with either 125 mm NaCl or 225 mm mannitol, and then they were maintained for 7 days after a visible phenotype became evident. More than 30 seedlings of WT and each transgenic line were used for calculating the root length, lateral root number, and fresh weight.

4.8. Assessment of Drought and NaCl Stress Tolerance of Transgenic Arabidopsis at Adult Stage

Four-week-old plants from the WT and transgenic Arabidopsis cultured on soil (nutritive soil:vermiculite:perlite = 3:1:1, v/v) were chosen. For NaCl stress, Arabidopsis plants were watered with 300 mm NaCl and maintained for 7 days after a visible phenotype became evident. For drought stress, Arabidopsis plants were not provided with water and were maintained for 7 days after a visible phenotype became evident. For the fresh weight, 10 plants of the WT and each transgenic line under each condition were used.
For chlorophyll content, samples of fresh leaves were homogenized in a mortar and suspended in 3 mL of 96% (v/v) ethanol per 50 mg of tissue. After incubation in the dark until no green was visible, the extracts were centrifuged for 5 min at 10,000 ×  g; then, the supernatants were used to measured absorbance at 665 and 649 nm to obtain the concentrations of chlorophyll a and b [48]. Chlorophyll fluorescence was measured using PAM-2500 (Walz, Würzburg, Germany). Initially, plant material was incubated in the dark for 30 min. Minimal fluorescence (Fo) and maximum (Fm) florescence were measured with very weak red light (0.1 μmoL photons m−2s−1) and saturating light pulse (8000 μmol photons m−2s−1), respectively. The Fv/Fm ratio was determined as (Fm−Fo)/Fm. For ETR, Y(II), Y(NPQ), and Y(NO) values were obtained at the 500 μmol photons m−2s−1 light intensity.
Electrolyte leakage was assessed by ion leakage analysis, as previously described [49]. For enzyme extracts and assays for H2O2 content, MDA content, the total SOD activity, and POD activity, fresh leaves (0.3 g of fresh weight (FW)) were ground with an ice-cold 0.1 mol L−1 potassium phosphate buffer (pH 7.4), as suggested by the kit manufacturer (Nanjing Jiancheng Bioengineering Institute, China) (http://www.njjcbio.com/contents.asp?cid=2&wid=2&id=756) (accessed on 16 May 2019) and published literature [47,50,51]. Then, the extracts were centrifuged for 10 min at 8000 ×  g (4 °C) and the supernatants were measured using assay kits according to the manufacturer’s instructions (kit no. A064, A003-1, A001-1, A084-3; Nanjing Jiancheng Bioengineering Institute, China). The extractions and assays were all based on the manufacturers’ instruction. H2O2 content was determined using the method described by Jana and Choudhuri [52]. Briefly, 1 mL of supernatant was thoroughly mixed with 1 mL of 0.1% titanium sulphate in 20% H2SO4 (v/v), and the mixture was then centrifuged at 6000× g for 15 min at room temperature. The absorbance of the yellow color of the supernatant was measured at 410 nm. The measurement of MDA content was based on the thiobarbituric acid (TBA) method [53]. Briefly, after mixing trichloroacetic acid with the homogenate and centrifuging, a supernatant was obtained and TBA was added. The developed red color of the resulting reaction was measured at 532 nm with a spectrophotometer. The total activity of SOD was determined by measuring the inhibiting rate of the enzyme to the O2−·produced by the xanthine morpholine with xanthine oxidase using the SOD assay kit [54]. The POD activity was measured based on the change of absorbance at 420 nm by catalyzing H2O2 [55]. The quantitation of total protein was measured with the bicinchoninic acid (BCA) method [56] using an assay kit (no. A045; Nanjing Jiancheng Bioengineering Institute, China). Each treatment had four biological replicates. Proline content was measured using an acid-ninhydrin reagent and acetic acid [57]. Briefly, fresh leaves were ground with an ice-cold extraction solution provided in an assay kit (no. A107-1; Nanjing Jiancheng Bioengineering Institute, Nanjing, China). Well-mixed solutions were boiled at 100 °C for 30 min. After cooling to room temperature, the proline levels of samples were calculated at 520 nm absorbance.
Additionally, the expression of eight related genes—P5CS1 (AT2G39800), P5CS2 (AT3G55610), SOD1 (AT1G08830), SOD2 (AT2G28190), SOD3 (AT3G10920), POD1 (AT1G14550), POD2 (AT2G18140), and POD3 (AT5G58400)—was evaluated by RT-qPCR. α-tubulin was used as a suitable reference for RT-qPCR. The conditions for the amplification of RT-qPCR were: polymerase activation at 95 °C for 30 s and 40 cycles, which each cycle comprising 95 °C for 30 s, 55–60 °C for 10 s, and 72 °C for 15 s. The primers for this experiment are listed in Table S1.
The activities of the total NADP-ME activity were determined in supernatant according to Gerrard Wheeler et al. [11], and frozen leaves were used. NADP-ME activity was assayed using a mixture of 50 mm Tris-HCl (pH 7.5), 0.5 mm NADP, 10 mm malate, 10 mm MgCl2, and 10 μL of an extract containing the enzyme [11]. Each treatment had four biological replicates.

4.9. Statistical Analysis

All statistical tests were performed with SPSS v. 19.0 (SPSS Inc., Chicago, IL, USA) using an ANOVA, and differences were considered statistically significant at * p < 0.05.

5. Conclusions

In summary, we demonstrated that the expression of SaNADP-ME4 in the C3–C4 woody desert plant S. laricifolia is induced by drought and salt stresses. The overexpression of SaNADP-ME4 increased root length and fresh weight under mannitol and salt stress conditions at the seedling stage. At the adult stage, the overexpression of SaNADP-ME4 in Arabidopsis conferred drought and salt stress tolerance by alleviating decreases in chlorophyll content and PSII photochemical efficiency, as well as be activating ROS scavenging capability and osmotic adjustments. These findings provide useful information for the function of the chloroplast SaNADP-ME4 of intermediate species in abiotic stress resistance.

Supplementary Materials

The following are available online at https://www.mdpi.com/article/10.3390/plants10091827/s1. Figure S1: Alignment of the predicted amino acid sequences between SaNADP-ME4 and eight other chloroplastic NADP-MEs. Conserved sequences site (I–V) were found in all NADP-MEs. The access numbers to GenBank of each sequence are: AtChlNADP-ME (AT1G79750.1), FbChlNADP-ME (AAW56450.1), FpChlNADP-ME (P36444.1), LeChlNADP-ME (AAB58727), NtChlNADP-ME (DQ923119), PtChlNADP-ME (7470579), RcChlNADP-ME (AAF73006.1), and VvChlNADP-ME (U67426); Figure S2: Molecular identification of the SaNADP-ME4 transgenic Arabidopsis lines. (a) Genomic DNA PCR of overexpression lines, (b) the relative expression level of SaNADP-ME4 in the overexpression lines; Figure S3: Comparison of the Fv/Fm (PSII maximal photochemical efficiency) (a), ETR (photosynthetic electron transportation rate) (b), Y(II) (effective photochemical quantum yield of PSII) (c), Y(NPQ) (quantum yield of regulated energy dissipation of PSII) (d), and Y(NO) (quantum yield of non-regulated energy dissipation of PSII) (e) of WT and two overexpressing lines under the control, NaCl, and drought stress conditions. Values are means ± SD (standard deviation). Asterisk indicates a significant difference at the p < 0.05 significance level, as determined with SPSS v. 19.0; Figure S4: Analysis of the total NADP-ME activity affected by SaNADP-ME4. Values are means ± SD (standard deviation). Asterisks indicate a significant difference at the p < 0.05 significance level, as determined with SPSS v. 19.0.

Author Contributions

Investigation, Y.W. and Z.W.; methodology, Z.W. and H.Z.; software, Y.W. and C.X.; supervision, Z.W. and H.Z.; visualization, Y.W. and Y.Z.; writing—original draft preparation, Z.W.; writing—review and editing, Z.W. and H.Z. All authors have read and agreed to the published version of the manuscript.

Funding

This work was supported by the National Natural Science Foundation of China (Nos. 31970354; 31670339), and the Youth Innovation Promotion Association of Chinese Academy of Sciences (No. 2018479).

Institutional Review Board Statement

Not applicable.

Informed Consent Statement

Not applicable.

Data Availability Statement

The data presented in this study is available in the article.

Conflicts of Interest

The authors declare no conflict of interest.

References

  1. Edwards, G.E.; Andreo, C.S. NADP-malic enzyme from plants. Phytochemistry 1992, 31, 1845–1857. [Google Scholar]
  2. Drincovich, M.F.; Casati, P.; Andreo, C.S. NADP-malic enzyme from plants: A ubiquitous enzyme involved in different metabolic pathways. FEBS Lett. 2001, 490, 1–6. [Google Scholar] [CrossRef] [Green Version]
  3. Maier, A.; Zell, M.B.; Maurino, V.G. Malate decarboxylases: Evolution and roles of NAD(P)-ME isoforms in species performing C4 and C3 photosynthesis. J. Exp. Bot. 2011, 62, 3061–3069. [Google Scholar] [CrossRef] [Green Version]
  4. Alvarez, C.E.; Saigo, M.; Margarit, E.; Andreo, C.S.; Drincovich, M.F. Kinetics and functional diversity among the five members of the NADP-malic enzyme family from Zea mays, a C4 species. Photosynth. Res. 2013, 115, 65–80. [Google Scholar] [CrossRef] [PubMed]
  5. Badia, M.B.; Arias, C.L.; Tronconi, M.A.; Maurino, V.G.; Andreo, C.S.; Drincovich, M.F.; Gerrard Wheeler, M.C. Enhanced cytosolic NADP-ME2 activity in A. thaliana affects plant development, stress tolerance and specific diurnal and nocturnal cellular processes. Plant Sci. 2015, 240, 193–203. [Google Scholar] [CrossRef] [PubMed]
  6. Chen, Q.Q.; Wang, B.P.; Ding, H.Y.; Zhang, J.; Li, S.C. Review: The role of NADP-malic enzyme in plants under stress. Plant Sci. 2019, 281, 206–212. [Google Scholar] [CrossRef] [PubMed]
  7. Doubnerová Hýsková, V.; Ryšlavá, H. What can enzymes of C4 photosynthesis do for C3 plants under stress? Plant Sci. 2011, 180, 575–583. [Google Scholar] [CrossRef] [PubMed]
  8. Guo, Y.Y.; Song, Y.S.; Zheng, X.X.; Zhang, Y.; Guo, J.R.; Sui, N. NADP-malate dehydrogenase of sweet sorghum improves salt tolerance of Arabidopsis thaliana. J. Agric. Food Chem. 2018, 66, 5992–6002. [Google Scholar] [CrossRef] [PubMed]
  9. Maurino, V.G.; Gerrard Wheeler, M.C.; Andreo, C.S.; Drincovich, M.F. Redundancy is sometimes seen only by the uncritical: Does Arabidopsis need six malic enzyme isoforms? Plant Sci. 2009, 176, 715–721. [Google Scholar] [CrossRef]
  10. Chi, W.; Yang, J.; Wu, N.; Zhang, F. Four rice genes encoding NADP malic enzyme exhibit distinct expression profiles. Biosci. Biotech. Biochem. 2004, 68, 1865–1874. [Google Scholar] [CrossRef] [PubMed]
  11. Gerrard Wheeler, M.C.; Tronconi, M.A.; Drincovich, M.F.; Andreo, C.S.; Flügge, U.I.; Maurino, V.G. A comprehensive analysis of the NADP-malic enzyme gene family of Arabidopsis thaliana. Plant Physiol. 2005, 139, 39–51. [Google Scholar] [CrossRef] [Green Version]
  12. Honda, H.; Akagi, H.; Shimada, H. An isozyme of the NADP-malic enzyme of a CAM plant, Aloe arborescens, with variation on conservative amino acid residues. Gene 2000, 243, 85–92. [Google Scholar] [CrossRef]
  13. Lai, L.B.; Wang, L.; Nelson, T.M. Distinct but conserved functions for two chloroplastic NADP-malic enzyme isoforms in C3 and C4 Flaveria Species. Plant Physiol. 2002, 128, 125–139. [Google Scholar] [CrossRef] [PubMed]
  14. Marshall, J.S.; Stubbs, J.D.; Taylor, W.C. Two genes encode highly similar chloroplastic NADP-malic enzymes in Flaveria. Plant Physiol. 1996, 111, 1251–1261. [Google Scholar] [CrossRef] [Green Version]
  15. Müller, G.L.; Drincovich, M.F.; Andreo, C.S.; Lara, M.V. Nicotiana tabacum NADP-Malic enzyme: Cloning, characterization and analysis of biological role. Plant Cell Physiol. 2008, 49, 469–480. [Google Scholar] [CrossRef] [Green Version]
  16. Yu, Q.G.; Liu, J.W.; Wang, Z.F.; Nai, J.F.; Lü, M.Y.; Zhou, X.Y.; Chen, Y.X. Characterization of the NADP-malic enzymes in the woody plant Populus trichocarpa. Mol. Biol. Rep. 2013, 40, 1385–1396. [Google Scholar] [CrossRef]
  17. Estavillo, G.M.; Rao, S.K.; Reiskind, J.B.; Bowes, G. Characterization of the NADP malic enzyme gene family in the facultative, single-cell C4 monocot Hydrilla verticillata. Photosynth. Res. 2007, 94, 43–57. [Google Scholar] [CrossRef]
  18. Boyer, J.S. Plant productivity and environment. Science 1982, 218, 443–448. [Google Scholar] [CrossRef]
  19. Umezawa, T.; Fujita, M.; Fujita, Y.; Yamaguchi-Shinozaki, K.; Shinozaki, K. Engineering drought tolerance in plants: Discovering and tailoring genes to unlock the future. Curr. Opin. Biotechnol. 2006, 17, 113–122. [Google Scholar] [CrossRef]
  20. Cheng, Y.; Long, M. A cytosolic NADP-malic enzyme gene from rice (Oryza sativa L.) confers salt tolerance in transgenic Arabidopsis. Biotechnol. Lett. 2007, 29, 1129–1134. [Google Scholar] [CrossRef] [PubMed]
  21. Chen, L.; Tsugama, D.; Takano, S.; Liu, S.Q. Rice (Oryza sativa L.) OsNADP-ME4 gene responds to adversity stresses. Cell Biochem. Biophys. 2015, 4, 1–7. [Google Scholar]
  22. Liu, S.; Cheng, Y.; Zhang, X.; Guan, Q.; Nishiuchi, S.; Hase, K.; Takano, T. Expression of an NADP-malic enzyme gene in rice (Oryza sativa L.) is induced by environmental stresses; over-expression of the gene in Arabidopsis confers salt and osmotic stresses tolerance. Plant Mol. Biol. 2007, 64, 49–58. [Google Scholar] [CrossRef]
  23. Doubnerová Hýsková, V.; Miedzińska, L.; Dobra, J.; Vankova, R.; Ryšlavá, H. Phosphoenolpyruvate carboxylase, NADP-malic enzyme, and pyruvate, phosphate dikinase are involved in the acclimation of Nicotiana tabacum L. to drought stress. J. Plant Physiol. 2014, 171, 19–25. [Google Scholar] [CrossRef]
  24. Laporte, M.; Shen, B.; Tarczynski, M. Engineering for drought avoidance expression of maize NADP-ME in tobacco results in altered stomatal function. J. Exp. Bot. 2002, 53, 699–705. [Google Scholar] [CrossRef] [Green Version]
  25. Lundgren, M.R.; Christin, P.A. Despite phylogenetic effects, C3-C4 lineages bridge the ecological gap to C4 photosynthesis. J. Exp. Bot. 2017, 68, 241–254. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  26. Sage, R.F.; Khoshravesh, R.; Sage, T.L. From proto-Kranz to C4 Kranz: Building the bridge to C4 photosynthesis. J. Exp. Bot. 2014, 65, 3341–3356. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  27. The Angiosperm Phylogeny Group. An update of the angiosperm phylogeny group classification for the orders and families of flowering plants: APG IV. Bot. J. Linn. Soc. 2016, 181, 1–20. [Google Scholar] [CrossRef] [Green Version]
  28. Wen, Z.B.; Zhang, M.L. Salsola laricifolia, another C3–C4 intermediate species in tribe Salsoleae s.l. (Chenopodiaceae). Photosynth. Res. 2015, 123, 33–43. [Google Scholar] [CrossRef]
  29. Jaglo-Ottosen, K.R.; Gilmour, S.J.; Zarka, D.G.; Schabenberger, O.; Thomashow, M.F. Arabidopsis CBF1 overexpression induces COR genes and enhances freezing tolerance. Science 1998, 280, 104–116. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  30. Drincovich, M.F.; Lara, M.; Maurino, V.G.; Andreo, C. C4 decrboxylases: Different solutions for the same biochemical problem, the provision of CO2 in the bundle sheath cells. In C4 Photosynthesis and Related CO2 Concentrating Mechanisms; Raghavendra, A., Sage, R.F., Eds.; Springer: Berlin/Heidelberg, Germany, 2010; pp. 277–300. [Google Scholar]
  31. Sui, N.; Han, G. Salt-induced photoinhibition of PSII is alleviated in halophyte Thellungiella halophila by increases of unsaturated fatty acids in membrane lipids. Acta Physiol. Plant 2014, 36, 983–992. [Google Scholar] [CrossRef]
  32. Kramer, D.M.; Johnson, G.; Kiirats, O.; Edwards, G.E. New Fluorescence parameters for the determination of QA redox state and excitation energy fluxes. Photosynth. Res. 2004, 79, 209. [Google Scholar] [CrossRef]
  33. Wang, X.; Dinler, B.S.; Vignjevic, M.; Jacobsen, S.; Wollenweber, B. Physiological and proteome studies of responses to heat stress during grain filling in contrasting wheat cultivars. Plant Sci. 2015, 230, 33–50. [Google Scholar] [CrossRef]
  34. Baxter, C.J.; Redestig, H.; Schauer, N.; Repilber, D.; Patil, K.R.; Nielsen, J.; Selbig, J.; Liu, J.; Fernie, A.R.; Sweetlove, L.J. The metabolic response of heterotrophic Arabidopsis cells to oxidative stress. Plant Physiol. 2007, 143, 312–325. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  35. Valderrama, R.; Corpas, F.; Carreras, A.; Gόmez-Rodríguez, M.; Pedrajas, C.J.; Fernández-Ocaña, A.; Del Río, L.; Barroso, J. The dehydrogenase-mediated recycling of NADPH is a key antioxidant system against salt-induced oxidative stress in olive plant. Plant Cell Environ. 2006, 29, 1449–1459. [Google Scholar] [CrossRef] [PubMed]
  36. Suzuki, N.; Koussevitzky, S.; Mittler, R.; Miller, G. ROS and redox signally in the response of plants to abiotic stress. Plant Cell Environ. 2012, 35, 259–270. [Google Scholar] [CrossRef] [PubMed]
  37. Tao, R.K.; Zhao, Y.Z.; Chu, H.Y.; Wang, A.X.; Zhu, J.H.; Chen, X.J.; Zou, Y.J.; Shi, M.; Liu, R.M.; Su, N.; et al. Genetically encoded fluorescent sensors reveal dynamic regulation of NADPH metabolism. Nat. Methods 2017, 14, 720–728. [Google Scholar] [CrossRef]
  38. Cracan, V.; Titov, D.V.; Shen, H.Y.; Grabarek, Z.; Mootha, V.K. A genetically encoded tool for manipulation of NADP+/NADPH in living cells. Nat. Chem. Biol. 2017, 13, 1088–1095. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  39. Tan, Z.L.; Wen, X.J.; Wang, Y.C. Betala platuphylla BpHOX2 transcription factor binds to different cis-acting elements and confers osmotic tolerance. J. Integr. Plant Biol. 2020, 62, 1762–1779. [Google Scholar] [CrossRef]
  40. Zhu, J.J.; Schwörer, S.; Berisa, M.; Kyung, Y.J.; Ryu, K.W.; Yi, J.M.; Jiang, X.J.; Cross, J.R.; Thompson, C.B. Mitochondrial NADP(H) generation is essential for proline biosynthesis. Science 2021, 372, 968–972. [Google Scholar] [CrossRef]
  41. Zhang, Y.F.; Wen, Z.B.; Wang, Y.L.; Feng, Y. Suitable reference genes for real-time quantitative PCR in Salsola laricifolia under five abiotic stresses. Biol. Plantarum 2019, 63, 380–387. [Google Scholar] [CrossRef]
  42. Tamura, K.; Stecher, G.; Peterson, D.; Filipski, A.; Kumar, S. MEGA6: Molecular evolutionary genetics analysis version 6.0. Mol. Biol. Evol. 2013, 30, 2725–2739. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  43. Abdel-Ghany, S.E.; Müller-Moulé, P.; Niyogi, K.K.; Pilon, M.; Shikanai, T. Two-type ATPases are required for copper delivery in Arabidopsis thaliana chloroplasts. Plant Cell 2005, 17, 1233–1251. [Google Scholar] [CrossRef] [Green Version]
  44. Candat, A.; Poupart, P.; Andrieu, J.P.; Chevrollier, A.; Reynier, P.; Rogniaux, H.; Avelange-Macherel, M.; Macherel, D. Experimental determination of organelle targeting-peptide cleavage sites using transient expression of green fluorescent protein translational fusions. Anal. Biochem. 2013, 434, 44–51. [Google Scholar] [CrossRef] [PubMed]
  45. Livak, K.J.; Schmittgen, T.D. Analysis of relative gene expression data using real-time quantitative PCR and the 2(-Delta Delta C (T)) method. Methods 2001, 25, 402–408. [Google Scholar] [CrossRef] [PubMed]
  46. Bechtold, N.; Pelletier, G. In planta Agrobacterium-mediated transformation of adult Arabidopsis thaliana plants by vacuum infiltration. Methods Mol. Biol. 1998, 82, 259–266. [Google Scholar] [PubMed]
  47. Li, X.S.; Liang, Y.Q.; Gao, B.; Mijiti, M.; Bozorov, T.A.; Yang, H.L.; Zhang, D.Y.; Wood, A.J. ScDREB10, an A-5c type of DREB gene of the desert moss Syntrichia caninervis, confers osmotic and salt tolerances to Arabidopsis. Genes 2019, 10, 146. [Google Scholar] [CrossRef] [PubMed] [Green Version]
  48. Wintermans, J.F.G.M.; De Mots, A. Spectrophotometric characteristics of chlorophylls a and b and their pheophytins in ethanol. Biochim. Biophys. Acta 1965, 109, 448–453. [Google Scholar] [CrossRef]
  49. Weigel, R.R.; Bäuscher, C.; Pfitzner, A.J.; Pfitzner, U.M. NIMIN-1, NIMIN-2 and NIMIN-3, members of a novel family of proteins from Arabidopsis that interact with NPR1/NIM1, a key regulator of systemic acquired resistance in plants. Plant Mol. Biol. 2001, 46, 143–160. [Google Scholar] [CrossRef]
  50. Hu, L.X.; Li, H.Y.; Pang, H.C.; Fu, J.M. Responses of antioxidant gene, protein and enzymes to salinity stress in two genotypes of perennial ryegrass (Lolium perenne) differing in salt tolerance. J. Plant Physiol. 2012, 169, 146–156. [Google Scholar] [CrossRef]
  51. Li, H.X.; Xiao, Y.; Cao, L.L.; Yan, X.; Li, C.; Shi, H.Y.; Wang, J.W.; Ye, Y.H. Cerebroside C increases tolerance to chilling injury and alters lipid composition in wheat roots. PLoS ONE 2013, 8, e73380. [Google Scholar] [CrossRef] [Green Version]
  52. Jana, S.; Choudhuri, M.A. Glycolate metabolism of three submerged aquatic angiosperms during aging. Aquat. Bot. 1981, 12, 345–354. [Google Scholar] [CrossRef]
  53. Draper, H.H.; Hadley, M. Malondialdehyde determination as index of lipid peroxidation. Methods Enzymol. 1990, 186, 421–431. [Google Scholar]
  54. Ries, S.K.; Giannopolitis, C.N. Superoxide dismutases: II. Purification and quantitative relationship with water-soluble protein in seedlings. Plant Physiol. 1977, 59, 315–318. [Google Scholar]
  55. Chance, M.; Maehly, A.C. Assay of catalases and peroxidases. Method Enzy. 1955, 2, 764–817. [Google Scholar]
  56. Smith, P.K.; Krohn, R.I.; Hermanson, G.T.; Mallia, A.K.; Gartner, F.H.; Provenzano, M.D.; Fujimoto, E.K.; Goeke, N.M.; Olson, B.J.; Klenk, D.C. Measurement of protein using bicinchoninic acid. Anal. Biochem. 1985, 150, 76–85. [Google Scholar] [CrossRef]
  57. Bates, L.S.; Waldren, R.P.; Teare, I.D. Rapid determination of free proline for water-stress studies. Plant Soil 1973, 39, 205–207. [Google Scholar] [CrossRef]
Plants 10 01827 g001 550
Figure 1. Phylogenetic analysis of SaNADP-ME4 and other plant NADP-MEs via the neighbor joining method using MEGA 6.0 software. All plant NADP-MEs were classified into four groups: Group I (cytosolic eudicot types), Group II (plastidic eudicot types), Group III (monocot types), and Group IV (found in both eudicots and monocots). The C4 photosynthesis isoforms are marked with (*). Cyt, cytosolic; Chl, chloroplastic. The GenBank accession numbers and sources of the plant NADP-MEs are as follows: Aloe arborescens (CytNADP-ME1, BAA24950.1; CytNADP-ME2, BAA74735.1), Arabidopsis thaliana (CytNADP-ME1, AT2G19900.1; CytNADP-ME2, AT5G11670.1; CytNADP-ME3, AT5G25880.1; ChlNADP-ME, AT1G79750.1), Flaveria bidentis (ChlNADP-ME, AAW56450.1), Flaveria pringlei (CytNADP-ME1, AAK83073.1; CytNADP-ME2, AAK83074.1; ChlNADP-ME, P36444.1), Hydrilla verticillata (ChlNADP-ME, AY594687; CytNADP-ME2, AY594688; CytNADP-ME3, AY594689), Lycopersicon esculentum (ChlNADP-ME, AAB58727; CytNADP-ME, AAB58728), Mesembryanthemum crystallinum (NADP-ME, P37223.1), Nicotiana tabacum (ChlNADP-ME, DQ923119; CytNADP-ME, DQ923118), Oryza sativa (ChlNADP-ME, D16499; CytNADP-ME1, AB053295; CytNADP-ME2, AY435404; CytNADP-ME3, AY444338), Populus trichocarpa (CytNADP-ME1, 7461559; CytNADP-ME2, 7470734; CytNADP-ME3, 7476690; ChlNADP-ME, 7470579), Ricinus communis (ChlNADP-ME, AAF73006.1), Triticum aestivum (ChlNADP-ME, ABY25986.1; CytNADP-ME, ABW77317.1), Vitis vinifera (ChlNADP-ME, U67426; CytNADP-ME, L34836), and Zea mays (ChlNADP-ME1, J05130; ChlNADP-ME2, AY315822; CytNADP-ME1, AY104511; CytNADP-ME2, NM_001157493, CytNADP-ME 3, AY864063).
Figure 1. Phylogenetic analysis of SaNADP-ME4 and other plant NADP-MEs via the neighbor joining method using MEGA 6.0 software. All plant NADP-MEs were classified into four groups: Group I (cytosolic eudicot types), Group II (plastidic eudicot types), Group III (monocot types), and Group IV (found in both eudicots and monocots). The C4 photosynthesis isoforms are marked with (*). Cyt, cytosolic; Chl, chloroplastic. The GenBank accession numbers and sources of the plant NADP-MEs are as follows: Aloe arborescens (CytNADP-ME1, BAA24950.1; CytNADP-ME2, BAA74735.1), Arabidopsis thaliana (CytNADP-ME1, AT2G19900.1; CytNADP-ME2, AT5G11670.1; CytNADP-ME3, AT5G25880.1; ChlNADP-ME, AT1G79750.1), Flaveria bidentis (ChlNADP-ME, AAW56450.1), Flaveria pringlei (CytNADP-ME1, AAK83073.1; CytNADP-ME2, AAK83074.1; ChlNADP-ME, P36444.1), Hydrilla verticillata (ChlNADP-ME, AY594687; CytNADP-ME2, AY594688; CytNADP-ME3, AY594689), Lycopersicon esculentum (ChlNADP-ME, AAB58727; CytNADP-ME, AAB58728), Mesembryanthemum crystallinum (NADP-ME, P37223.1), Nicotiana tabacum (ChlNADP-ME, DQ923119; CytNADP-ME, DQ923118), Oryza sativa (ChlNADP-ME, D16499; CytNADP-ME1, AB053295; CytNADP-ME2, AY435404; CytNADP-ME3, AY444338), Populus trichocarpa (CytNADP-ME1, 7461559; CytNADP-ME2, 7470734; CytNADP-ME3, 7476690; ChlNADP-ME, 7470579), Ricinus communis (ChlNADP-ME, AAF73006.1), Triticum aestivum (ChlNADP-ME, ABY25986.1; CytNADP-ME, ABW77317.1), Vitis vinifera (ChlNADP-ME, U67426; CytNADP-ME, L34836), and Zea mays (ChlNADP-ME1, J05130; ChlNADP-ME2, AY315822; CytNADP-ME1, AY104511; CytNADP-ME2, NM_001157493, CytNADP-ME 3, AY864063).
Plants 10 01827 g001
Plants 10 01827 g002 550
Figure 2. Subcellular localization of SaNADP-ME4 and its expression in Salsola laricifolia. (a) Subcellular localization of SaNADP-ME4 in Arabidopsis protoplasts. Arabidopsis protoplasts isolated from 3-week-old leaves and transiently transformed with the 35S: SaNADP-ME4-GFP construct or the 35S: GFP as a control were analyzed by 16 h post transformation. Green and red fluorescence are indicative of the localization of the GFP protein and the chlorophyll, respectively. The images present GFP localization, chlorophyll localization, bright field, and a merge of the first three images. (b) The relative expression of SaNADP-ME4 in leaves, stems, and roots of S. laricifolia based on RT-qPCR. The relative expression in other tissues was normalized by that in stems, which was set to 1.0. The samples were collected from 2-month-old S. laricifolia plants at 2 h after the beginning of a photoperiod. The Sa18S of S. laricifolia was used as a suitable reference gene for RT-qPCR in different tissues. (c,d) Expression analysis of SaNADP-ME4 in the leaves of S. laricifolia under different levels of mannitol (c) and NaCl (d) stresses based on RT-qPCR. The relative expression in stress conditions was normalized by that in control condition, which was set to 1.0. Two-month-old plants were chosen. All treatments started at 2 h after the beginning of a photoperiod and lasted for 4 h. The SaEF1-α of S. laricifolia was used as a suitable reference gene for RT-qPCR in mannitol and salt stresses. Values are means ± SD (standard deviation). Asterisk indicates a significant difference at the p < 0.05 significance level, as determined with SPSS v. 19.0.
Figure 2. Subcellular localization of SaNADP-ME4 and its expression in Salsola laricifolia. (a) Subcellular localization of SaNADP-ME4 in Arabidopsis protoplasts. Arabidopsis protoplasts isolated from 3-week-old leaves and transiently transformed with the 35S: SaNADP-ME4-GFP construct or the 35S: GFP as a control were analyzed by 16 h post transformation. Green and red fluorescence are indicative of the localization of the GFP protein and the chlorophyll, respectively. The images present GFP localization, chlorophyll localization, bright field, and a merge of the first three images. (b) The relative expression of SaNADP-ME4 in leaves, stems, and roots of S. laricifolia based on RT-qPCR. The relative expression in other tissues was normalized by that in stems, which was set to 1.0. The samples were collected from 2-month-old S. laricifolia plants at 2 h after the beginning of a photoperiod. The Sa18S of S. laricifolia was used as a suitable reference gene for RT-qPCR in different tissues. (c,d) Expression analysis of SaNADP-ME4 in the leaves of S. laricifolia under different levels of mannitol (c) and NaCl (d) stresses based on RT-qPCR. The relative expression in stress conditions was normalized by that in control condition, which was set to 1.0. Two-month-old plants were chosen. All treatments started at 2 h after the beginning of a photoperiod and lasted for 4 h. The SaEF1-α of S. laricifolia was used as a suitable reference gene for RT-qPCR in mannitol and salt stresses. Values are means ± SD (standard deviation). Asterisk indicates a significant difference at the p < 0.05 significance level, as determined with SPSS v. 19.0.
Plants 10 01827 g002
Plants 10 01827 g003 550
Figure 3. The seed germination percentage and growth of WT and two overexpressing lines of Arabidopsis plants under osmotic and salt stresses. (a–c) Phenotypes of WT and two overexpressing lines treated with an MS medium (control) (a), MS medium supplied with 125 mm NaCl (b), and an MS medium supplied with 225 mm mannitol (c) for 7 days. (d–f) Effect of different levels of mannitol and NaCl stresses on germination percentage (d), root length (e), and fresh weight (f) of WT and transgenic overexpressing Arabidopsis plants after 7 days. Values are means ± SD (standard deviation). Asterisk indicates a significant difference at the p < 0.05 significance level, as determined with SPSS v. 19.0.
Figure 3. The seed germination percentage and growth of WT and two overexpressing lines of Arabidopsis plants under osmotic and salt stresses. (a–c) Phenotypes of WT and two overexpressing lines treated with an MS medium (control) (a), MS medium supplied with 125 mm NaCl (b), and an MS medium supplied with 225 mm mannitol (c) for 7 days. (d–f) Effect of different levels of mannitol and NaCl stresses on germination percentage (d), root length (e), and fresh weight (f) of WT and transgenic overexpressing Arabidopsis plants after 7 days. Values are means ± SD (standard deviation). Asterisk indicates a significant difference at the p < 0.05 significance level, as determined with SPSS v. 19.0.
Plants 10 01827 g003
Plants 10 01827 g004 550
Figure 4. SaNADP-ME4 confers NaCl and drought stress resistance. (a) The growth of WT and two overexpressing lines were compared under the control, 300 mm NaCl, and drought stress conditions for seven days. (b–d) The chlorophyll a content (b), chlorophyll b content (c), and fresh weight (d) were compared under the control, NaCl, and drought stress conditions. Values are means ± SD (standard deviation). Asterisk indicates a significant difference at the p < 0.05 significance level, as determined with SPSS v. 19.0.
Figure 4. SaNADP-ME4 confers NaCl and drought stress resistance. (a) The growth of WT and two overexpressing lines were compared under the control, 300 mm NaCl, and drought stress conditions for seven days. (b–d) The chlorophyll a content (b), chlorophyll b content (c), and fresh weight (d) were compared under the control, NaCl, and drought stress conditions. Values are means ± SD (standard deviation). Asterisk indicates a significant difference at the p < 0.05 significance level, as determined with SPSS v. 19.0.
Plants 10 01827 g004
Plants 10 01827 g005 550
Figure 5. Comparison of hydrogen peroxide (H2O2) (a), malondialdehyde (MDA) content (b), and electrolyte leakage (c) of WT and two overexpressing lines under the control, 300 mm NaCl, and drought stress conditions. Values are means ± SD (standard deviation). Asterisk indicates a significant difference at the p < 0.05 significance level, as determined with SPSS v. 19.0.
Figure 5. Comparison of hydrogen peroxide (H2O2) (a), malondialdehyde (MDA) content (b), and electrolyte leakage (c) of WT and two overexpressing lines under the control, 300 mm NaCl, and drought stress conditions. Values are means ± SD (standard deviation). Asterisk indicates a significant difference at the p < 0.05 significance level, as determined with SPSS v. 19.0.
Plants 10 01827 g005
Plants 10 01827 g006 550
Figure 6. Analysis of proline biosynthesis affected by SaNADP-ME4. (a) Comparison of the proline content of WT and two overexpressing lines under the control, 300 mm NaCl, and drought stress conditions. (b,c) Analysis of the relative expression level of pyrroline-5-carboxylate synthase (P5CS1) (b) and P5CS2 (c) under the control, NaCl, and drought stress conditions. The relative expression in stress conditions was normalized by that in control condition, which was set to 1.0. Values are means ± SD (standard deviation). Asterisks indicate a significant difference at the p < 0.05 significance level, as determined with SPSS v. 19.0.
Figure 6. Analysis of proline biosynthesis affected by SaNADP-ME4. (a) Comparison of the proline content of WT and two overexpressing lines under the control, 300 mm NaCl, and drought stress conditions. (b,c) Analysis of the relative expression level of pyrroline-5-carboxylate synthase (P5CS1) (b) and P5CS2 (c) under the control, NaCl, and drought stress conditions. The relative expression in stress conditions was normalized by that in control condition, which was set to 1.0. Values are means ± SD (standard deviation). Asterisks indicate a significant difference at the p < 0.05 significance level, as determined with SPSS v. 19.0.
Plants 10 01827 g006
Plants 10 01827 g007 550
Figure 7. Analysis of reactive oxygen species (ROS) scavenging affected by SaNADP-ME4. (a,b) Measurement of superoxide dismutase (SOD) (a) and peroxidase (POD) (b) activities among WT and two overexpression lines under the control, 300 mm NaCl, and drought stress conditions. (c–h) Analysis of the relative expression level of SOD1 (c), SOD2 (d), SOD3 (e), POD1 (f), POD2 (g), and POD3 (h) under the control, NaCl, and drought stress conditions. The relative expression in stress conditions was normalized by that in control condition, which was set to 1.0. Values are means ± SD (standard deviation). Asterisks indicate a significant difference at the p < 0.05 significance level, as determined with SPSS v. 19.0.
Figure 7. Analysis of reactive oxygen species (ROS) scavenging affected by SaNADP-ME4. (a,b) Measurement of superoxide dismutase (SOD) (a) and peroxidase (POD) (b) activities among WT and two overexpression lines under the control, 300 mm NaCl, and drought stress conditions. (c–h) Analysis of the relative expression level of SOD1 (c), SOD2 (d), SOD3 (e), POD1 (f), POD2 (g), and POD3 (h) under the control, NaCl, and drought stress conditions. The relative expression in stress conditions was normalized by that in control condition, which was set to 1.0. Values are means ± SD (standard deviation). Asterisks indicate a significant difference at the p < 0.05 significance level, as determined with SPSS v. 19.0.
Plants 10 01827 g007
Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Share and Cite

MDPI and ACS Style

Wen, Z.; Wang, Y.; Xia, C.; Zhang, Y.; Zhang, H. Chloroplastic SaNADP-ME4 of C3–C4 Woody Desert Species Salsola laricifolia Confers Drought and Salt Stress Resistance to Arabidopsis. Plants 2021, 10, 1827. https://doi.org/10.3390/plants10091827

AMA Style

Wen Z, Wang Y, Xia C, Zhang Y, Zhang H. Chloroplastic SaNADP-ME4 of C3–C4 Woody Desert Species Salsola laricifolia Confers Drought and Salt Stress Resistance to Arabidopsis. Plants. 2021; 10(9):1827. https://doi.org/10.3390/plants10091827

Chicago/Turabian Style

Wen, Zhibin, Yulan Wang, Chunlan Xia, Yuhui Zhang, and Hongxiang Zhang. 2021. "Chloroplastic SaNADP-ME4 of C3–C4 Woody Desert Species Salsola laricifolia Confers Drought and Salt Stress Resistance to Arabidopsis" Plants 10, no. 9: 1827. https://doi.org/10.3390/plants10091827

APA Style

Wen, Z., Wang, Y., Xia, C., Zhang, Y., & Zhang, H. (2021). Chloroplastic SaNADP-ME4 of C3–C4 Woody Desert Species Salsola laricifolia Confers Drought and Salt Stress Resistance to Arabidopsis. Plants, 10(9), 1827. https://doi.org/10.3390/plants10091827

Note that from the first issue of 2016, this journal uses article numbers instead of page numbers. See further details here.

Article Metrics

Back to TopTop